F430466

General Info

Members Datasets Scaffolds Average Seq Length
386 172 386 154

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100090955|Ga0070716_1000909552
Length 180
Sequence MSRCSSSVEIVRIRDVRPFQAQDSKQVAKLKEGDKAPDFTVHDGEGQTIRLKDLRGKKVVLYFYPKDDTPGCTKEACSFRDSFAKFKKRGIEVLGVSFDSEAKHKKFAQKYDLPFRLLADTDRAIAEGFGTYGEKKFMGRTYMGIHRMTFLIDEKGKIKKIFNKVKPEDHAEEVLAAFDE

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001426 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 Metagenome Rhizosphere
3 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
87 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.52
Rhizosphere 99.22
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1006241 3300000546 Bacteria 1293
2 JGI24030J14995_100424 3300001426 Bacteria 1338
3 JGI24034J14986_100008 3300001432 Bacteria 6582
4 JGI24748J21848_1000018 3300002074 Bacteria 129847
5 JGI24034J26672_10000001 3300002239 Bacteria 1118280
6 Ga0065704_10318779 3300005289 Bacteria 856
7 Ga0065715_10161771 3300005293 Bacteria 1622
8 Ga0065707_10094673 3300005295 Bacteria 3466
9 Ga0065707_10161158 3300005295 Bacteria 1562
10 Ga0070658_10100311 3300005327 Bacteria 2393
11 Ga0070690_100026897 3300005330 Bacteria 3552
12 Ga0070690_100292549 3300005330 Bacteria 1165
13 Ga0070690_100539826 3300005330 Bacteria 878
14 Ga0068869_100069471 3300005334 Bacteria 2605
15 Ga0068869_100272036 3300005334 Bacteria 1359
16 Ga0068869_100675194 3300005334 Bacteria 879
17 Ga0068869_101022997 3300005334 Bacteria 720
18 Ga0070680_101258930 3300005336 Unclassified 640
19 Ga0068868_100052504 3300005338 Bacteria 3209
20 Ga0070689_100004049 3300005340 Bacteria 9864
21 Ga0070689_100014454 3300005340 Bacteria 5735
22 Ga0070689_100262878 3300005340 Bacteria 1427
23 Ga0070687_100047480 3300005343 Bacteria 2203
24 Ga0070669_100002272 3300005353 Bacteria 13944
25 Ga0070669_101230041 3300005353 Unclassified 647
26 Ga0070675_100082428 3300005354 Bacteria 2683
27 Ga0070671_100563601 3300005355 Bacteria 983
28 Ga0070671_100918627 3300005355 Unclassified 765
29 Ga0070674_100357043 3300005356 Bacteria 1182
30 Ga0070673_100002995 3300005364 Bacteria 10423
31 Ga0070673_100117114 3300005364 Bacteria 2217
32 Ga0070673_100819170 3300005364 Bacteria 860
33 Ga0070688_100056134 3300005365 Bacteria 2472
34 Ga0070703_10000180 3300005406 Bacteria 30778
35 Ga0070709_10390460 3300005434 Bacteria 1037
36 Ga0070701_10118709 3300005438 Bacteria 1487
37 Ga0070701_10220374 3300005438 Bacteria 1131
38 Ga0070711_100114221 3300005439 Bacteria 1987
39 Ga0070711_100346895 3300005439 Unclassified 1193
40 Ga0070705_100049046 3300005440 Bacteria 2450
41 Ga0070705_100199685 3300005440 Bacteria 1370
42 Ga0070705_100252540 3300005440 Bacteria 1239
43 Ga0070705_100388369 3300005440 Bacteria 1030
44 Ga0070705_100659944 3300005440 Bacteria 817
45 Ga0070705_100689896 3300005440 Bacteria 801
46 Ga0070705_101442289 3300005440 Bacteria 575
47 Ga0070700_100122451 3300005441 Bacteria 1745
48 Ga0070700_100389383 3300005441 Bacteria 1045
49 Ga0070694_100008011 3300005444 Bacteria 6456
50 Ga0070694_100050434 3300005444 Bacteria 2806
51 Ga0070694_100092083 3300005444 Bacteria 2129
52 Ga0070694_100153640 3300005444 Bacteria 1683
53 Ga0070694_100244847 3300005444 Bacteria 1354
54 Ga0070694_101098616 3300005444 Bacteria 663
