F430729

General Info

Members Datasets Scaffolds Average Seq Length
387 230 774 110

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100156136|Ga0070682_1001561363
Length 129
Sequence MVGMTIIKINAITVAADSGSELAKRFAARAGAIDDQDGFEGFELLQPTDDRTTWLVITRWRDEASFKAWVSSPAFGHGHRSAAERAGEKAPPPVGVHSELWSYEIAGGSAGAVTSETSSEVTGSTSATS

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
117 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
128 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
141 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
142 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
143 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
144 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
145 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
146 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
147 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
148 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
149 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
150 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
151 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
152 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
153 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 2687453743 Frankia colletiae Cc1.17 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.26
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.07
Nodule 0.26
Rhizoplane 11.37
Rhizosphere 79.33
Stem 0
Stem Tuber 0
Unclassified 4.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100156136 3300005337 Bacteria 1571
2 JGI24735J21928_10013821 3300002067 Bacteria 2532
3 JGI25405J52794_10118821 3300003911 Bacteria 595
4 Ga0070683_101715215 3300005329 Bacteria 604
5 Ga0070666_11401667 3300005335 Bacteria 522
6 Ga0070682_100194354 3300005337 Bacteria 1427
7 Ga0070682_100993812 3300005337 Bacteria 696
8 Ga0068868_100596604 3300005338 Bacteria 978
9 Ga0068868_101834895 3300005338 Bacteria 573
10 Ga0070691_10604208 3300005341 Bacteria 648
11 Ga0070671_100885048 3300005355 Bacteria 780
12 Ga0070709_10017020 3300005434 Bacteria 4163
13 Ga0070709_10122311 3300005434 Bacteria 1766
14 Ga0070714_100000419 3300005435 Bacteria 31121
15 Ga0070714_101624271 3300005435 Bacteria 631
16 Ga0070713_100024190 3300005436 Bacteria 4728
17 Ga0070713_101938461 3300005436 Bacteria 571
18 Ga0070710_10010734 3300005437 Bacteria 4504
19 Ga0070710_10142661 3300005437 Unclassified 1470
20 Ga0070711_100119589 3300005439 Unclassified 1946
21 Ga0070700_101657266 3300005441 Bacteria 548
22 Ga0070708_101825217 3300005445 Bacteria 564
23 Ga0070663_100355660 3300005455 Bacteria 1187
24 Ga0070663_101846678 3300005455 Unclassified 542
25 Ga0070678_100537420 3300005456 Bacteria 1036
26 Ga0070678_100589556 3300005456 Bacteria 991
27 Ga0068867_101439415 3300005459 Bacteria 640
28 Ga0068867_102370698 3300005459 Bacteria 505
29 Ga0070685_10555766 3300005466 Bacteria 820
30 Ga0070706_100050564 3300005467 Bacteria 3835
31 Ga0070706_100058501 3300005467 Bacteria 3557
32 Ga0070706_100080651 3300005467 Bacteria 3014
33 Ga0070706_100515584 3300005467 Bacteria 1112
34 Ga0070707_100034395 3300005468 Bacteria 4833
35 Ga0070707_100347972 3300005468 Bacteria 1439
36 Ga0070698_100032225 3300005471 Bacteria 5429
37 Ga0070698_100076057 3300005471 Bacteria 3360
38 Ga0070698_100078977 3300005471 Bacteria 3288
39 Ga0070699_100038501 3300005518 Bacteria 4140
40 Ga0070699_100249949 3300005518 Bacteria 1584
41 Ga0070684_100410699 3300005535 Bacteria 1249
42 Ga0068853_100363735 3300005539 Bacteria 1348
43 Ga0070665_100202036 3300005548 Bacteria 1988
44 Ga0070665_100719183 3300005548 Bacteria 1012
45 Ga0070664_100254639 3300005564 Bacteria 1579
46 Ga0068856_100133286 3300005614 Unclassified 2490
47 Ga0068856_100448336 3300005614 Bacteria 1311
48 Ga0070702_100916796 3300005615 Bacteria 687
