F430498

General Info

Members Datasets Scaffolds Average Seq Length
386 217 382 207

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10357169|Ga0105238_103571693
Length 249
Sequence MGRVYTPKRDETPHQLLKKWLTAASLTPLAAPSYGRAQLGKGNPMKLHVSIGPNPRTVKMFLAEKGLQIPFVSVDLMAGENRREPYNVSVNPAGQTPALELDDGSCLTEITAICEYVEERQPNPPLIGTTAEERAATRMWTRRVDLKICEPMANGFRFAEGLPLFESRMRCLPEAAAGLKAVAKDGEQWVEDHFHGPWIAGERFTLADILLFCFLDFGAQVGQPLDPAFGKLTDWFGRVKARPSATASA

Samples

Sample ID Description Type Environment
1 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
2 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
3 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
4 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
5 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
210 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
211 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
212 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
215 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
216 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.63
Metatranscriptomes 2.07
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.74
Nodule 0
Rhizoplane 2.07
Rhizosphere 87.31
Stem 0
Stem Tuber 0
Unclassified 3.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10024904 3300001979 Bacteria 2023
2 rootH2_10013173 3300003320 Bacteria 22330
3 rootH1_10047640 3300003316 Bacteria 1334
4 rootH1_10047640 3300003323 Bacteria 2215
5 Ga0055536_1001633 3300003781 Bacteria 13334
6 Ga0055536_1003840 3300003781 Bacteria 7906
7 Ga0055536_1005691 3300003781 Bacteria 6017
8 Ga0055530_10000749 3300003791 Bacteria 26983
9 Ga0055531_10007137 3300003794 Bacteria 6162
10 Ga0055531_10023952 3300003794 Bacteria 2270
11 Ga0070658_10070905 3300005327 Bacteria 2853
12 Ga0070658_10177766 3300005327 Bacteria 1790
13 Ga0070658_10261971 3300005327 Bacteria 1468
14 Ga0070658_10308674 3300005327 Bacteria 1350
15 Ga0070658_10329061 3300005327 Bacteria 1305
16 Ga0070658_10727661 3300005327 Bacteria 862
17 Ga0070683_100120869 3300005329 Bacteria 2474
18 Ga0070683_100668979 3300005329 Bacteria 994
19 Ga0070680_100016529 3300005336 Bacteria 5806
20 Ga0070680_100045166 3300005336 Bacteria 3581
21 Ga0070680_100348829 3300005336 Bacteria 1258
22 Ga0070682_100133756 3300005337 Bacteria 1681
23 Ga0070660_100037059 3300005339 Bacteria 3696
24 Ga0070660_100195487 3300005339 Bacteria 1639
25 Ga0070660_100247033 3300005339 Bacteria 1454
26 Ga0070660_100501282 3300005339 Bacteria 1010
27 Ga0070660_100581638 3300005339 Bacteria 935
28 Ga0070691_10001568 3300005341 Bacteria 9868
29 Ga0070691_10013327 3300005341 Bacteria 3766
30 Ga0070661_100000046 3300005344 Bacteria 92262
31 Ga0070661_100000071 3300005344 Bacteria 82723
32 Ga0070661_100030965 3300005344 Bacteria 3867
33 Ga0070661_100797047 3300005344 Bacteria 775
34 Ga0070692_10009052 3300005345 Bacteria 4471
35 Ga0070692_10552849 3300005345 Bacteria 754
36 Ga0070669_100361144 3300005353 Bacteria 1181
37 Ga0070673_100077397 3300005364 Bacteria 2688
38 Ga0070659_100000180 3300005366 Bacteria 48763
39 Ga0070659_100009643 3300005366 Bacteria 7096
40 Ga0070659_100009976 3300005366 Bacteria 6986
41 Ga0070659_100308755 3300005366 Bacteria 1320
42 Ga0070709_10365267 3300005434 Bacteria 1070
43 Ga0070710_10212893 3300005437 Bacteria 1226
44 Ga0070663_100006343 3300005455 Bacteria 7102
45 Ga0070663_100850096 3300005455 Bacteria 785
46 Ga0070678_100051288 3300005456 Bacteria 2990
47 Ga0070681_10007148 3300005458 Bacteria 10878
48 Ga0070681_10052233 3300005458 Bacteria 4076
49 Ga0070706_100355169 3300005467 Bacteria 1366
50 Ga0070698_100251905 3300005471 Bacteria 1698
51 Ga0070699_100684872 3300005518 Bacteria 936
52 Ga0070679_100051244 3300005530 Bacteria 4111
53 Ga0070679_100130083 3300005530 Bacteria 2498
54 Ga0070684_100095693 3300005535 Bacteria 2646
55 Ga0068853_100003636 3300005539 Bacteria 11823
56 Ga0070696_100007859 3300005546 Bacteria 7120
57 Ga0070696_100055978 3300005546 Bacteria 2750
58 Ga0070696_100349154 3300005546 Bacteria 1145
59 Ga0070665_100000494 3300005548 Bacteria 56412
60 Ga0070665_100724064 3300005548 Bacteria 1008
61 Ga0070704_100318101 3300005549 Bacteria 1303
62 Ga0068855_100010766 3300005563 Bacteria 11041
63 Ga0068855_100060296 3300005563 Bacteria 4438
64 Ga0068855_100382749 3300005563 Bacteria 1544
65 Ga0070664_100266086 3300005564 Bacteria 1543
66 Ga0068857_100272907 3300005577 Bacteria 1554
67 Ga0068857_101199230 3300005577 Bacteria 735
68 Ga0068854_100329282 3300005578 Bacteria 1244
69 Ga0068854_100501199 3300005578 Bacteria 1022
70 Ga0068856_100239335 3300005614 Bacteria 1830
71 Ga0068856_100253194 3300005614 Bacteria 1776
72 Ga0068852_100245471 3300005616 Bacteria 1713
73 Ga0068852_100255032 3300005616 Bacteria 1682
74 Ga0068859_100512589 3300005617 Bacteria 1294
75 Ga0068864_100002705 3300005618 Bacteria 14603
76 Ga0068864_100073458 3300005618 Bacteria 2982
77 Ga0068851_10108821 3300005834 Bacteria 1478
78 Ga0068863_100077309 3300005841 Bacteria 3150
79 Ga0068863_100132189 3300005841 Bacteria 2383
80 Ga0068858_100078046 3300005842 Bacteria 3077
81 Ga0068860_100146410 3300005843 Bacteria 2273
82 Ga0068860_101019145 3300005843 Bacteria 846
83 Ga0068862_100248906 3300005844 Bacteria 1619
84 Ga0068862_100275556 3300005844 Unclassified 1540
85 Ga0070712_100000367 3300006175 Bacteria 25540
86 Ga0097621_100443177 3300006237 Bacteria 1169
87 Ga0068871_100344490 3300006358 Bacteria 1317
88 Ga0075428_100052958 3300006844 Bacteria 4446
89 Ga0075428_100110000 3300006844 Bacteria 3002
90 Ga0075430_100362022 3300006846 Bacteria 1198
91 Ga0075430_100509603 3300006846 Bacteria 993
92 Ga0075431_100052018 3300006847 Bacteria 4224
93 Ga0075434_100616213 3300006871 Unclassified 1104
94 Ga0075429_100373884 3300006880 Bacteria 1248
95 Ga0097620_100512601 3300006931 Bacteria 1294
96 Ga0105240_10005403 3300009093 Bacteria 19048
97 Ga0105240_10049470 3300009093 Bacteria 5305
98 Ga0105240_10220634 3300009093 Bacteria 2209
99 Ga0105240_10675047 3300009093 Bacteria 1130
100 Ga0105243_10656006 3300009148 Unclassified 1017
101 Ga0105241_10094238 3300009174 Bacteria 2368
102 Ga0105242_11164324 3300009176 Bacteria 788
103 Ga0105248_10078987 3300009177 Bacteria 3698
104 Ga0105248_10194096 3300009177 Bacteria 2288
105 Ga0105237_10116576 3300009545 Bacteria 2664
106 Ga0105238_10022124 3300009551 Bacteria 6483
107 Ga0105238_10033400 3300009551 Bacteria 5237
108 Ga0105238_10038915 3300009551 Bacteria 4827
109 Ga0105238_10357169 3300009551 Bacteria 1450
110 Ga0105238_10420848 3300009551 Bacteria 1331