55 Ga0070694_101246313 3300005444 Bacteria 624
56 Ga0070708_100135412 3300005445 Unclassified 2282
57 Ga0070708_100165287 3300005445 Bacteria 2064
58 Ga0070708_100241383 3300005445 Bacteria 1696
59 Ga0070708_100297636 3300005445 Bacteria 1519
60 Ga0070708_100493322 3300005445 Bacteria 1155
61 Ga0070708_100689098 3300005445 Bacteria 962
62 Ga0070708_100736749 3300005445 Bacteria 927
63 Ga0070678_100246494 3300005456 Bacteria 1496
64 Ga0070685_10171517 3300005466 Unclassified 1391
65 Ga0070706_100001796 3300005467 Bacteria 22211
66 Ga0070706_100011523 3300005467 Bacteria 8218
67 Ga0070706_100444253 3300005467 Bacteria 1207
68 Ga0070707_100000053 3300005468 Bacteria 100755
69 Ga0070707_100004457 3300005468 Bacteria 13110
70 Ga0070707_100049035 3300005468 Bacteria 4047
71 Ga0070707_100139852 3300005468 Bacteria 2356
72 Ga0070707_100348578 3300005468 Bacteria 1438
73 Ga0070707_100611880 3300005468 Bacteria 1052
74 Ga0070698_100000127 3300005471 Bacteria 66092
75 Ga0070698_100068342 3300005471 Bacteria 3571
76 Ga0070698_100088599 3300005471 Unclassified 3079
77 Ga0070698_100106269 3300005471 Bacteria 2776
78 Ga0070698_100150198 3300005471 Bacteria 2277
79 Ga0070698_100151063 3300005471 Unclassified 2270
80 Ga0070698_100400269 3300005471 Bacteria 1306
81 Ga0070698_100508349 3300005471 Bacteria 1143
82 Ga0070698_101294119 3300005471 Bacteria 679
83 Ga0070699_100021527 3300005518 Bacteria 5560
84 Ga0070699_100057551 3300005518 Unclassified 3367
85 Ga0070699_100144861 3300005518 Bacteria 2099
86 Ga0070699_100218175 3300005518 Unclassified 1699
87 Ga0070699_100549456 3300005518 Bacteria 1051
88 Ga0070699_100737093 3300005518 Bacteria 901
89 Ga0070699_100769344 3300005518 Bacteria 881
90 Ga0070697_100000815 3300005536 Bacteria 23370
91 Ga0070697_100003479 3300005536 Bacteria 12102
92 Ga0070697_100011445 3300005536 Bacteria 6935
93 Ga0070697_100066544 3300005536 Unclassified 2946
94 Ga0070697_100180086 3300005536 Bacteria 1791
95 Ga0070697_100372475 3300005536 Bacteria 1236
96 Ga0070697_100759230 3300005536 Unclassified 857
97 Ga0070697_100865792 3300005536 Bacteria 801
98 Ga0070697_101062566 3300005536 Bacteria 720
99 Ga0070686_100045973 3300005544 Bacteria 2752
100 Ga0070686_100376508 3300005544 Bacteria 1073
101 Ga0070686_100535230 3300005544 Bacteria 914
102 Ga0070695_100039557 3300005545 Bacteria 2982
103 Ga0070695_100134958 3300005545 Bacteria 1705
104 Ga0070695_100240626 3300005545 Bacteria 1313
105 Ga0070695_100496900 3300005545 Bacteria 943
106 Ga0070696_100008993 3300005546 Bacteria 6685
107 Ga0070696_100012093 3300005546 Bacteria 5784
108 Ga0070696_100170390 3300005546 Bacteria 1609
109 Ga0070696_100405914 3300005546 Bacteria 1067
110 Ga0070696_100869253 3300005546 Unclassified 746
111 Ga0070693_100280155 3300005547 Bacteria 1116
112 Ga0070665_101478328 3300005548 Bacteria 688
113 Ga0070704_100002410 3300005549 Bacteria 10500
114 Ga0070704_100018567 3300005549 Bacteria 4450
115 Ga0070704_100061952 3300005549 Bacteria 2680
116 Ga0070704_100207803 3300005549 Unclassified 1584
117 Ga0070704_100347892 3300005549 Bacteria 1250
118 Ga0070704_100750614 3300005549 Bacteria 869
119 Ga0070704_101228226 3300005549 Archaea 684
120 Ga0068855_100976096 3300005563 Bacteria 891
121 Ga0070702_100379367 3300005615 Bacteria 1005