49 Ga0068859_100000409 3300005617 Bacteria 42671
50 Ga0068859_102211032 3300005617 Bacteria 607
51 Ga0068864_100108980 3300005618 Bacteria 2465
52 Ga0068870_10495957 3300005840 Unclassified 813
53 Ga0068863_100045359 3300005841 Bacteria 4172
54 Ga0068863_100729628 3300005841 Bacteria 986
55 Ga0068860_100590866 3300005843 Bacteria 1115
56 Ga0081455_10000480 3300005937 Bacteria 51756
57 Ga0081455_10186573 3300005937 Bacteria 1566
58 Ga0081540_1133104 3300005983 Bacteria 1012
59 Ga0070717_10034927 3300006028 Bacteria 4066
60 Ga0070717_10099978 3300006028 Bacteria 2462
61 Ga0075363_100049430 3300006048 Bacteria 2239
62 Ga0075364_10007768 3300006051 Bacteria 6390
63 Ga0070716_101487634 3300006173 Bacteria 553
64 Ga0070712_100130617 3300006175 Bacteria 1903
65 Ga0070712_100137590 3300006175 Unclassified 1859
66 Ga0075367_10313570 3300006178 Bacteria 988
67 Ga0097621_100088273 3300006237 Bacteria 2591
68 Ga0075370_10346560 3300006353 Bacteria 887
69 Ga0068871_100063596 3300006358 Bacteria 3019
70 Ga0075428_100516370 3300006844 Bacteria 1278
71 Ga0075430_100038946 3300006846 Bacteria 4025
72 Ga0075430_100132104 3300006846 Bacteria 2081
73 Ga0075430_100334545 3300006846 Bacteria 1251
74 Ga0075430_100609913 3300006846 Bacteria 900
75 Ga0075431_101559621 3300006847 Bacteria 618
76 Ga0068865_100772196 3300006881 Bacteria 827
77 Ga0068865_100915625 3300006881 Bacteria 763
78 Ga0097620_100000409 3300006931 Bacteria 42671
79 Ga0097620_102211454 3300006931 Bacteria 607
80 Ga0105240_10050956 3300009093 Bacteria 5213
81 Ga0105240_11798635 3300009093 Bacteria 638
82 Ga0111539_11933891 3300009094 Bacteria 684
83 Ga0111539_12449860 3300009094 Bacteria 605
84 Ga0105245_10036650 3300009098 Bacteria 4358
85 Ga0105245_10080678 3300009098 Bacteria 2973
86 Ga0105245_10083330 3300009098 Bacteria 2927
87 Ga0105245_12170785 3300009098 Bacteria 609
88 Ga0105245_12376722 3300009098 Bacteria 583
89 Ga0105245_12662244 3300009098 Bacteria 553
90 Ga0105247_10012643 3300009101 Bacteria 5067
91 Ga0105247_10096646 3300009101 Bacteria 1883
92 Ga0105243_10077770 3300009148 Bacteria 2699
93 Ga0105243_10524414 3300009148 Bacteria 1127
94 Ga0105243_10896422 3300009148 Bacteria 882
95 Ga0105243_11153459 3300009148 Unclassified 786
96 Ga0105243_12183457 3300009148 Bacteria 590
97 Ga0105248_10599484 3300009177 Bacteria 1243
98 Ga0105237_10005894 3300009545 Bacteria 13742
99 Ga0105237_10299451 3300009545 Bacteria 1611
100 Ga0105237_12269558 3300009545 Bacteria 552
101 Ga0105249_10704564 3300009553 Bacteria 1070
102 Ga0105239_10003528 3300010375 Bacteria 19153
103 Ga0105239_10711677 3300010375 Bacteria 1148
104 Ga0157371_10876363 3300013102 Bacteria 680
105 Ga0157371_11340969 3300013102 Bacteria 554
106 Ga0157369_12290309 3300013105 Bacteria 547
107 Ga0157374_10123915 3300013296 Bacteria 2496
108 Ga0157374_11702161 3300013296 Bacteria 655
109 Ga0163162_10540979 3300013306 Bacteria 1293
110 Ga0157375_10066689 3300013308 Bacteria 3594
111 Ga0157375_10202558 3300013308 Unclassified 2141
112 Ga0157375_10679567 3300013308 Bacteria 1184
113 Ga0157375_11618942 3300013308 Bacteria 766
114 Ga0157375_12700592 3300013308 Bacteria 594
115 Ga0157375_13791065 3300013308 Bacteria 502
116 Ga0163163_10008316 3300014325 Bacteria 9211
117 Ga0163163_10588200 3300014325 Bacteria 1176
118 Ga0157377_10474891 3300014745 Bacteria 868
119 Ga0157377_10679319 3300014745 Bacteria 745
120 Ga0157379_10017093 3300014968 Bacteria 6386
121 Ga0157379_12237639 3300014968 Bacteria 544
122 Ga0157376_10873554 3300014969 Bacteria 916
123 Ga0206354_10581029 3300020081 Bacteria 1033
124 Ga0213875_10069298 3300021388 Bacteria 1647
125 Ga0213875_10308642 3300021388 Bacteria 749
126 Ga0207692_10011740 3300025898 Bacteria 3741
127 Ga0207692_10180202 3300025898 Bacteria 1230
128 Ga0207710_10008047 3300025900 Bacteria 4457