111 Ga0105249_10030591 3300009553 Bacteria 4868
112 Ga0105249_10916020 3300009553 Bacteria 944
113 Ga0105239_10255861 3300010375 Bacteria 1967
114 Ga0157371_10078514 3300013102 Bacteria 2338
115 Ga0157370_10009873 3300013104 Bacteria 10116
116 Ga0157370_10066597 3300013104 Bacteria 3406
117 Ga0157370_10178155 3300013104 Bacteria 1976
118 Ga0157370_10863096 3300013104 Bacteria 822
119 Ga0157369_10347581 3300013105 Bacteria 1540
120 Ga0157369_10540144 3300013105 Bacteria 1205
121 Ga0157374_10120433 3300013296 Bacteria 2532
122 Ga0163162_10031864 3300013306 Bacteria 5231
123 Ga0163162_10116700 3300013306 Bacteria 2770
124 Ga0163162_10341552 3300013306 Bacteria 1630
125 Ga0163162_10524459 3300013306 Bacteria 1314
126 Ga0157372_10011587 3300013307 Bacteria 9383
127 Ga0157372_10266305 3300013307 Bacteria 1990
128 Ga0157375_10169396 3300013308 Bacteria 2331
129 Ga0163163_10227535 3300014325 Bacteria 1914
130 Ga0163163_10325818 3300014325 Bacteria 1590
131 Ga0163163_10335455 3300014325 Bacteria 1567
132 Ga0157379_10378245 3300014968 Bacteria 1299
133 Ga0157379_10496955 3300014968 Bacteria 1130
134 Ga0206356_11148188 3300020070 Bacteria 1757
135 Ga0206351_10931970 3300020077 Bacteria 3715
136 Ga0206352_10188214 3300020078 Bacteria 2830
137 Ga0206350_10713402 3300020080 Bacteria 1975
138 Ga0206354_11241761 3300020081 Bacteria 2512
139 Ga0206353_11090799 3300020082 Bacteria 1377
140 Ga0154015_1102430 3300020610 Bacteria 2360
141 Ga0213872_10006976 3300021361 Bacteria 5604
142 Ga0213872_10032825 3300021361 Bacteria 2379
143 Ga0213872_10180286 3300021361 Bacteria 913
144 Ga0213876_10000381 3300021384 Bacteria 37556
145 Ga0224712_10011674 3300022467 Bacteria 2735
146 Ga0209026_1000772 3300025250 Bacteria 17898
147 Ga0209675_1001281 3300025291 Bacteria 15005
148 Ga0209676_1000384 3300025292 Bacteria 81053
149 Ga0209676_1000475 3300025292 Bacteria 66299
150 Ga0209676_1035818 3300025292 Bacteria 1451
151 Ga0209025_1013031 3300025294 Bacteria 5262
152 Ga0209025_1083756 3300025294 Bacteria 1071
153 Ga0209758_1076715 3300025297 Bacteria 1027
154 Ga0209050_1000132 3300025298 Bacteria 185906
155 Ga0209050_1051830 3300025298 Bacteria 1031
156 Ga0209257_1000176 3300025304 Bacteria 161436
157 Ga0209257_1002954 3300025304 Bacteria 15592
158 Ga0209257_1004939 3300025304 Bacteria 9785
159 Ga0207710_10304628 3300025900 Unclassified 805
160 Ga0207647_10003196 3300025904 Bacteria 12288
161 Ga0207705_10000345 3300025909 Bacteria 41860
162 Ga0207705_10000478 3300025909 Bacteria 34357
163 Ga0207705_10036759 3300025909 Bacteria 3504
164 Ga0207705_10174691 3300025909 Bacteria 1619
165 Ga0207705_10271631 3300025909 Bacteria 1296
166 Ga0207705_10474511 3300025909 Bacteria 971
167 Ga0207654_10153386 3300025911 Bacteria 1481
168 Ga0207707_10011010 3300025912 Bacteria 7870
169 Ga0207707_10022214 3300025912 Bacteria 5546
170 Ga0207707_10063317 3300025912 Bacteria 3219
171 Ga0207695_10000766 3300025913 Bacteria 61318
172 Ga0207695_10012899 3300025913 Bacteria 10000
173 Ga0207695_10070892 3300025913 Bacteria 3561
174 Ga0207695_10153147 3300025913 Unclassified 2243
175 Ga0207695_10414065 3300025913 Bacteria 1232
176 Ga0207693_10002178 3300025915 Bacteria 17072
177 Ga0207663_10434071 3300025916 Bacteria 1010
178 Ga0207660_10002364 3300025917 Bacteria 12421
179 Ga0207660_10007009 3300025917 Bacteria 7299
180 Ga0207660_10051542 3300025917 Bacteria 2926
181 Ga0207660_10136183 3300025917 Bacteria 1874
182 Ga0207657_10004072 3300025919 Bacteria 15518
183 Ga0207657_10010723 3300025919 Bacteria 9125
184 Ga0207657_10079119 3300025919 Bacteria 2766
185 Ga0207657_10151521 3300025919 Bacteria 1888
186 Ga0207649_10000029 3300025920 Bacteria 156557
187 Ga0207649_10000072 3300025920 Bacteria 87103
188 Ga0207649_10016121 3300025920 Bacteria 4209
189 Ga0207652_10001639 3300025921 Bacteria 19640
190 Ga0207652_10049453 3300025921 Bacteria 3599
191 Ga0207652_10091343 3300025921 Bacteria 2677
192 Ga0207646_10877149 3300025922 Bacteria 797
193 Ga0207694_10024379 3300025924 Bacteria 4594
194 Ga0207694_10054075 3300025924 Bacteria 3114
195 Ga0207694_10055111 3300025924 Bacteria 3086
196 Ga0207694_10550789 3300025924 Bacteria 968
197 Ga0207694_10582293 3300025924 Bacteria 941
198 Ga0207650_10078456 3300025925 Bacteria 2498
199 Ga0207700_10320424 3300025928 Bacteria 1343
200 Ga0207664_10384051 3300025929 Bacteria 1247
201 Ga0207644_10438827 3300025931 Unclassified 1071
202 Ga0207690_10000158 3300025932 Bacteria 53051
203 Ga0207690_10008499 3300025932 Bacteria 6090
204 Ga0207690_10727449 3300025932 Bacteria 817
205 Ga0207711_10317432 3300025941 Bacteria 1439
206 Ga0207711_10858680 3300025941 Bacteria 844
207 Ga0207661_10030262 3300025944 Bacteria 4168
208 Ga0207679_10191540 3300025945 Bacteria 1701
209 Ga0207667_10024661 3300025949 Bacteria 6598
210 Ga0207667_10050753 3300025949 Bacteria 4376
211 Ga0207667_10082618 3300025949 Bacteria 3327
212 Ga0207667_10091780 3300025949 Bacteria 3137
213 Ga0207667_10231658 3300025949 Bacteria 1891
214 Ga0207712_10021477 3300025961 Bacteria 4239
215 Ga0207668_10405094 3300025972 Bacteria 1154
216 Ga0207640_10047023 3300025981 Bacteria 2780
217 Ga0207639_10049148 3300026041 Bacteria 3196
218 Ga0207678_10686790 3300026067 Bacteria 900
219 Ga0207702_10012829 3300026078 Bacteria 6972
220 Ga0207702_10284674 3300026078 Bacteria 1564
221 Ga0207641_10088664 3300026088 Bacteria 2702
222 Ga0207641_10124470 3300026088 Bacteria 2306
223 Ga0207641_10130921 3300026088 Unclassified 2253
224 Ga0207676_10032312 3300026095 Bacteria 3943
225 Ga0207676_10571044 3300026095 Bacteria 1083
226 Ga0207674_10529716 3300026116 Bacteria 1138
227 Ga0207675_100497918 3300026118 Bacteria 1213
228 Ga0207683_10053597 3300026121 Bacteria 3537
229 Ga0207698_10145834 3300026142 Bacteria 2047
230 Ga0268266_10000003 3300028379 Bacteria 1701703
231 Ga0268265_10181433 3300028380 Unclassified 1809
232 Ga0268265_10187723 3300028380 Bacteria 1782
233 Ga0268264_10018522 3300028381 Bacteria 5695
234 Ga0307517_10004204 3300028786 Bacteria 22199
235 Ga0265338_10096570 3300028800 Bacteria 2424
236 Ga0265328_10075302 3300031239 Bacteria 1242
237 Ga0265320_10093431 3300031240 Bacteria 1392
238 Ga0265340_10003302 3300031247 Bacteria 9144
239 Ga0265340_10023218 3300031247 Bacteria 3164
240 Ga0265340_10075853 3300031247 Bacteria 1588
241 Ga0265331_10000006 3300031250 Bacteria 418907
242 Ga0265331_10012974 3300031250 Bacteria 4492
243 Ga0265327_10000052 3300031251 Bacteria 256602
244 Ga0265327_10000454 3300031251 Bacteria 73503
245 Ga0307513_10027712 3300031456 Bacteria 6496