122 Ga0068859_100103258 3300005617 Bacteria 2908
123 Ga0068859_100134390 3300005617 Bacteria 2545
124 Ga0068859_100523639 3300005617 Bacteria 1280
125 Ga0068859_100564554 3300005617 Bacteria 1232
126 Ga0068859_101065629 3300005617 Bacteria 889
127 Ga0068859_101146083 3300005617 Bacteria 856
128 Ga0068864_100149448 3300005618 Bacteria 2115
129 Ga0068864_100291258 3300005618 Unclassified 1526
130 Ga0068866_10032214 3300005718 Bacteria 2532
131 Ga0068861_100004992 3300005719 Bacteria 8942
132 Ga0068861_101117195 3300005719 Bacteria 758
133 Ga0068863_100235735 3300005841 Bacteria 1766
134 Ga0068863_100955209 3300005841 Bacteria 859
135 Ga0068858_100000005 3300005842 Bacteria 305830
136 Ga0068858_100098723 3300005842 Bacteria 2722
137 Ga0068858_100248401 3300005842 Bacteria 1690
138 Ga0068858_100792898 3300005842 Bacteria 924
139 Ga0068860_100217400 3300005843 Bacteria 1855
140 Ga0068860_100587915 3300005843 Unclassified 1118
141 Ga0068860_100822237 3300005843 Bacteria 943
142 Ga0068860_102739560 3300005843 Bacteria 511
143 Ga0068862_100066794 3300005844 Bacteria 3099
144 Ga0081539_10023777 3300005985 Bacteria 4000
145 Ga0070715_10000034 3300006163 Bacteria 80012
146 Ga0070716_100000003 3300006173 Bacteria 312721
147 Ga0070716_100090955 3300006173 Bacteria 1847
148 Ga0070716_100103884 3300006173 Bacteria 1748
149 Ga0097621_100301985 3300006237 Bacteria 1414
150 Ga0068871_100497019 3300006358 Bacteria 1099
151 Ga0068871_100797684 3300006358 Bacteria 870
152 Ga0075428_100046685 3300006844 Bacteria 4756
153 Ga0075430_100217672 3300006846 Bacteria 1585
154 Ga0075433_10085270 3300006852 Bacteria 2788
155 Ga0075433_10413841 3300006852 Bacteria 1189
156 Ga0075433_10487486 3300006852 Bacteria 1086
157 Ga0075434_100006736 3300006871 Bacteria 10556
158 Ga0075434_101137053 3300006871 Bacteria 794
159 Ga0075429_100034266 3300006880 Bacteria 4412
160 Ga0068865_100210061 3300006881 Bacteria 1516
161 Ga0068865_100487965 3300006881 Bacteria 1025
162 Ga0075436_100000002 3300006914 Bacteria 475522
163 Ga0097620_100103254 3300006931 Bacteria 2908
164 Ga0097620_100134390 3300006931 Bacteria 2545
165 Ga0097620_100523608 3300006931 Bacteria 1280
166 Ga0097620_100564620 3300006931 Bacteria 1232
167 Ga0097620_101065529 3300006931 Bacteria 889
168 Ga0075435_100042820 3300007076 Bacteria 3623
169 Ga0075435_101626768 3300007076 Bacteria 567
170 Ga0075435_101789785 3300007076 Bacteria 539
171 Ga0099794_10005650 3300007265 Bacteria 5035
172 Ga0099794_10157590 3300007265 Bacteria 1154
173 Ga0099794_10194824 3300007265 Bacteria 1037
174 Ga0099794_10368217 3300007265 Bacteria 749
175 Ga0111539_10103546 3300009094 Bacteria 3340
176 Ga0111539_10318920 3300009094 Bacteria 1809
177 Ga0111539_11737703 3300009094 Bacteria 723
178 Ga0105245_10189025 3300009098 Bacteria 1972
179 Ga0105245_11249332 3300009098 Bacteria 791
180 Ga0105245_12561735 3300009098 Bacteria 563
181 Ga0105247_10000002 3300009101 Bacteria 724587
182 Ga0114129_10017168 3300009147 Bacteria 10308
183 Ga0114129_10026989 3300009147 Bacteria 8130
184 Ga0114129_10050453 3300009147 Bacteria 5844
185 Ga0114129_10090258 3300009147 Unclassified 4248
186 Ga0114129_10328153 3300009147 Unclassified 2033
187 Ga0114129_10862522 3300009147 Bacteria 1150
188 Ga0105243_10000493 3300009148 Bacteria 40228