129 Ga0207710_10411515 3300025900 Bacteria 695
130 Ga0207688_10576145 3300025901 Bacteria 708
131 Ga0207699_10012639 3300025906 Bacteria 4299
132 Ga0207699_10012846 3300025906 Unclassified 4266
133 Ga0207643_10236556 3300025908 Bacteria 1122
134 Ga0207684_10125351 3300025910 Bacteria 2203
135 Ga0207684_10205120 3300025910 Bacteria 1701
136 Ga0207684_10356465 3300025910 Unclassified 1259
137 Ga0207684_10416903 3300025910 Bacteria 1154
138 Ga0207684_10742615 3300025910 Bacteria 832
139 Ga0207684_11437960 3300025910 Bacteria 563
140 Ga0207695_10778463 3300025913 Bacteria 837
141 Ga0207671_10032857 3300025914 Bacteria 3861
142 Ga0207671_10636457 3300025914 Bacteria 849
143 Ga0207693_10042687 3300025915 Bacteria 3570
144 Ga0207693_10273908 3300025915 Bacteria 1322
145 Ga0207663_10375354 3300025916 Bacteria 1082
146 Ga0207663_11727129 3300025916 Bacteria 503
147 Ga0207687_10039954 3300025927 Bacteria 3214
148 Ga0207687_10875140 3300025927 Bacteria 768
149 Ga0207700_10037834 3300025928 Bacteria 3498
150 Ga0207664_10104768 3300025929 Bacteria 2343
151 Ga0207664_10126524 3300025929 Bacteria 2146
152 Ga0207706_10881033 3300025933 Bacteria 757
153 Ga0207709_10567280 3300025935 Bacteria 895
154 Ga0207704_10837166 3300025938 Bacteria 770
155 Ga0207704_11926999 3300025938 Bacteria 508
156 Ga0207665_10859803 3300025939 Bacteria 718
157 Ga0207661_11436406 3300025944 Bacteria 633
158 Ga0207712_10333800 3300025961 Bacteria 1255
159 Ga0207677_11786486 3300026023 Bacteria 571
160 Ga0207677_12059439 3300026023 Bacteria 531
161 Ga0207678_10402224 3300026067 Bacteria 1186
162 Ga0207708_10358137 3300026075 Bacteria 1198
163 Ga0207702_10004610 3300026078 Bacteria 12210
164 Ga0207702_11172977 3300026078 Bacteria 762
165 Ga0207676_10579995 3300026095 Unclassified 1075
166 Ga0207675_100362265 3300026118 Bacteria 1423
167 Ga0207683_10133619 3300026121 Bacteria 2232
168 Ga0207683_10312544 3300026121 Bacteria 1438
169 Ga0207683_11754813 3300026121 Bacteria 570
170 Ga0207698_11387612 3300026142 Bacteria 718
171 Ga0268266_10309036 3300028379 Bacteria 1477
172 Ga0268266_11040010 3300028379 Bacteria 792
173 Ga0268264_10437951 3300028381 Bacteria 1264
174 Ga0265336_10006721 3300028666 Bacteria 4123
175 Ga0265338_10001637 3300028800 Bacteria 35838
176 Ga0265338_11127196 3300028800 Bacteria 528
177 Ga0307512_10040242 3300030522 Bacteria 3904
178 Ga0265327_10003384 3300031251 Bacteria 15339
179 Ga0307513_10338981 3300031456 Bacteria 1255
180 Ga0307408_100886636 3300031548 Bacteria 816
181 Ga0307405_10525507 3300031731 Bacteria 953
182 Ga0307413_10154831 3300031824 Bacteria 1602
183 Ga0307413_11094753 3300031824 Bacteria 688
184 Ga0307410_10094586 3300031852 Bacteria 2129
185 Ga0307407_10105661 3300031903 Bacteria 1757
186 Ga0307407_10118970 3300031903 Bacteria 1671
187 Ga0307412_10226346 3300031911 Bacteria 1437
188 Ga0307412_10635023 3300031911 Bacteria 909
189 Ga0307412_10812299 3300031911 Bacteria 813
190 Ga0307409_100019435 3300031995 Bacteria 4600
191 Ga0307409_100584410 3300031995 Bacteria 1101
192 Ga0307409_101151787 3300031995 Bacteria 798
193 Ga0307409_101225988 3300031995 Bacteria 774
194 Ga0307416_100116363 3300032002 Bacteria 2370
195 Ga0307416_100179300 3300032002 Bacteria 1983
196 Ga0307416_103442845 3300032002 Bacteria 529
197 Ga0307414_10199269 3300032004 Bacteria 1627
198 Ga0307411_10014635 3300032005 Bacteria 4374
199 Ga0307415_100067847 3300032126 Bacteria 2494
200 Ga0307415_100154161 3300032126 Bacteria 1772
201 Ga0307415_100179060 3300032126 Bacteria 1661
202 Ga0307415_100351676 3300032126 Bacteria 1241
203 Ga0307415_101091986 3300032126 Bacteria 746
204 Ga0307415_101600083 3300032126 Bacteria 626
205 Ga0316214_1004191 3300033545 Bacteria 1852
206 Ga0373926_0000036 3300035083 Bacteria 22135
207 Ga0373944_0000491 3300035089 Bacteria 9197
208 Ga0373923_0009520 3300035111 Bacteria 3510