246 Ga0307408_100376010 3300031548 Bacteria 1213
247 Ga0265314_10051839 3300031711 Bacteria 2856
248 Ga0265314_10052353 3300031711 Bacteria 2838
249 Ga0265314_10093716 3300031711 Bacteria 1949
250 Ga0265314_10194832 3300031711 Bacteria 1203
251 Ga0307413_10019677 3300031824 Bacteria 3573
252 Ga0307413_10490370 3300031824 Bacteria 984
253 Ga0307410_10028856 3300031852 Bacteria 3525
254 Ga0307407_10015477 3300031903 Bacteria 3773
255 Ga0307412_10456365 3300031911 Bacteria 1054
256 Ga0307409_100023536 3300031995 Bacteria 4272
257 Ga0307414_10001847 3300032004 Bacteria 10959
258 Ga0307414_10003420 3300032004 Bacteria 8469
259 Ga0307414_10133311 3300032004 Bacteria 1932
260 Ga0307414_10383130 3300032004 Bacteria 1216
261 Ga0307414_11364891 3300032004 Bacteria 658
262 Ga0307411_10032011 3300032005 Bacteria 3244
263 Ga0307411_10193413 3300032005 Bacteria 1555
264 Ga0373943_0445884 3300035170 Bacteria 752
265 Ga0373931_0093515 3300035691 Bacteria 1679
266 Ga0373927_0005192 3300035695 Bacteria 9004
267 Ga0373947_0214758 3300035725 Bacteria 1263
268 Ga0373937_0002756 3300036401 Bacteria 14659
269 Ga0373925_0133107 3300037068 Bacteria 1940
270 Ga0395900_0227272 3300037418 Bacteria 1878
271 Ga0395900_0311728 3300037418 Bacteria 1556
272 Ga0395898_0653336 3300037466 Bacteria 994
273 Ga0395905_0253470 3300037471 Bacteria 1644
274 Ga0400483_113347 3300039062 Unclassified 2304
275 Ga0436365_1004240 3300039437 Bacteria 80154
276 Ga0436361_0242079 3300039447 Bacteria 15971
277 Ga0436361_0603297 3300039447 Bacteria 3111
278 Ga0436361_0726854 3300039447 Bacteria 822
279 Ga0436362_0878090 3300039453 Bacteria 1422
280 Ga0466966_0042551 3300044684 Bacteria 2915
281 Ga0466968_0187168 3300044735 Bacteria 965
282 Ga0466959_0068906 3300045049 Bacteria 2563
283 Ga0495642_0001185 3300046528 Bacteria 11976
284 Ga0495621_0033885 3300046539 Bacteria 1763
285 Ga0495645_0220794 3300046543 Bacteria 1275
286 Ga0495668_0037493 3300046616 Bacteria 2712
287 Ga0495625_0001754 3300046660 Bacteria 25090
288 Ga0495600_0183275 3300046809 Bacteria 1349
289 Ga0495672_0280342 3300047320 Bacteria 797
290 Ga0496101_0413077 3300048904 Bacteria 1063
291 Ga0496102_0231612 3300048905 Bacteria 1741
292 Ga0496104_0365931 3300048907 Bacteria 1354
293 Ga0496106_0219450 3300048909 Bacteria 1516
294 Ga0496109_0006856 3300048912 Bacteria 9609
295 Ga0496115_0000107 3300048918 Bacteria 76028
296 Ga0496115_0046020 3300048918 Bacteria 3485
297 Ga0496115_0114973 3300048918 Bacteria 2212
298 Ga0496121_0039563 3300048924 Bacteria 4151
299 Ga0496125_0069643 3300048928 Bacteria 2759
300 Ga0496126_0001155 3300048929 Bacteria 43745
301 Ga0496126_0044628 3300048929 Bacteria 4080
302 Ga0501031_0058418 3300049568 Bacteria 2513
303 Ga0501032_0011402 3300049569 Bacteria 6385
304 Ga0501032_0045923 3300049569 Bacteria 2953
305 Ga0501032_0154672 3300049569 Bacteria 1507
306 Ga0501033_0004349 3300049570 Bacteria 11358
307 Ga0501033_0044900 3300049570 Bacteria 3289
308 Ga0501033_0054526 3300049570 Bacteria 2957
309 Ga0501033_0274088 3300049570 Bacteria 1192
310 Ga0501034_0055603 3300049571 Bacteria 3982
311 Ga0501036_0052382 3300049572 Bacteria 3456
312 Ga0501036_0470489 3300049572 Bacteria 1047
313 Ga0501037_0010181 3300049573 Bacteria 6899
314 Ga0501037_0085193 3300049573 Bacteria 2288
315 Ga0501037_0093126 3300049573 Bacteria 2179
316 Ga0501037_0105509 3300049573 Bacteria 2031
317 Ga0501038_0007790 3300049574 Bacteria 9869
318 Ga0501038_0029542 3300049574 Bacteria 4856
319 Ga0501038_0549419 3300049574 Bacteria 878
320 Ga0501039_0199885 3300049575 Bacteria 1572
321 Ga0501039_0358920 3300049575 Bacteria 1145
322 Ga0501043_0025769 3300049579 Bacteria 4612
323 Ga0501043_0162863 3300049579 Bacteria 1742
324 Ga0501043_0284815 3300049579 Bacteria 1266
325 Ga0501043_0525004 3300049579 Bacteria 882
326 Ga0501043_0718361 3300049579 Bacteria 728
327 Ga0501046_0033406 3300049580 Bacteria 4156
328 Ga0501046_0040922 3300049580 Bacteria 3701
329 Ga0501046_0077504 3300049580 Bacteria 2573
330 Ga0501046_0463050 3300049580 Bacteria 911
331 Ga0501047_0039075 3300049581 Bacteria 4591
332 Ga0501047_0051324 3300049581 Bacteria 3984
333 Ga0501048_0068080 3300049582 Bacteria 2516
334 Ga0501069_0081988 3300049585 Bacteria 1817
335 Ga0501069_0091006 3300049585 Bacteria 1725
336 Ga0501070_0000020 3300049586 Bacteria 169025
337 Ga0501070_0011645 3300049586 Bacteria 7425
338 Ga0501070_0013009 3300049586 Bacteria 7013
339 Ga0501070_0025424 3300049586 Bacteria 4966
340 Ga0501070_0031135 3300049586 Bacteria 4469
341 Ga0501070_0063446 3300049586 Bacteria 3060
342 Ga0501073_0031432 3300049589 Bacteria 3789
343 Ga0501074_0001639 3300049590 Bacteria 15165
344 Ga0501074_0243879 3300049590 Bacteria 1278
345 Ga0501075_0016607 3300049591 Bacteria 5306
346 Ga0501075_0494310 3300049591 Bacteria 933
347 Ga0501076_0316826 3300049592 Bacteria 1279
348 Ga0501076_0426207 3300049592 Bacteria 1092
349 Ga0501077_0094718 3300049593 Bacteria 1893
350 Ga0501079_0667270 3300049741 Bacteria 818
351 Ga0501080_0012105 3300049742 Bacteria 7903
352 Ga0501080_0041489 3300049742 Bacteria 4288
353 Ga0501035_0000322 3300049822 Bacteria 55416
354 Ga0501035_0005404 3300049822 Bacteria 12076
355 Ga0501035_0013563 3300049822 Bacteria 7520
356 Ga0501035_0115529 3300049822 Bacteria 2349
357 Ga0501035_0744235 3300049822 Bacteria 787
358 Ga0501044_0013582 3300049823 Bacteria 8800
359 Ga0501044_0018030 3300049823 Bacteria 7570
360 Ga0501044_0021544 3300049823 Bacteria 6873
361 Ga0501044_0067500 3300049823 Bacteria 3644
362 Ga0501044_0090082 3300049823 Bacteria 3095
363 Ga0501044_0091674 3300049823 Bacteria 3065
364 Ga0501044_0701943 3300049823 Bacteria 897
365 Ga0501044_0856803 3300049823 Bacteria 785
366 nmdc:mga09592_491980_c1 3300050508 Bacteria 1056
367 nmdc:mga09592_546244_c1 3300050508 Bacteria 995
368 nmdc:mga0qj67_107064_c1 3300050509 Bacteria 2255
369 nmdc:mga0qj67_348191_c1 3300050509 Bacteria 1198
370 nmdc:mga0qj67_957526_c1 3300050509 Bacteria 673
371 nmdc:mga0n895_115535_c1 3300050512 Bacteria 2702
372 nmdc:mga0rr50_126580_c1 3300050513 Bacteria 2041
373 nmdc:mga0a205_701883_c1 3300050515 Unclassified 861
374 Ga0500562_000836 3300053108 Bacteria 7453
375 Ga0500592_015272 3300053116 Bacteria 1231
376 Ga0500595_024646 3300053119 Bacteria 2097
377 Ga0500655_039626 3300053133 Bacteria 922
378 Ga0500568_0005266 3300053139 Bacteria 6726
379 Ga0500604_0025944 3300053151 Bacteria 1687
380 Ga0500627_0000014 3300053158 Bacteria 135404
381 Ga0500645_004733 3300053730 Bacteria 5154
382 Ga0501082_0565157 3300060353 Bacteria 995