189 Ga0105243_10000558 3300009148 Bacteria 37622
190 Ga0105243_10031687 3300009148 Bacteria 4077
191 Ga0105243_10392778 3300009148 Bacteria 1286
192 Ga0105243_10653506 3300009148 Bacteria 1019
193 Ga0105243_10788136 3300009148 Unclassified 935
194 Ga0105243_11619702 3300009148 Bacteria 674
195 Ga0105243_12072754 3300009148 Bacteria 604
196 Ga0105242_10000817 3300009176 Bacteria 24173
197 Ga0105242_10001631 3300009176 Bacteria 17700
198 Ga0105242_10009656 3300009176 Bacteria 7393
199 Ga0105242_10203246 3300009176 Bacteria 1761
200 Ga0105242_10531730 3300009176 Bacteria 1124
201 Ga0105242_10617309 3300009176 Bacteria 1050
202 Ga0105242_10740851 3300009176 Bacteria 966
203 Ga0105248_10078914 3300009177 Bacteria 3700
204 Ga0105248_10634435 3300009177 Bacteria 1205
205 Ga0105248_10978660 3300009177 Bacteria 956
206 Ga0105249_10000201 3300009553 Bacteria 68199
207 Ga0105249_10013960 3300009553 Bacteria 7100
208 Ga0105249_10545546 3300009553 Bacteria 1209
209 Ga0105239_10057361 3300010375 Bacteria 4271
210 Ga0105239_10525639 3300010375 Bacteria 1346
211 Ga0157370_10743841 3300013104 Unclassified 894
212 Ga0157374_11246177 3300013296 Unclassified 765
213 Ga0157378_10000077 3300013297 Bacteria 89664
214 Ga0157378_10004689 3300013297 Bacteria 11992
215 Ga0157378_10032765 3300013297 Bacteria 4592
216 Ga0157378_10050211 3300013297 Bacteria 3712
217 Ga0157378_10070495 3300013297 Bacteria 3139
218 Ga0157378_10097908 3300013297 Unclassified 2674
219 Ga0157378_10168865 3300013297 Bacteria 2050
220 Ga0157378_10272672 3300013297 Bacteria 1628
221 Ga0157378_10404655 3300013297 Bacteria 1346
222 Ga0157378_10434747 3300013297 Bacteria 1299
223 Ga0163162_10000128 3300013306 Bacteria 68199
224 Ga0163162_10029921 3300013306 Bacteria 5392
225 Ga0163162_10058391 3300013306 Bacteria 3887
226 Ga0163162_10093748 3300013306 Bacteria 3088
227 Ga0157375_10004099 3300013308 Bacteria 12637
228 Ga0157375_10039220 3300013308 Bacteria 4557
229 Ga0157375_10359982 3300013308 Bacteria 1621
230 Ga0157375_10373450 3300013308 Bacteria 1592
231 Ga0157375_10444411 3300013308 Bacteria 1462
232 Ga0163163_10026850 3300014325 Bacteria 5508
233 Ga0157380_10019160 3300014326 Bacteria 5097
234 Ga0157380_11733122 3300014326 Unclassified 683
235 Ga0157380_12227519 3300014326 Unclassified 612
236 Ga0157380_12390012 3300014326 Unclassified 594
237 Ga0163161_10777763 3300017792 Bacteria 803
238 Ga0163161_11035315 3300017792 Bacteria 702
239 Ga0163161_11502918 3300017792 Bacteria 591
240 Ga0206350_11396361 3300020080 Bacteria 1289
241 Ga0213871_10000630 3300021441 Bacteria 5030
242 Ga0213871_10248959 3300021441 Unclassified 564
243 Ga0207672_1000032 3300025223 Bacteria 18064
244 Ga0207653_10000154 3300025885 Bacteria 48375
245 Ga0207653_10267055 3300025885 Unclassified 658
246 Ga0207642_10086711 3300025899 Bacteria 1535
247 Ga0207710_10000002 3300025900 Bacteria 1251998
248 Ga0207688_10048768 3300025901 Bacteria 2366
249 Ga0207685_10000006 3300025905 Bacteria 284255
250 Ga0207645_10554984 3300025907 Bacteria 779
251 Ga0207684_10004349 3300025910 Bacteria 13378
252 Ga0207684_10161920 3300025910 Bacteria 1927
253 Ga0207684_10193920 3300025910 Bacteria 1752
254 Ga0207695_10227920 3300025913 Bacteria 1769
255 Ga0207663_10531445 3300025916 Unclassified 917
256 Ga0207663_10618805 3300025916 Bacteria 852