209 Ga0373936_0000338 3300035113 Bacteria 15873
210 Ga0373945_0037096 3300035116 Bacteria 1748
211 Ga0373954_0237172 3300035118 Bacteria 898
212 Ga0373957_0189476 3300035120 Bacteria 854
213 Ga0373943_0001601 3300035170 Bacteria 10250
214 Ga0373946_0000090 3300035171 Bacteria 25070
215 Ga0373955_0123542 3300035172 Bacteria 1506
216 Ga0373961_0398733 3300035241 Bacteria 528
217 Ga0373962_0325152 3300035242 Bacteria 551
218 Ga0373924_0014779 3300035410 Bacteria 2954
219 Ga0373935_0001489 3300035692 Bacteria 13015
220 Ga0373935_1316595 3300035692 Bacteria 539
221 Ga0373927_0002661 3300035695 Bacteria 13016
222 Ga0373933_0758453 3300035724 Bacteria 638
223 Ga0373947_0000693 3300035725 Bacteria 20074
224 Ga0373937_0135915 3300036401 Bacteria 2299
225 Ga0373937_0242535 3300036401 Bacteria 1698
226 Ga0373925_0003394 3300037068 Bacteria 12350
227 Ga0373925_0008710 3300037068 Bacteria 7390
228 Ga0436364_0399584 3300037853 Bacteria 939
229 Ga0436364_1019607 3300037853 Bacteria 1207
230 Ga0436364_1214321 3300037853 Bacteria 715
231 Ga0436364_1260272 3300037853 Bacteria 903
232 Ga0436364_1542589 3300037853 Bacteria 2267
233 Ga0436361_0043995 3300039447 Bacteria 674
234 Ga0436363_1022559 3300039450 Bacteria 627
235 Ga0436363_1408768 3300039450 Bacteria 992
236 Ga0436362_0461311 3300039453 Bacteria 600
237 Ga0436362_0529360 3300039453 Bacteria 1217
238 Ga0436362_0596484 3300039453 Bacteria 619
239 Ga0451789_1071666 3300041443 Bacteria 7126
240 Ga0451791_1707799 3300041451 Bacteria 1066
241 Ga0451793_1131141 3300041452 Bacteria 1665
242 Ga0451797_0283703 3300041453 Bacteria 563
243 Ga0451795_0596291 3300041456 Bacteria 3624
244 Ga0451802_0149145 3300041460 Bacteria 823
245 Ga0451802_1882357 3300041460 Bacteria 584
246 Ga0451833_0783072 3300041491 Bacteria 2330
247 Ga0451833_0941972 3300041491 Bacteria 512
248 Ga0451839_0047842 3300041496 Bacteria 4259
249 Ga0451841_0007554 3300041498 Bacteria 1904
250 Ga0451845_0030687 3300041501 Bacteria 764
251 Ga0451847_0796529 3300041503 Bacteria 517
252 Ga0451851_0243602 3300041507 Bacteria 1073
253 Ga0451843_1575205 3300041509 Bacteria 1211
254 Ga0451855_1256718 3300041511 Bacteria 2425
255 Ga0451853_0271055 3300041512 Bacteria 1410
256 Ga0451853_3045459 3300041512 Bacteria 2350
257 Ga0466960_0026220 3300044901 Bacteria 2646
258 Ga0466959_0065682 3300045049 Bacteria 2633
259 Ga0495629_0089305 3300046459 Bacteria 2150
260 Ga0495629_0091164 3300046459 Bacteria 2127
261 Ga0495641_0005006 3300046461 Bacteria 9138
262 Ga0495641_0228819 3300046461 Bacteria 834
263 Ga0495651_0257530 3300046462 Bacteria 1189
264 Ga0495653_0000655 3300046463 Bacteria 26443
265 Ga0495582_0645135 3300046473 Bacteria 613
266 Ga0495662_0004638 3300046476 Bacteria 6896
267 Ga0495664_0000476 3300046477 Bacteria 19912
268 Ga0495664_0508668 3300046477 Bacteria 719
269 Ga0495608_0171672 3300046511 Bacteria 1375
270 Ga0495608_0259911 3300046511 Unclassified 1081
271 Ga0495618_0410056 3300046514 Bacteria 827
272 Ga0495628_0175123 3300046516 Bacteria 1625
273 Ga0495628_0494596 3300046516 Bacteria 884
274 Ga0495630_0066952 3300046517 Bacteria 2700
275 Ga0495630_0258118 3300046517 Bacteria 1331
276 Ga0495652_0008437 3300046529 Bacteria 9403
277 Ga0495652_0524743 3300046529 Bacteria 818
278 Ga0495652_0922352 3300046529 Bacteria 575
279 Ga0495665_0003655 3300046531 Bacteria 8349
280 Ga0495640_0049735 3300046533 Bacteria 2889
281 Ga0495587_0060014 3300046536 Bacteria 2231
282 Ga0495587_0296332 3300046536 Bacteria 905
283 Ga0495587_0361261 3300046536 Bacteria 809
284 Ga0495645_0496194 3300046543 Bacteria 764
285 Ga0495667_0000562 3300046559 Bacteria 23634
286 Ga0495667_0022867 3300046559 Bacteria 4212
287 Ga0495667_0050825 3300046559 Bacteria 2736
288 Ga0495667_0532788 3300046559 Bacteria 734
289 Ga0495634_0019058 3300046642 Bacteria 4877