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_115535_c1 nmdc:mga0n895_115535_c1_801_1310 168
2 3300049579 Ga0501043_0162863 Ga0501043_0162863_1210_1725 171
3 3300035725 Ga0373947_0214758 Ga0373947_0214758_722_1246 174
4 3300013104 Ga0157370_10178155 Ga0157370_101781551 188
5 3300035170 Ga0373943_0445884 Ga0373943_0445884_58_624 188
6 3300037068 Ga0373925_0133107 Ga0373925_0133107_121_687 188
7 3300050509 nmdc:mga0qj67_957526_c1 nmdc:mga0qj67_957526_c1_88_657 188
8 3300053133 Ga0500655_039626 Ga0500655_039626_42_608 188
9 3300049579 Ga0501043_0718361 Ga0501043_0718361_116_694 191
10 3300049823 Ga0501044_0701943 Ga0501044_0701943_293_868 191
11 3300006871 Ga0075434_100616213 Ga0075434_1006162131 192
12 3300050509 nmdc:mga0qj67_348191_c1 nmdc:mga0qj67_348191_c1_554_1150 197
13 3300025900 Ga0207710_10304628 Ga0207710_103046281 200
14 iso_pu_bacteria 2643221560 2643821457 200
15 iso_pu_bacteria 2643221563 2643835228 200
16 iso_pu_bacteria 2643221608 2644056154 200
17 iso_pu_bacteria 2852653556 2852654739 200
18 iso_pu_bacteria 2852680915 2852681851 200
19 3300009176 Ga0105242_11164324 Ga0105242_111643241 201
20 3300025913 Ga0207695_10153147 Ga0207695_101531471 201
21 3300005616 Ga0068852_100255032 Ga0068852_1002550322 202
22 3300009174 Ga0105241_10094238 Ga0105241_100942382 202
23 3300009551 Ga0105238_10033400 Ga0105238_100334005 202
24 3300025911 Ga0207654_10153386 Ga0207654_101533862 202
25 3300025924 Ga0207694_10024379 Ga0207694_100243793 202
26 3300026142 Ga0207698_10145834 Ga0207698_101458342 202
27 3300037418 Ga0395900_0227272 Ga0395900_0227272_368_976 202
28 3300037418 Ga0395900_0311728 Ga0395900_0311728_581_1189 202
29 3300003320 rootH2_10013173 rootH2_1001317327 203
30 3300003323 rootH1_10047640 rootH1_100476401 203
31 3300005329 Ga0070683_100668979 Ga0070683_1006689791 203
32 3300005339 Ga0070660_100037059 Ga0070660_1000370593 203
33 3300005341 Ga0070691_10001568 Ga0070691_1000156814 203
34 3300005344 Ga0070661_100000046 Ga0070661_10000004669 203
35 3300005344 Ga0070661_100000071 Ga0070661_10000007156 203
36 3300005353 Ga0070669_100361144 Ga0070669_1003611441 203
37 3300005366 Ga0070659_100009643 Ga0070659_10000964310 203
38 3300005434 Ga0070709_10365267 Ga0070709_103652671 203
39 3300005437 Ga0070710_10212893 Ga0070710_102128932 203
40 3300005471 Ga0070698_100251905 Ga0070698_1002519053 203
41 3300005546 Ga0070696_100007859 Ga0070696_1000078595 203
42 3300005546 Ga0070696_100349154 Ga0070696_1003491542 203
43 3300005614 Ga0068856_100253194 Ga0068856_1002531942 203
44 3300005617 Ga0068859_100512589 Ga0068859_1005125892 203
45 3300005841 Ga0068863_100077309 Ga0068863_1000773093 203
46 3300005843 Ga0068860_100146410 Ga0068860_1001464101 203
47 3300005843 Ga0068860_101019145 Ga0068860_1010191451 203
48 3300005844 Ga0068862_100248906 Ga0068862_1002489063 203
49 3300005844 Ga0068862_100275556 Ga0068862_1002755562 203
50 3300006175 Ga0070712_100000367 Ga0070712_10000036725 203
51 3300006844 Ga0075428_100052958 Ga0075428_1000529582 203
52 3300006844 Ga0075428_100110000 Ga0075428_1001100003 203
53 3300006846 Ga0075430_100362022 Ga0075430_1003620221 203
54 3300006846 Ga0075430_100509603 Ga0075430_1005096031 203
55 3300006880 Ga0075429_100373884 Ga0075429_1003738842 203
56 3300006931 Ga0097620_100512601 Ga0097620_1005126012 203
57 3300009093 Ga0105240_10220634 Ga0105240_102206342 203
58 3300009148 Ga0105243_10656006 Ga0105243_106560062 203
59 3300009177 Ga0105248_10078987 Ga0105248_100789875 203
60 3300009545 Ga0105237_10116576 Ga0105237_101165762 203
61 3300009551 Ga0105238_10022124 Ga0105238_1002212410 203
62 3300009553 Ga0105249_10030591 Ga0105249_100305915 203
63 3300009553 Ga0105249_10916020 Ga0105249_109160202 203
64 3300013104 Ga0157370_10009873 Ga0157370_1000987314 203
65 3300013306 Ga0163162_10524459 Ga0163162_105244592 203
66 3300013307 Ga0157372_10011587 Ga0157372_1001158710 203
67 3300014325 Ga0163163_10325818 Ga0163163_103258182 203
68 3300014968 Ga0157379_10496955 Ga0157379_104969551 203
69 3300021361 Ga0213872_10032825 Ga0213872_100328252 203
70 3300021361 Ga0213872_10180286 Ga0213872_101802862 203
71 3300021384 Ga0213876_10000381 Ga0213876_100003816 203
72 3300025909 Ga0207705_10000345 Ga0207705_1000034534 203
73 3300025915 Ga0207693_10002178 Ga0207693_1000217817 203
74 3300025916 Ga0207663_10434071 Ga0207663_104340712 203
75 3300025917 Ga0207660_10002364 Ga0207660_100023645 203
76 3300025919 Ga0207657_10004072 Ga0207657_1000407220 203
77 3300025920 Ga0207649_10000029 Ga0207649_10000029131 203
78 3300025920 Ga0207649_10000072 Ga0207649_1000007219 203
79 3300025921 Ga0207652_10001639 Ga0207652_1000163914 203
80 3300025924 Ga0207694_10582293 Ga0207694_105822931 203
81 3300025928 Ga0207700_10320424 Ga0207700_103204242 203
82 3300025929 Ga0207664_10384051 Ga0207664_103840512 203
83 3300025932 Ga0207690_10727449 Ga0207690_107274491 203
84 3300025941 Ga0207711_10317432 Ga0207711_103174322 203
85 3300025949 Ga0207667_10231658 Ga0207667_102316582 203
86 3300025961 Ga0207712_10021477 Ga0207712_100214774 203
87 3300026078 Ga0207702_10284674 Ga0207702_102846742 203
88 3300026088 Ga0207641_10124470 Ga0207641_101244703 203
89 3300026095 Ga0207676_10032312 Ga0207676_100323123 203
90 3300026118 Ga0207675_100497918 Ga0207675_1004979181 203
91 3300028380 Ga0268265_10181433 Ga0268265_101814332 203
92 3300028380 Ga0268265_10187723 Ga0268265_101877231 203
93 3300028381 Ga0268264_10018522 Ga0268264_100185223 203
94 3300028800 Ga0265338_10096570 Ga0265338_100965702 203
95 3300031239 Ga0265328_10075302 Ga0265328_100753022 203
96 3300031240 Ga0265320_10093431 Ga0265320_100934312 203
97 3300031247 Ga0265340_10003302 Ga0265340_100033023 203
98 3300031247 Ga0265340_10023218 Ga0265340_100232183 203
99 3300031250 Ga0265331_10000006 Ga0265331_10000006213 203
100 3300031250 Ga0265331_10012974 Ga0265331_100129743 203