257 Ga0207660_10725210 3300025917 Bacteria 811
258 Ga0207662_10008830 3300025918 Bacteria 5528
259 Ga0207662_10027170 3300025918 Bacteria 3303
260 Ga0207662_10028282 3300025918 Bacteria 3240
261 Ga0207662_10049790 3300025918 Bacteria 2486
262 Ga0207662_10453752 3300025918 Unclassified 877
263 Ga0207646_10000575 3300025922 Bacteria 48116
264 Ga0207646_10001854 3300025922 Bacteria 25492
265 Ga0207646_10059960 3300025922 Bacteria 3398
266 Ga0207646_10109812 3300025922 Bacteria 2475
267 Ga0207646_10119472 3300025922 Bacteria 2368
268 Ga0207646_10161041 3300025922 Bacteria 2025
269 Ga0207646_10858150 3300025922 Bacteria 807
270 Ga0207646_11583803 3300025922 Bacteria 565
271 Ga0207681_10000966 3300025923 Bacteria 18757
272 Ga0207681_10202758 3300025923 Bacteria 1524
273 Ga0207681_11144855 3300025923 Unclassified 653
274 Ga0207650_10211897 3300025925 Bacteria 1556
275 Ga0207659_10209460 3300025926 Bacteria 1561
276 Ga0207687_11185720 3300025927 Bacteria 656
277 Ga0207644_10000361 3300025931 Bacteria 29606
278 Ga0207686_10000257 3300025934 Bacteria 40231
279 Ga0207686_10000802 3300025934 Bacteria 19287
280 Ga0207686_10002748 3300025934 Bacteria 9540
281 Ga0207686_10201592 3300025934 Bacteria 1425
282 Ga0207686_10221793 3300025934 Bacteria 1366
283 Ga0207686_10437496 3300025934 Unclassified 1004
284 Ga0207709_10000325 3300025935 Bacteria 51529
285 Ga0207709_10000427 3300025935 Bacteria 40208
286 Ga0207709_10095954 3300025935 Bacteria 1949
287 Ga0207709_10349433 3300025935 Bacteria 1116
288 Ga0207709_10832751 3300025935 Bacteria 746
289 Ga0207709_11005920 3300025935 Bacteria 681
290 Ga0207670_10244036 3300025936 Bacteria 1385
291 Ga0207704_10220146 3300025938 Bacteria 1404
292 Ga0207704_10372103 3300025938 Bacteria 1119
293 Ga0207665_10000009 3300025939 Bacteria 162252
294 Ga0207665_10091955 3300025939 Bacteria 2104
295 Ga0207665_10167961 3300025939 Bacteria 1582
296 Ga0207691_10371150 3300025940 Bacteria 1222
297 Ga0207689_10005332 3300025942 Bacteria 11523
298 Ga0207689_10080898 3300025942 Bacteria 2670
299 Ga0207689_10211504 3300025942 Bacteria 1602
300 Ga0207679_11860700 3300025945 Bacteria 549
301 Ga0207651_10012392 3300025960 Bacteria 4825
302 Ga0207651_10090316 3300025960 Bacteria 2239
303 Ga0207651_10166071 3300025960 Bacteria 1736
304 Ga0207712_10000259 3300025961 Bacteria 51318
305 Ga0207712_10069479 3300025961 Bacteria 2527
306 Ga0207668_10002115 3300025972 Bacteria 11592
307 Ga0207640_11005117 3300025981 Bacteria 734
308 Ga0207677_10519777 3300026023 Bacteria 1032
309 Ga0207677_10590988 3300026023 Bacteria 973
310 Ga0207703_10001954 3300026035 Bacteria 18218
311 Ga0207703_10207627 3300026035 Bacteria 1744
312 Ga0207708_10037147 3300026075 Bacteria 3710
313 Ga0207708_10507019 3300026075 Bacteria 1012
314 Ga0207708_10625373 3300026075 Bacteria 914
315 Ga0207641_10489830 3300026088 Bacteria 1193
316 Ga0207641_10517172 3300026088 Bacteria 1161
317 Ga0207641_10585523 3300026088 Bacteria 1091
318 Ga0207648_10220773 3300026089 Bacteria 1684
319 Ga0207676_10260174 3300026095 Unclassified 1566
320 Ga0207676_11000373 3300026095 Bacteria 824
321 Ga0207676_11236565 3300026095 Bacteria 741
322 Ga0207675_100000853 3300026118 Bacteria 30381
323 Ga0207675_100152941 3300026118 Bacteria 2197
324 Ga0207675_100500556 3300026118 Bacteria 1209