290 Ga0495635_0000224 3300046663 Bacteria 35932
291 Ga0495635_0483850 3300046663 Bacteria 816
292 Ga0495588_0203563 3300046674 Bacteria 1046
293 Ga0495657_0017714 3300046675 Bacteria 5168
294 Ga0495599_0042436 3300046678 Bacteria 2854
295 Ga0495646_0198734 3300046680 Bacteria 1093
296 Ga0495646_0379756 3300046680 Bacteria 737
297 Ga0495624_0062211 3300046690 Bacteria 2336
298 Ga0495581_0055683 3300047315 Bacteria 2282
299 Ga0495581_0723118 3300047315 Bacteria 574
300 Ga0495604_0294807 3300047317 Bacteria 1091
301 Ga0495674_0000268 3300047319 Bacteria 44366
302 Ga0495674_0200797 3300047319 Bacteria 1654
303 Ga0495674_0424734 3300047319 Bacteria 1070
304 Ga0495674_0592541 3300047319 Bacteria 879
305 Ga0495674_1342626 3300047319 Bacteria 535
306 Ga0495676_0001786 3300047321 Bacteria 18785
307 Ga0495676_0365157 3300047321 Bacteria 963
308 Ga0495680_0003081 3300047322 Bacteria 16604
309 Ga0495680_0593232 3300047322 Bacteria 742
310 Ga0495675_0708098 3300047444 Bacteria 563
311 Ga0495684_0001313 3300047471 Bacteria 19993
312 Ga0495684_1007280 3300047471 Bacteria 529
313 Ga0495593_0431053 3300047673 Bacteria 660
314 Ga0495602_0692102 3300048088 Bacteria 693
315 Ga0496100_0563729 3300048903 Bacteria 882
316 Ga0496101_0014098 3300048904 Bacteria 5368
317 Ga0496101_0585617 3300048904 Bacteria 882
318 Ga0496101_0857841 3300048904 Bacteria 715
319 Ga0496101_0970151 3300048904 Bacteria 669
320 Ga0496102_0000090 3300048905 Bacteria 127346
321 Ga0496102_0104324 3300048905 Bacteria 2637
322 Ga0496102_0196632 3300048905 Bacteria 1900
323 Ga0496102_0668033 3300048905 Bacteria 962
324 Ga0496103_0000034 3300048906 Bacteria 189284
325 Ga0496103_0337660 3300048906 Bacteria 969
326 Ga0496104_0004085 3300048907 Bacteria 12667
327 Ga0496104_0070645 3300048907 Bacteria 3319
328 Ga0496105_0004508 3300048908 Bacteria 10485
329 Ga0496105_0127571 3300048908 Bacteria 2097
330 Ga0496108_0030115 3300048911 Unclassified 4498
331 Ga0496108_0077586 3300048911 Bacteria 2810
332 Ga0496108_0142313 3300048911 Bacteria 2066
333 Ga0496109_0000317 3300048912 Bacteria 45298
334 Ga0496109_0398381 3300048912 Bacteria 1300
335 Ga0496110_0025993 3300048913 Bacteria 5005
336 Ga0496110_0030791 3300048913 Unclassified 4627
337 Ga0496110_0104134 3300048913 Bacteria 2546
338 Ga0496110_0487844 3300048913 Bacteria 1122
339 Ga0496111_0034248 3300048914 Bacteria 3625
340 Ga0496111_0954143 3300048914 Bacteria 616
341 Ga0496112_0090172 3300048915 Bacteria 3035
342 Ga0496113_0049996 3300048916 Bacteria 3115
343 Ga0496114_0008953 3300048917 Bacteria 7936
344 Ga0496114_0011011 3300048917 Bacteria 7212
345 Ga0496114_0033833 3300048917 Bacteria 4214
346 Ga0496114_0326174 3300048917 Bacteria 1357
347 Ga0496114_0340140 3300048917 Bacteria 1327
348 Ga0496114_0387013 3300048917 Bacteria 1238
349 Ga0496114_1426472 3300048917 Bacteria 580
350 Ga0496115_0237196 3300048918 Bacteria 1503
351 Ga0496115_0237921 3300048918 Bacteria 1501
352 Ga0496117_0053560 3300048920 Bacteria 2834
353 Ga0496118_0088827 3300048921 Bacteria 2136
354 Ga0496119_0041936 3300048922 Bacteria 2908
355 Ga0496121_0121410 3300048924 Bacteria 1973
356 Ga0501034_0005999 3300049571 Bacteria 13142
357 Ga0501067_0391692 3300049583 Bacteria 775
358 Ga0501071_0409717 3300049587 Bacteria 1035
359 Ga0501072_1071433 3300049588 Bacteria 627
360 Ga0501075_0352359 3300049591 Bacteria 1122
361 Ga0501035_0691772 3300049822 Bacteria 823
362 Ga0501044_0280696 3300049823 Bacteria 1599
363 nmdc:mga03n38_81387_c1 3300050490 Bacteria 1522
364 nmdc:mga00v17_664015_c1 3300050491 Bacteria 670
365 nmdc:mga06z11_868786_c1 3300050494 Bacteria 549
366 nmdc:mga07m45_227017_c1 3300050496 Bacteria 1086
367 nmdc:mga05p37_1738903_c1 3300050507 Bacteria 606
368 nmdc:mga09592_1032816_c1 3300050508 Unclassified 686
369 nmdc:mga09592_519757_c1 3300050508 Bacteria 1024