101 3300031251 Ga0265327_10000052 Ga0265327_10000052209 203
102 3300031548 Ga0307408_100376010 Ga0307408_1003760101 203
103 3300031711 Ga0265314_10051839 Ga0265314_100518394 203
104 3300031711 Ga0265314_10052353 Ga0265314_100523533 203
105 3300031711 Ga0265314_10093716 Ga0265314_100937161 203
106 3300031711 Ga0265314_10194832 Ga0265314_101948322 203
107 3300031824 Ga0307413_10019677 Ga0307413_100196772 203
108 3300031852 Ga0307410_10028856 Ga0307410_100288562 203
109 3300031903 Ga0307407_10015477 Ga0307407_100154774 203
110 3300031995 Ga0307409_100023536 Ga0307409_1000235362 203
111 3300032005 Ga0307411_10032011 Ga0307411_100320114 203
112 3300035695 Ga0373927_0005192 Ga0373927_0005192_5437_6048 203
113 3300036401 Ga0373937_0002756 Ga0373937_0002756_2671_3282 203
114 3300039062 Ga0400483_113347 Ga0400483_113347_672_1283 203
115 3300039437 Ga0436365_1004240 Ga0436365_1004240_62184_62795 203
116 3300039447 Ga0436361_0726854 Ga0436361_0726854_109_723 203
117 3300039453 Ga0436362_0878090 Ga0436362_0878090_715_1329 203
118 3300044684 Ga0466966_0042551 Ga0466966_0042551_239_853 203
119 3300044735 Ga0466968_0187168 Ga0466968_0187168_124_738 203
120 3300045049 Ga0466959_0068906 Ga0466959_0068906_626_1240 203
121 3300046543 Ga0495645_0220794 Ga0495645_0220794_346_957 203
122 3300046809 Ga0495600_0183275 Ga0495600_0183275_261_872 203
123 3300048924 Ga0496121_0039563 Ga0496121_0039563_504_1118 203
124 3300048929 Ga0496126_0001155 Ga0496126_0001155_28171_28782 203
125 3300048929 Ga0496126_0044628 Ga0496126_0044628_3376_3990 203
126 3300049569 Ga0501032_0045923 Ga0501032_0045923_931_1542 203
127 3300049569 Ga0501032_0154672 Ga0501032_0154672_344_955 203
128 3300049570 Ga0501033_0044900 Ga0501033_0044900_2014_2625 203
129 3300049570 Ga0501033_0274088 Ga0501033_0274088_353_967 203
130 3300049572 Ga0501036_0470489 Ga0501036_0470489_387_998 203
131 3300049574 Ga0501038_0029542 Ga0501038_0029542_3935_4546 203
132 3300049575 Ga0501039_0199885 Ga0501039_0199885_801_1412 203
133 3300049579 Ga0501043_0525004 Ga0501043_0525004_249_860 203
134 3300049580 Ga0501046_0033406 Ga0501046_0033406_2894_3505 203
135 3300049580 Ga0501046_0463050 Ga0501046_0463050_174_785 203
136 3300049586 Ga0501070_0000020 Ga0501070_0000020_4488_5099 203
137 3300049586 Ga0501070_0031135 Ga0501070_0031135_1459_2103 203
138 3300049590 Ga0501074_0243879 Ga0501074_0243879_343_957 203
139 3300049591 Ga0501075_0494310 Ga0501075_0494310_64_678 203
140 3300049592 Ga0501076_0316826 Ga0501076_0316826_28_642 203
141 3300049592 Ga0501076_0426207 Ga0501076_0426207_73_747 203
142 3300049742 Ga0501080_0041489 Ga0501080_0041489_2001_2612 203
143 3300049822 Ga0501035_0000322 Ga0501035_0000322_4587_5198 203
144 3300049822 Ga0501035_0115529 Ga0501035_0115529_163_774 203
145 3300049823 Ga0501044_0018030 Ga0501044_0018030_3180_3791 203
146 3300049823 Ga0501044_0021544 Ga0501044_0021544_1470_2081 203
147 3300049823 Ga0501044_0091674 Ga0501044_0091674_291_902 203
148 3300049823 Ga0501044_0856803 Ga0501044_0856803_81_692 203
149 3300050508 nmdc:mga09592_491980_c1 nmdc:mga09592_491980_c1_20_634 203
150 3300050508 nmdc:mga09592_546244_c1 nmdc:mga09592_546244_c1_106_720 203
151 3300050509 nmdc:mga0qj67_107064_c1 nmdc:mga0qj67_107064_c1_1511_2125 203
152 3300050513 nmdc:mga0rr50_126580_c1 nmdc:mga0rr50_126580_c1_1407_2021 203
153 3300050515 nmdc:mga0a205_701883_c1 nmdc:mga0a205_701883_c1_109_723 203
154 3300060353 Ga0501082_0565157 Ga0501082_0565157_66_680 203
155 3300003781 Ga0055536_1001633 Ga0055536_100163311 204
156 3300003781 Ga0055536_1003840 Ga0055536_10038404 204
157 3300003781 Ga0055536_1005691 Ga0055536_10056913 204
158 3300003791 Ga0055530_10000749 Ga0055530_100007493 204
159 3300003794 Ga0055531_10007137 Ga0055531_100071374 204
160 3300003794 Ga0055531_10023952 Ga0055531_100239523 204
161 3300005327 Ga0070658_10070905 Ga0070658_100709052 204
162 3300005327 Ga0070658_10177766 Ga0070658_101777663 204
163 3300005327 Ga0070658_10261971 Ga0070658_102619713 204
164 3300005327 Ga0070658_10308674 Ga0070658_103086742 204
165 3300005327 Ga0070658_10727661 Ga0070658_107276612 204
166 3300005336 Ga0070680_100016529 Ga0070680_1000165292 204
167 3300005336 Ga0070680_100045166 Ga0070680_1000451662 204
168 3300005339 Ga0070660_100247033 Ga0070660_1002470332 204
169 3300005339 Ga0070660_100501282 Ga0070660_1005012822 204
170 3300005339 Ga0070660_100581638 Ga0070660_1005816381 204
171 3300005341 Ga0070691_10013327 Ga0070691_100133274 204
172 3300005344 Ga0070661_100797047 Ga0070661_1007970471 204
173 3300005345 Ga0070692_10552849 Ga0070692_105528491 204
174 3300005364 Ga0070673_100077397 Ga0070673_1000773973 204
175 3300005366 Ga0070659_100000180 Ga0070659_10000018022 204
176 3300005366 Ga0070659_100009976 Ga0070659_1000099762 204
177 3300005455 Ga0070663_100850096 Ga0070663_1008500961 204
178 3300005456 Ga0070678_100051288 Ga0070678_1000512885 204
179 3300005458 Ga0070681_10007148 Ga0070681_100071484 204
180 3300005458 Ga0070681_10052233 Ga0070681_100522332 204
181 3300005467 Ga0070706_100355169 Ga0070706_1003551691 204
182 3300005530 Ga0070679_100051244 Ga0070679_1000512442 204
183 3300005530 Ga0070679_100130083 Ga0070679_1001300832 204
184 3300005539 Ga0068853_100003636 Ga0068853_1000036362 204
185 3300005548 Ga0070665_100000494 Ga0070665_1000004943 204
186 3300005548 Ga0070665_100724064 Ga0070665_1007240642 204
187 3300005563 Ga0068855_100010766 Ga0068855_1000107665 204
188 3300005563 Ga0068855_100060296 Ga0068855_1000602963 204
189 3300005578 Ga0068854_100329282 Ga0068854_1003292822 204
190 3300005618 Ga0068864_100002705 Ga0068864_1000027058 204
191 3300005841 Ga0068863_100132189 Ga0068863_1001321892 204
192 3300006358 Ga0068871_100344490 Ga0068871_1003444902 204
193 3300009093 Ga0105240_10005403 Ga0105240_100054035 204
194 3300009093 Ga0105240_10049470 Ga0105240_100494703 204