325 Ga0207675_100918871 3300026118 Bacteria 892
326 Ga0207683_10366889 3300026121 Bacteria 1323
327 Ga0207428_10026232 3300027907 Bacteria 4865
328 Ga0207428_10872933 3300027907 Bacteria 636
329 Ga0268266_11345991 3300028379 Bacteria 689
330 Ga0268264_10573411 3300028381 Bacteria 1109
331 Ga0268264_11581186 3300028381 Bacteria 666
332 Ga0265336_10003792 3300028666 Bacteria 5834
333 Ga0265338_10003491 3300028800 Bacteria 22071
334 Ga0265338_10007519 3300028800 Bacteria 13482
335 Ga0265320_10184636 3300031240 Bacteria 934
336 Ga0316576_10054666 3300031727 Bacteria 2912
337 Ga0307413_10400737 3300031824 Bacteria 1075
338 Ga0307415_100231951 3300032126 Bacteria 1487
339 Ga0316583_10018939 3300032133 Bacteria 2473
340 Ga0395898_0564255 3300037466 Bacteria 1081
341 Ga0242420_039395 3300038996 Bacteria 899
342 Ga0436360_0287319 3300039438 Bacteria 5310
343 Ga0436360_1269472 3300039438 Unclassified 698
344 Ga0436361_0525479 3300039447 Bacteria 1204
345 Ga0436362_0451221 3300039453 Unclassified 2379
346 Ga0451853_1569424 3300041512 Bacteria 643
347 Ga0439440_0262414 3300042993 Bacteria 529
348 Ga0453683_0071734 3300044673 Bacteria 2167
349 Ga0451576_0055815 3300045051 Bacteria 4131
350 Ga0495580_0000528 3300046472 Bacteria 32306
351 Ga0495582_0107886 3300046473 Bacteria 1563
352 Ga0495662_0092051 3300046476 Bacteria 1479
353 Ga0495598_0149317 3300046537 Bacteria 814
354 Ga0495621_0024829 3300046539 Bacteria 2006
355 Ga0495656_0339899 3300046615 Bacteria 776
356 Ga0495659_0102382 3300046664 Bacteria 1110
357 Ga0495658_0198770 3300046683 Bacteria 1249
358 Ga0495670_0054189 3300046691 Bacteria 2009
359 Ga0495636_0458387 3300047318 Bacteria 613
360 Ga0495674_1312967 3300047319 Unclassified 542
361 Ga0495677_0093839 3300047445 Bacteria 1132
362 Ga0496100_0330137 3300048903 Bacteria 1148
363 Ga0496106_0000981 3300048909 Bacteria 20812
364 Ga0501048_0409789 3300049582 Bacteria 969
365 Ga0501076_0116943 3300049592 Bacteria 2158
366 Ga0501077_0232356 3300049593 Unclassified 1172
367 Ga0501080_0493939 3300049742 Unclassified 1094
368 Ga0501081_0904178 3300049743 Bacteria 666
369 Ga0501044_0516880 3300049823 Bacteria 1094
370 Ga0501044_0803079 3300049823 Unclassified 820
371 nmdc:mga05p37_127174_c1 3300050507 Bacteria 3129
372 nmdc:mga05p37_38262_c1 3300050507 Bacteria 5884
373 nmdc:mga05p37_54431_c1 3300050507 Bacteria 4923
374 nmdc:mga09592_241896_c1 3300050508 Bacteria 1564
375 nmdc:mga0qj67_866872_c1 3300050509 Bacteria 713
376 nmdc:mga08y16_969948_c1 3300050511 Bacteria 832
377 nmdc:mga0n895_113360_c1 3300050512 Bacteria 2729
378 nmdc:mga0n895_170866_c1 3300050512 Bacteria 2206
379 nmdc:mga0n895_965430_c1 3300050512 Bacteria 835
380 nmdc:mga0rr50_33812_c1 3300050513 Bacteria 3656
381 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
382 nmdc:mga0a205_26799_c2 3300050515 Bacteria 3291
383 nmdc:mga0a205_349141_c1 3300050515 Bacteria 1347
384 nmdc:mga0a205_520262_c1 3300050515 Bacteria 1046
385 nmdc:mga0a205_56342_c1 3300050515 Bacteria 3795
386 Ga0501082_1194773 3300060353 Bacteria 665

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0451221 Ga0436362_0451221_1706_2137 143
2 3300028666 Ga0265336_10003792 Ga0265336_100037924 146
3 3300028800 Ga0265338_10003491 Ga0265338_100034913 148
4 3300028800 Ga0265338_10007519 Ga0265338_1000751918 148