370 nmdc:mga09592_734541_c1 3300050508 Bacteria 839
371 nmdc:mga0qj67_103466_c1 3300050509 Bacteria 2297
372 nmdc:mga0qj67_310090_c1 3300050509 Bacteria 1278
373 nmdc:mga0qj67_32585_c1 3300050509 Bacteria 4065
374 nmdc:mga0qj67_71588_c1 3300050509 Bacteria 2768
375 nmdc:mga06r32_158593_c1 3300050510 Bacteria 2245
376 nmdc:mga06r32_58349_c1 3300050510 Bacteria 3710
377 nmdc:mga08y16_1682128_c1 3300050511 Bacteria 590
378 nmdc:mga08y16_302080_c1 3300050511 Bacteria 1650
379 nmdc:mga0rr50_1556802_c1 3300050513 Bacteria 558
380 Ga0495601_0287316 3300053077 Bacteria 1072
381 Ga0495612_0515211 3300053078 Bacteria 549
382 Ga0495655_0018263 3300053083 Bacteria 1539
383 Ga0495595_0154186 3300053084 Bacteria 1131
384 Ga0495595_0610360 3300053084 Bacteria 558
385 Ga0495619_0124466 3300053085 Unclassified 1769
386 Ga0495619_0994534 3300053085 Bacteria 561
387 2689991467 2687453743 Bacteria 8361025
388 Ga0070682_100156136
389 JGI24735J21928_10013821
390 JGI25405J52794_10118821
391 Ga0070683_101715215
392 Ga0070666_11401667
393 Ga0070682_100194354
394 Ga0070682_100993812
395 Ga0068868_100596604
396 Ga0068868_101834895
397 Ga0070691_10604208
398 Ga0070671_100885048
399 Ga0070709_10017020
400 Ga0070709_10122311
401 Ga0070714_100000419
402 Ga0070714_101624271
403 Ga0070713_100024190
404 Ga0070713_101938461
405 Ga0070710_10010734
406 Ga0070710_10142661
407 Ga0070711_100119589
408 Ga0070700_101657266
409 Ga0070708_101825217
410 Ga0070663_100355660
411 Ga0070663_101846678
412 Ga0070678_100537420
413 Ga0070678_100589556
414 Ga0068867_101439415
415 Ga0068867_102370698
416 Ga0070685_10555766
417 Ga0070706_100050564
418 Ga0070706_100058501
419 Ga0070706_100080651
420 Ga0070706_100515584
421 Ga0070707_100034395
422 Ga0070707_100347972
423 Ga0070698_100032225
424 Ga0070698_100076057
425 Ga0070698_100078977
426 Ga0070699_100038501
427 Ga0070699_100249949
428 Ga0070684_100410699
429 Ga0068853_100363735
430 Ga0070665_100202036
431 Ga0070665_100719183
432 Ga0070664_100254639
433 Ga0068856_100133286
434 Ga0068856_100448336
435 Ga0070702_100916796
436 Ga0068859_100000409
437 Ga0068859_102211032
438 Ga0068864_100108980
439 Ga0068870_10495957
440 Ga0068863_100045359
441 Ga0068863_100729628
442 Ga0068860_100590866
443 Ga0081455_10000480
444 Ga0081455_10186573
445 Ga0081540_1133104
446 Ga0070717_10034927
447 Ga0070717_10099978
448 Ga0075363_100049430
449 Ga0075364_10007768
450 Ga0070716_101487634
451 Ga0070712_100130617
452 Ga0070712_100137590
453 Ga0075367_10313570
454 Ga0097621_100088273
455 Ga0075370_10346560
456 Ga0068871_100063596
457 Ga0075428_100516370
458 Ga0075430_100038946
459 Ga0075430_100132104
460 Ga0075430_100334545
461 Ga0075430_100609913
462 Ga0075431_101559621
463 Ga0068865_100772196
464 Ga0068865_100915625
465 Ga0097620_100000409
466 Ga0097620_102211454
467 Ga0105240_10050956
468 Ga0105240_11798635
469 Ga0111539_11933891
470 Ga0111539_12449860
471 Ga0105245_10036650
472 Ga0105245_10080678
473 Ga0105245_10083330
474 Ga0105245_12170785
475 Ga0105245_12376722
476 Ga0105245_12662244
477 Ga0105247_10012643
478 Ga0105247_10096646
479 Ga0105243_10077770
480 Ga0105243_10524414
481 Ga0105243_10896422
482 Ga0105243_11153459
483 Ga0105243_12183457
484 Ga0105248_10599484
485 Ga0105237_10005894
486 Ga0105237_10299451
487 Ga0105237_12269558
488 Ga0105249_10704564
489 Ga0105239_10003528
490 Ga0105239_10711677
491 Ga0157371_10876363
492 Ga0157371_11340969
493 Ga0157369_12290309
494 Ga0157374_10123915
495 Ga0157374_11702161
496 Ga0163162_10540979
497 Ga0157375_10066689
498 Ga0157375_10202558
499 Ga0157375_10679567
500 Ga0157375_11618942
501 Ga0157375_12700592
502 Ga0157375_13791065
503 Ga0163163_10008316
504 Ga0163163_10588200
505 Ga0157377_10474891
506 Ga0157377_10679319
507 Ga0157379_10017093
508 Ga0157379_12237639
509 Ga0157376_10873554
510 Ga0206354_10581029
511 Ga0213875_10069298