195 3300009177 Ga0105248_10194096 Ga0105248_101940962 204
196 3300009551 Ga0105238_10038915 Ga0105238_100389155 204
197 3300009551 Ga0105238_10357169 Ga0105238_103571693 204
198 3300009551 Ga0105238_10420848 Ga0105238_104208482 204
199 3300010375 Ga0105239_10255861 Ga0105239_102558612 204
200 3300013104 Ga0157370_10066597 Ga0157370_100665972 204
201 3300013105 Ga0157369_10540144 Ga0157369_105401443 204
202 3300013296 Ga0157374_10120433 Ga0157374_101204332 204
203 3300013306 Ga0163162_10116700 Ga0163162_101167002 204
204 3300013306 Ga0163162_10341552 Ga0163162_103415522 204
205 3300014325 Ga0163163_10227535 Ga0163163_102275353 204
206 3300014325 Ga0163163_10335455 Ga0163163_103354552 204
207 3300025250 Ga0209026_1000772 Ga0209026_100077222 204
208 3300025291 Ga0209675_1001281 Ga0209675_100128115 204
209 3300025292 Ga0209676_1000384 Ga0209676_100038460 204
210 3300025292 Ga0209676_1000475 Ga0209676_100047557 204
211 3300025292 Ga0209676_1035818 Ga0209676_10358182 204
212 3300025294 Ga0209025_1013031 Ga0209025_10130313 204
213 3300025294 Ga0209025_1083756 Ga0209025_10837562 204
214 3300025297 Ga0209758_1076715 Ga0209758_10767152 204
215 3300025298 Ga0209050_1000132 Ga0209050_100013269 204
216 3300025298 Ga0209050_1051830 Ga0209050_10518302 204
217 3300025304 Ga0209257_1000176 Ga0209257_100017671 204
218 3300025304 Ga0209257_1002954 Ga0209257_100295411 204
219 3300025304 Ga0209257_1004939 Ga0209257_10049393 204
220 3300025909 Ga0207705_10000478 Ga0207705_1000047824 204
221 3300025909 Ga0207705_10174691 Ga0207705_101746912 204
222 3300025909 Ga0207705_10271631 Ga0207705_102716313 204
223 3300025909 Ga0207705_10474511 Ga0207705_104745112 204
224 3300025912 Ga0207707_10011010 Ga0207707_100110103 204
225 3300025912 Ga0207707_10022214 Ga0207707_100222143 204
226 3300025913 Ga0207695_10000766 Ga0207695_1000076646 204
227 3300025913 Ga0207695_10012899 Ga0207695_100128995 204
228 3300025913 Ga0207695_10414065 Ga0207695_104140652 204
229 3300025917 Ga0207660_10007009 Ga0207660_100070092 204
230 3300025917 Ga0207660_10136183 Ga0207660_101361832 204
231 3300025919 Ga0207657_10010723 Ga0207657_100107238 204
232 3300025919 Ga0207657_10151521 Ga0207657_101515212 204
233 3300025921 Ga0207652_10049453 Ga0207652_100494532 204
234 3300025924 Ga0207694_10054075 Ga0207694_100540752 204
235 3300025924 Ga0207694_10055111 Ga0207694_100551112 204
236 3300025924 Ga0207694_10550789 Ga0207694_105507892 204
237 3300025925 Ga0207650_10078456 Ga0207650_100784562 204
238 3300025931 Ga0207644_10438827 Ga0207644_104388272 204
239 3300025932 Ga0207690_10000158 Ga0207690_1000015837 204
240 3300025932 Ga0207690_10008499 Ga0207690_100084992 204
241 3300025941 Ga0207711_10858680 Ga0207711_108586801 204
242 3300025945 Ga0207679_10191540 Ga0207679_101915402 204
243 3300025949 Ga0207667_10024661 Ga0207667_100246613 204
244 3300025949 Ga0207667_10050753 Ga0207667_100507533 204
245 3300025949 Ga0207667_10091780 Ga0207667_100917802 204
246 3300026041 Ga0207639_10049148 Ga0207639_100491483 204
247 3300026088 Ga0207641_10088664 Ga0207641_100886643 204
248 3300026121 Ga0207683_10053597 Ga0207683_100535973 204
249 3300028379 Ga0268266_10000003 Ga0268266_10000003748 204
250 3300028786 Ga0307517_10004204 Ga0307517_1000420410 204
251 3300031251 Ga0265327_10000454 Ga0265327_1000045457 204
252 3300031456 Ga0307513_10027712 Ga0307513_100277123 204
253 3300031824 Ga0307413_10490370 Ga0307413_104903702 204
254 3300031911 Ga0307412_10456365 Ga0307412_104563652 204
255 3300032004 Ga0307414_10001847 Ga0307414_100018474 204
256 3300032004 Ga0307414_10003420 Ga0307414_100034207 204
257 3300032004 Ga0307414_10133311 Ga0307414_101333112 204
258 3300032004 Ga0307414_10383130 Ga0307414_103831302 204
259 3300032004 Ga0307414_11364891 Ga0307414_113648911 204
260 3300032005 Ga0307411_10193413 Ga0307411_101934132 204
261 3300037466 Ga0395898_0653336 Ga0395898_0653336_19_636 204
262 3300037471 Ga0395905_0253470 Ga0395905_0253470_682_1335 204
263 3300046528 Ga0495642_0001185 Ga0495642_0001185_7992_8609 204
264 3300046539 Ga0495621_0033885 Ga0495621_0033885_1086_1703 204
265 3300046616 Ga0495668_0037493 Ga0495668_0037493_2033_2647 204
266 3300046660 Ga0495625_0001754 Ga0495625_0001754_2891_3514 204
267 3300047320 Ga0495672_0280342 Ga0495672_0280342_156_773 204
268 3300048904 Ga0496101_0413077 Ga0496101_0413077_310_927 204
269 3300048905 Ga0496102_0231612 Ga0496102_0231612_109_726 204
270 3300048909 Ga0496106_0219450 Ga0496106_0219450_594_1211 204
271 3300048912 Ga0496109_0006856 Ga0496109_0006856_133_750 204
272 3300048918 Ga0496115_0000107 Ga0496115_0000107_23587_24204 204
273 3300048918 Ga0496115_0114973 Ga0496115_0114973_1553_2170 204
274 3300049568 Ga0501031_0058418 Ga0501031_0058418_23_640 204
275 3300049569 Ga0501032_0011402 Ga0501032_0011402_2806_3423 204
276 3300049570 Ga0501033_0004349 Ga0501033_0004349_6235_6852 204
277 3300049570 Ga0501033_0054526 Ga0501033_0054526_2184_2801 204
278 3300049571 Ga0501034_0055603 Ga0501034_0055603_2403_3020 204
279 3300049572 Ga0501036_0052382 Ga0501036_0052382_2660_3277 204
280 3300049573 Ga0501037_0010181 Ga0501037_0010181_26_643 204
281 3300049573 Ga0501037_0105509 Ga0501037_0105509_27_644 204
282 3300049574 Ga0501038_0007790 Ga0501038_0007790_6029_6646 204
283 3300049574 Ga0501038_0549419 Ga0501038_0549419_135_752 204
284 3300049579 Ga0501043_0025769 Ga0501043_0025769_2103_2720 204
285 3300049580 Ga0501046_0040922 Ga0501046_0040922_1151_1768 204
286 3300049581 Ga0501047_0039075 Ga0501047_0039075_94_711 204
287 3300049582 Ga0501048_0068080 Ga0501048_0068080_1330_1947 204
288 3300049822 Ga0501035_0005404 Ga0501035_0005404_8055_8672 204
289 3300049823 Ga0501044_0013582 Ga0501044_0013582_6097_6714 204
290 3300049823 Ga0501044_0090082 Ga0501044_0090082_1327_1944 204
291 3300053116 Ga0500592_015272 Ga0500592_015272_415_1038 204