5 3300039447 Ga0436361_0525479 Ga0436361_0525479_267_713 148
6 3300005334 Ga0068869_101022997 Ga0068869_1010229971 150
7 3300005444 Ga0070694_100153640 Ga0070694_1001536402 150
8 3300005444 Ga0070694_101098616 Ga0070694_1010986161 150
9 3300005471 Ga0070698_100106269 Ga0070698_1001062692 150
10 3300005471 Ga0070698_101294119 Ga0070698_1012941191 150
11 3300005518 Ga0070699_100021527 Ga0070699_1000215271 150
12 3300005536 Ga0070697_100000815 Ga0070697_10000081516 150
13 3300005536 Ga0070697_101062566 Ga0070697_1010625661 150
14 3300005545 Ga0070695_100240626 Ga0070695_1002406263 150
15 3300005546 Ga0070696_100008993 Ga0070696_1000089938 150
16 3300005546 Ga0070696_100012093 Ga0070696_1000120935 150
17 3300005547 Ga0070693_100280155 Ga0070693_1002801552 150
18 3300005549 Ga0070704_100347892 Ga0070704_1003478922 150
19 3300007265 Ga0099794_10194824 Ga0099794_101948242 150
20 3300009148 Ga0105243_11619702 Ga0105243_116197021 150
21 3300013297 Ga0157378_10070495 Ga0157378_100704953 150
22 3300013297 Ga0157378_10434747 Ga0157378_104347471 150
23 3300021441 Ga0213871_10000630 Ga0213871_100006302 150
24 3300021441 Ga0213871_10248959 Ga0213871_102489591 150
25 3300025940 Ga0207691_10371150 Ga0207691_103711502 150
26 3300031240 Ga0265320_10184636 Ga0265320_101846362 150
27 3300037466 Ga0395898_0564255 Ga0395898_0564255_500_952 150
28 3300039438 Ga0436360_0287319 Ga0436360_0287319_3872_4324 150
29 3300039438 Ga0436360_1269472 Ga0436360_1269472_74_526 150
30 3300046539 Ga0495621_0024829 Ga0495621_0024829_182_688 150
31 3300005327 Ga0070658_10100311 Ga0070658_101003112 151
32 3300005445 Ga0070708_100689098 Ga0070708_1006890982 151
33 3300005468 Ga0070707_100348578 Ga0070707_1003485782 151
34 3300005549 Ga0070704_101228226 Ga0070704_1012282261 151
35 3300006163 Ga0070715_10000034 Ga0070715_1000003414 151
36 3300006173 Ga0070716_100000003 Ga0070716_100000003125 151
37 3300006173 Ga0070716_100103884 Ga0070716_1001038842 151
38 3300006852 Ga0075433_10413841 Ga0075433_104138412 151
39 3300006871 Ga0075434_101137053 Ga0075434_1011370532 151
40 3300007076 Ga0075435_101626768 Ga0075435_1016267681 151
41 3300009147 Ga0114129_10862522 Ga0114129_108625222 151
42 3300025905 Ga0207685_10000006 Ga0207685_1000000620 151
43 3300025918 Ga0207662_10027170 Ga0207662_100271703 151
44 3300025922 Ga0207646_10059960 Ga0207646_100599604 151
45 3300025939 Ga0207665_10000009 Ga0207665_100000097 151
46 3300025939 Ga0207665_10167961 Ga0207665_101679612 151
47 3300025945 Ga0207679_11860700 Ga0207679_118607001 151
48 3300028381 Ga0268264_11581186 Ga0268264_115811862 151
49 3300031824 Ga0307413_10400737 Ga0307413_104007371 151
50 3300032126 Ga0307415_100231951 Ga0307415_1002319513 151
51 3300049582 Ga0501048_0409789 Ga0501048_0409789_52_513 151
52 3300049823 Ga0501044_0516880 Ga0501044_0516880_561_1025 151
53 3300050512 nmdc:mga0n895_965430_c1 nmdc:mga0n895_965430_c1_108_572 151
54 3300050515 nmdc:mga0a205_26799_c2 nmdc:mga0a205_26799_c2_466_930 151
55 3300060353 Ga0501082_1194773 Ga0501082_1194773_52_513 151
56 3300000546 LJNas_1006241 LJNas_10062411 152
57 3300001426 JGI24030J14995_100424 JGI24030J14995_1004243 152
58 3300001432 JGI24034J14986_100008 JGI24034J14986_1000087 152
59 3300002074 JGI24748J21848_1000018 JGI24748J21848_100001839 152