512 Ga0213875_10308642
513 Ga0207692_10011740
514 Ga0207692_10180202
515 Ga0207710_10008047
516 Ga0207710_10411515
517 Ga0207688_10576145
518 Ga0207699_10012639
519 Ga0207699_10012846
520 Ga0207643_10236556
521 Ga0207684_10125351
522 Ga0207684_10205120
523 Ga0207684_10356465
524 Ga0207684_10416903
525 Ga0207684_10742615
526 Ga0207684_11437960
527 Ga0207695_10778463
528 Ga0207671_10032857
529 Ga0207671_10636457
530 Ga0207693_10042687
531 Ga0207693_10273908
532 Ga0207663_10375354
533 Ga0207663_11727129
534 Ga0207687_10039954
535 Ga0207687_10875140
536 Ga0207700_10037834
537 Ga0207664_10104768
538 Ga0207664_10126524
539 Ga0207706_10881033
540 Ga0207709_10567280
541 Ga0207704_10837166
542 Ga0207704_11926999
543 Ga0207665_10859803
544 Ga0207661_11436406
545 Ga0207712_10333800
546 Ga0207677_11786486
547 Ga0207677_12059439
548 Ga0207678_10402224
549 Ga0207708_10358137
550 Ga0207702_10004610
551 Ga0207702_11172977
552 Ga0207676_10579995
553 Ga0207675_100362265
554 Ga0207683_10133619
555 Ga0207683_10312544
556 Ga0207683_11754813
557 Ga0207698_11387612
558 Ga0268266_10309036
559 Ga0268266_11040010
560 Ga0268264_10437951
561 Ga0265336_10006721
562 Ga0265338_10001637
563 Ga0265338_11127196
564 Ga0307512_10040242
565 Ga0265327_10003384
566 Ga0307513_10338981
567 Ga0307408_100886636
568 Ga0307405_10525507
569 Ga0307413_10154831
570 Ga0307413_11094753
571 Ga0307410_10094586
572 Ga0307407_10105661
573 Ga0307407_10118970
574 Ga0307412_10226346
575 Ga0307412_10635023
576 Ga0307412_10812299
577 Ga0307409_100019435
578 Ga0307409_100584410
579 Ga0307409_101151787
580 Ga0307409_101225988
581 Ga0307416_100116363
582 Ga0307416_100179300
583 Ga0307416_103442845
584 Ga0307414_10199269
585 Ga0307411_10014635
586 Ga0307415_100067847
587 Ga0307415_100154161
588 Ga0307415_100179060
589 Ga0307415_100351676
590 Ga0307415_101091986
591 Ga0307415_101600083
592 Ga0316214_1004191
593 Ga0373926_0000036
594 Ga0373944_0000491
595 Ga0373923_0009520
596 Ga0373936_0000338
597 Ga0373945_0037096
598 Ga0373954_0237172
599 Ga0373957_0189476
600 Ga0373943_0001601
601 Ga0373946_0000090
602 Ga0373955_0123542
603 Ga0373961_0398733
604 Ga0373962_0325152
605 Ga0373924_0014779
606 Ga0373935_0001489
607 Ga0373935_1316595
608 Ga0373927_0002661
609 Ga0373933_0758453
610 Ga0373947_0000693
611 Ga0373937_0135915
612 Ga0373937_0242535
613 Ga0373925_0003394
614 Ga0373925_0008710
615 Ga0436364_0399584
616 Ga0436364_1019607
617 Ga0436364_1214321
618 Ga0436364_1260272
619 Ga0436364_1542589
620 Ga0436361_0043995
621 Ga0436363_1022559
622 Ga0436363_1408768
623 Ga0436362_0461311
624 Ga0436362_0529360
625 Ga0436362_0596484
626 Ga0451789_1071666
627 Ga0451791_1707799
628 Ga0451793_1131141
629 Ga0451797_0283703
630 Ga0451795_0596291
631 Ga0451802_0149145
632 Ga0451802_1882357
633 Ga0451833_0783072
634 Ga0451833_0941972
635 Ga0451839_0047842
636 Ga0451841_0007554
637 Ga0451845_0030687
638 Ga0451847_0796529
639 Ga0451851_0243602
640 Ga0451843_1575205
641 Ga0451855_1256718
642 Ga0451853_0271055
643 Ga0451853_3045459
644 Ga0466960_0026220
645 Ga0466959_0065682
646 Ga0495629_0089305
647 Ga0495629_0091164
648 Ga0495641_0005006
649 Ga0495641_0228819
650 Ga0495651_0257530
651 Ga0495653_0000655
652 Ga0495582_0645135
653 Ga0495662_0004638
654 Ga0495664_0000476
655 Ga0495664_0508668
656 Ga0495608_0171672
657 Ga0495608_0259911
658 Ga0495618_0410056
659 Ga0495628_0175123
660 Ga0495628_0494596
661 Ga0495630_0066952
662 Ga0495630_0258118
663 Ga0495652_0008437
664 Ga0495652_0524743
665 Ga0495652_0922352
666 Ga0495665_0003655
667 Ga0495640_0049735
668 Ga0495587_0060014
669 Ga0495587_0296332
670 Ga0495587_0361261
671 Ga0495645_0496194
672 Ga0495667_0000562
673 Ga0495667_0022867
674 Ga0495667_0050825
675 Ga0495667_0532788
676 Ga0495634_0019058
677 Ga0495635_0000224
678 Ga0495635_0483850
679 Ga0495588_0203563