292 3300053119 Ga0500595_024646 Ga0500595_024646_1231_1845 204
293 3300053139 Ga0500568_0005266 Ga0500568_0005266_3336_3959 204
294 3300053151 Ga0500604_0025944 Ga0500604_0025944_941_1564 204
295 3300053158 Ga0500627_0000014 Ga0500627_0000014_122277_122900 204
296 3300053730 Ga0500645_004733 Ga0500645_004733_4055_4669 204
297 3300005577 Ga0068857_101199230 Ga0068857_1011992301 205
298 3300021361 Ga0213872_10006976 Ga0213872_100069762 205
299 3300039447 Ga0436361_0242079 Ga0436361_0242079_13841_14458 205
300 3300048928 Ga0496125_0069643 Ga0496125_0069643_1520_2137 205
301 3300049822 Ga0501035_0744235 Ga0501035_0744235_18_668 205
302 3300005842 Ga0068858_100078046 Ga0068858_1000780462 206
303 3300006237 Ga0097621_100443177 Ga0097621_1004431771 206
304 3300026088 Ga0207641_10130921 Ga0207641_101309212 206
305 3300053108 Ga0500562_000836 Ga0500562_000836_2031_2651 206
306 3300048918 Ga0496115_0046020 Ga0496115_0046020_734_1384 215
307 3300001979 JGI24740J21852_10024904 JGI24740J21852_100249042 216
308 3300005327 Ga0070658_10329061 Ga0070658_103290611 216
309 3300005329 Ga0070683_100120869 Ga0070683_1001208693 216
310 3300005336 Ga0070680_100348829 Ga0070680_1003488292 216
311 3300005337 Ga0070682_100133756 Ga0070682_1001337562 216
312 3300005339 Ga0070660_100195487 Ga0070660_1001954873 216
313 3300005344 Ga0070661_100030965 Ga0070661_1000309653 216
314 3300005345 Ga0070692_10009052 Ga0070692_100090524 216
315 3300005366 Ga0070659_100308755 Ga0070659_1003087552 216
316 3300005455 Ga0070663_100006343 Ga0070663_1000063433 216
317 3300005518 Ga0070699_100684872 Ga0070699_1006848722 216
318 3300005535 Ga0070684_100095693 Ga0070684_1000956932 216
319 3300005546 Ga0070696_100055978 Ga0070696_1000559785 216
320 3300005549 Ga0070704_100318101 Ga0070704_1003181012 216
321 3300005563 Ga0068855_100382749 Ga0068855_1003827492 216
322 3300005564 Ga0070664_100266086 Ga0070664_1002660862 216
323 3300005577 Ga0068857_100272907 Ga0068857_1002729072 216
324 3300005578 Ga0068854_100501199 Ga0068854_1005011992 216
325 3300005614 Ga0068856_100239335 Ga0068856_1002393352 216
326 3300005616 Ga0068852_100245471 Ga0068852_1002454712 216
327 3300005618 Ga0068864_100073458 Ga0068864_1000734583 216
328 3300005834 Ga0068851_10108821 Ga0068851_101088212 216
329 3300006847 Ga0075431_100052018 Ga0075431_1000520183 216
330 3300009093 Ga0105240_10675047 Ga0105240_106750471 216
331 3300013102 Ga0157371_10078514 Ga0157371_100785143 216
332 3300013104 Ga0157370_10863096 Ga0157370_108630962 216
333 3300013105 Ga0157369_10347581 Ga0157369_103475812 216
334 3300013306 Ga0163162_10031864 Ga0163162_100318642 216
335 3300013307 Ga0157372_10266305 Ga0157372_102663052 216
336 3300013308 Ga0157375_10169396 Ga0157375_101693962 216
337 3300014968 Ga0157379_10378245 Ga0157379_103782451 216
338 3300020070 Ga0206356_11148188 Ga0206356_111481882 216
339 3300020077 Ga0206351_10931970 Ga0206351_109319703 216
340 3300020078 Ga0206352_10188214 Ga0206352_101882144 216
341 3300020080 Ga0206350_10713402 Ga0206350_107134024 216
342 3300020081 Ga0206354_11241761 Ga0206354_112417612 216
343 3300020082 Ga0206353_11090799 Ga0206353_110907993 216
344 3300020610 Ga0154015_1102430 Ga0154015_11024303 216
345 3300022467 Ga0224712_10011674 Ga0224712_100116743 216
346 3300025904 Ga0207647_10003196 Ga0207647_1000319613 216
347 3300025909 Ga0207705_10036759 Ga0207705_100367592 216
348 3300025912 Ga0207707_10063317 Ga0207707_100633174 216
349 3300025913 Ga0207695_10070892 Ga0207695_100708924 216
350 3300025917 Ga0207660_10051542 Ga0207660_100515423 216
351 3300025919 Ga0207657_10079119 Ga0207657_100791194 216
352 3300025920 Ga0207649_10016121 Ga0207649_100161214 216
353 3300025921 Ga0207652_10091343 Ga0207652_100913433 216
354 3300025922 Ga0207646_10877149 Ga0207646_108771491 216
355 3300025944 Ga0207661_10030262 Ga0207661_100302625 216
356 3300025949 Ga0207667_10082618 Ga0207667_100826183 216
357 3300025972 Ga0207668_10405094 Ga0207668_104050942 216
358 3300025981 Ga0207640_10047023 Ga0207640_100470232 216
359 3300026067 Ga0207678_10686790 Ga0207678_106867901 216
360 3300026078 Ga0207702_10012829 Ga0207702_100128297 216
361 3300026095 Ga0207676_10571044 Ga0207676_105710442 216
362 3300026116 Ga0207674_10529716 Ga0207674_105297162 216
363 3300031247 Ga0265340_10075853 Ga0265340_100758532 216
364 3300035691 Ga0373931_0093515 Ga0373931_0093515_494_1144 216
365 3300039447 Ga0436361_0603297 Ga0436361_0603297_110_760 216
366 3300048907 Ga0496104_0365931 Ga0496104_0365931_298_948 216
367 3300049573 Ga0501037_0085193 Ga0501037_0085193_197_847 216
368 3300049573 Ga0501037_0093126 Ga0501037_0093126_210_860 216
369 3300049575 Ga0501039_0358920 Ga0501039_0358920_450_1100 216
370 3300049579 Ga0501043_0284815 Ga0501043_0284815_25_675 216
371 3300049580 Ga0501046_0077504 Ga0501046_0077504_301_951 216
372 3300049581 Ga0501047_0051324 Ga0501047_0051324_1827_2477 216
373 3300049585 Ga0501069_0081988 Ga0501069_0081988_49_699 216
374 3300049585 Ga0501069_0091006 Ga0501069_0091006_59_709 216
375 3300049586 Ga0501070_0011645 Ga0501070_0011645_1633_2283 216
376 3300049586 Ga0501070_0013009 Ga0501070_0013009_949_1599 216
377 3300049586 Ga0501070_0025424 Ga0501070_0025424_3974_4624 216
378 3300049586 Ga0501070_0063446 Ga0501070_0063446_1842_2492 216
379 3300049589 Ga0501073_0031432 Ga0501073_0031432_2136_2786 216
380 3300049590 Ga0501074_0001639 Ga0501074_0001639_12680_13330 216
381 3300049591 Ga0501075_0016607 Ga0501075_0016607_3574_4224 216
382 3300049593 Ga0501077_0094718 Ga0501077_0094718_977_1627 216
383 3300049741 Ga0501079_0667270 Ga0501079_0667270_66_716 216
384 3300049742 Ga0501080_0012105 Ga0501080_0012105_5194_5844 216
385 3300049822 Ga0501035_0013563 Ga0501035_0013563_4810_5460 216
386 3300049823 Ga0501044_0067500 Ga0501044_0067500_468_1118 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

43

119

0.89

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

51

120

0.85

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

175

247

0.85

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

162

243

0.84

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

47

125

0.82

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

157

238

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3erf-assembly1.cif.gz_A crystal structure of gtt2 from saccharomyces cerevisiae 0.937 1 205
3erf-assembly1.cif.gz_A crystal structure of gtt2 from saccharomyces cerevisiae 0.9199 1 205
4n0v-assembly1.cif.gz_B crystal structure of a glutathione s-transferase domain-containing protein (marinobacter aquaeolei vt8), target efi-507332 0.919 1 201
6f05-assembly4.cif.gz_D arabidopsis thaliana gstf9, gso3 bound 0.9128 2 204
6f05-assembly6.cif.gz_G arabidopsis thaliana gstf9, gso3 bound 0.9062 1 204
ID Description Score Start End Superfamily
3ibhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9537 1 73 3.40.30.10
af_Q7JYX0_7_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9396 8 78 3.40.30.10
af_B8A514_42_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9335 2 74 3.40.30.10
3m8nC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9283 2 74 3.40.30.10
af_Q7JVZ8_6_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9223 8 76 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A537SEP8-F1-model_v4 Glutathione S-transferase 0.9937 1 82 GO:0004364
GO:0006749
AF-A0A1M3ADJ9-F1-model_v4 deleted 0.9911 1 181
AF-A0A7X4BZT9-F1-model_v4 Glutathione S-transferase 0.9891 86 201 GO:0016740
AF-A0A7Y8MU18-F1-model_v4 Glutathione S-transferase family protein 0.9889 1 202 GO:0016740
AF-A0A1Z8WW75-F1-model_v4 Glutathione S-transferase 0.9878 1 208 GO:0016740

Feature Viewer

pLDDT pTM Quality
96.66 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map