680 Ga0495657_0017714
681 Ga0495599_0042436
682 Ga0495646_0198734
683 Ga0495646_0379756
684 Ga0495624_0062211
685 Ga0495581_0055683
686 Ga0495581_0723118
687 Ga0495604_0294807
688 Ga0495674_0000268
689 Ga0495674_0200797
690 Ga0495674_0424734
691 Ga0495674_0592541
692 Ga0495674_1342626
693 Ga0495676_0001786
694 Ga0495676_0365157
695 Ga0495680_0003081
696 Ga0495680_0593232
697 Ga0495675_0708098
698 Ga0495684_0001313
699 Ga0495684_1007280
700 Ga0495593_0431053
701 Ga0495602_0692102
702 Ga0496100_0563729
703 Ga0496101_0014098
704 Ga0496101_0585617
705 Ga0496101_0857841
706 Ga0496101_0970151
707 Ga0496102_0000090
708 Ga0496102_0104324
709 Ga0496102_0196632
710 Ga0496102_0668033
711 Ga0496103_0000034
712 Ga0496103_0337660
713 Ga0496104_0004085
714 Ga0496104_0070645
715 Ga0496105_0004508
716 Ga0496105_0127571
717 Ga0496108_0030115
718 Ga0496108_0077586
719 Ga0496108_0142313
720 Ga0496109_0000317
721 Ga0496109_0398381
722 Ga0496110_0025993
723 Ga0496110_0030791
724 Ga0496110_0104134
725 Ga0496110_0487844
726 Ga0496111_0034248
727 Ga0496111_0954143
728 Ga0496112_0090172
729 Ga0496113_0049996
730 Ga0496114_0008953
731 Ga0496114_0011011
732 Ga0496114_0033833
733 Ga0496114_0326174
734 Ga0496114_0340140
735 Ga0496114_0387013
736 Ga0496114_1426472
737 Ga0496115_0237196
738 Ga0496115_0237921
739 Ga0496117_0053560
740 Ga0496118_0088827
741 Ga0496119_0041936
742 Ga0496121_0121410
743 Ga0501034_0005999
744 Ga0501067_0391692
745 Ga0501071_0409717
746 Ga0501072_1071433
747 Ga0501075_0352359
748 Ga0501035_0691772
749 Ga0501044_0280696
750 nmdc:mga03n38_81387_c1
751 nmdc:mga00v17_664015_c1
752 nmdc:mga06z11_868786_c1
753 nmdc:mga07m45_227017_c1
754 nmdc:mga05p37_1738903_c1
755 nmdc:mga09592_1032816_c1
756 nmdc:mga09592_519757_c1
757 nmdc:mga09592_734541_c1
758 nmdc:mga0qj67_103466_c1
759 nmdc:mga0qj67_310090_c1
760 nmdc:mga0qj67_32585_c1
761 nmdc:mga0qj67_71588_c1
762 nmdc:mga06r32_158593_c1
763 nmdc:mga06r32_58349_c1
764 nmdc:mga08y16_1682128_c1
765 nmdc:mga08y16_302080_c1
766 nmdc:mga0rr50_1556802_c1
767 Ga0495601_0287316
768 Ga0495612_0515211
769 Ga0495655_0018263
770 Ga0495595_0154186
771 Ga0495595_0610360
772 Ga0495619_0124466
773 Ga0495619_0994534
774 2689991467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

5

81

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tvz-assembly3.cif.gz_C structure of bacillus subtilis hmob 0.9129 2 66
5uq4-assembly1.cif.gz_A crystal structure of heme-degrading protein rv3592 from mycobacterium tuberculosis - heme free with cleaved protein 0.8959 1 107
6ds8-assembly1.cif.gz_B crystal structure of mhud r26s mutant with two manganese protoporphyrin ix bound per active site 0.8947 3 107
3tvz-assembly2.cif.gz_B structure of bacillus subtilis hmob 0.8934 2 68
5uq4-assembly1.cif.gz_A crystal structure of heme-degrading protein rv3592 from mycobacterium tuberculosis - heme free with cleaved protein 0.8861 1 107
ID Description Score Start End Superfamily
5uq4A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8959 1 107 3.30.70.100
5uq4A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8861 1 107 3.30.70.100
af_P9WLA3_32_98_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8732 6 68 3.10.450.240
1iujA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8719 3 107 3.30.70.100
3hx9B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8646 3 107 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A853DAM6-F1-model_v4 Heme-degrading monooxygenase HmoA 0.9779 1 107 GO:0004497
AF-A0A4U6QJV0-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9542 1 108 GO:0004497
AF-A0A853DAM6-F1-model_v4 Heme-degrading monooxygenase HmoA 0.9433 1 107 GO:0004497
AF-A0A4U6QJV0-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9293 1 108 GO:0004497
AF-A0A4P8HCD7-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.925 1 107 GO:0004497

Map