60 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001492 152
61 3300005289 Ga0065704_10318779 Ga0065704_103187792 152
62 3300005293 Ga0065715_10161771 Ga0065715_101617712 152
63 3300005295 Ga0065707_10094673 Ga0065707_100946734 152
64 3300005295 Ga0065707_10161158 Ga0065707_101611581 152
65 3300005330 Ga0070690_100026897 Ga0070690_1000268971 152
66 3300005330 Ga0070690_100292549 Ga0070690_1002925492 152
67 3300005330 Ga0070690_100539826 Ga0070690_1005398262 152
68 3300005334 Ga0068869_100069471 Ga0068869_1000694714 152
69 3300005334 Ga0068869_100272036 Ga0068869_1002720362 152
70 3300005334 Ga0068869_100675194 Ga0068869_1006751942 152
71 3300005336 Ga0070680_101258930 Ga0070680_1012589301 152
72 3300005338 Ga0068868_100052504 Ga0068868_1000525042 152
73 3300005340 Ga0070689_100004049 Ga0070689_1000040499 152
74 3300005340 Ga0070689_100014454 Ga0070689_1000144544 152
75 3300005340 Ga0070689_100262878 Ga0070689_1002628781 152
76 3300005343 Ga0070687_100047480 Ga0070687_1000474803 152
77 3300005353 Ga0070669_100002272 Ga0070669_1000022728 152
78 3300005353 Ga0070669_101230041 Ga0070669_1012300411 152
79 3300005354 Ga0070675_100082428 Ga0070675_1000824282 152
80 3300005355 Ga0070671_100563601 Ga0070671_1005636011 152
81 3300005355 Ga0070671_100918627 Ga0070671_1009186272 152
82 3300005356 Ga0070674_100357043 Ga0070674_1003570432 152
83 3300005364 Ga0070673_100002995 Ga0070673_1000029954 152
84 3300005364 Ga0070673_100117114 Ga0070673_1001171143 152
85 3300005364 Ga0070673_100819170 Ga0070673_1008191702 152
86 3300005365 Ga0070688_100056134 Ga0070688_1000561342 152
87 3300005406 Ga0070703_10000180 Ga0070703_1000018019 152
88 3300005434 Ga0070709_10390460 Ga0070709_103904601 152
89 3300005438 Ga0070701_10118709 Ga0070701_101187092 152
90 3300005438 Ga0070701_10220374 Ga0070701_102203742 152
91 3300005439 Ga0070711_100114221 Ga0070711_1001142212 152
92 3300005439 Ga0070711_100346895 Ga0070711_1003468952 152
93 3300005440 Ga0070705_100049046 Ga0070705_1000490462 152
94 3300005440 Ga0070705_100199685 Ga0070705_1001996852 152
95 3300005440 Ga0070705_100252540 Ga0070705_1002525401 152
96 3300005440 Ga0070705_100388369 Ga0070705_1003883692 152
97 3300005440 Ga0070705_100659944 Ga0070705_1006599442 152
98 3300005440 Ga0070705_100689896 Ga0070705_1006898962 152
99 3300005440 Ga0070705_101442289 Ga0070705_1014422891 152
100 3300005441 Ga0070700_100122451 Ga0070700_1001224512 152
101 3300005441 Ga0070700_100389383 Ga0070700_1003893832 152
102 3300005444 Ga0070694_100008011 Ga0070694_1000080112 152
103 3300005444 Ga0070694_100050434 Ga0070694_1000504343 152
104 3300005444 Ga0070694_100092083 Ga0070694_1000920832 152
105 3300005444 Ga0070694_100244847 Ga0070694_1002448472 152
106 3300005444 Ga0070694_101246313 Ga0070694_1012463131 152
107 3300005445 Ga0070708_100135412 Ga0070708_1001354124 152
108 3300005445 Ga0070708_100165287 Ga0070708_1001652871 152
109 3300005445 Ga0070708_100241383 Ga0070708_1002413832 152
110 3300005445 Ga0070708_100297636 Ga0070708_1002976361 152
111 3300005445 Ga0070708_100493322 Ga0070708_1004933222 152
112 3300005445 Ga0070708_100736749 Ga0070708_1007367492 152
113 3300005456 Ga0070678_100246494 Ga0070678_1002464943 152
114 3300005466 Ga0070685_10171517 Ga0070685_101715172 152
115 3300005467 Ga0070706_100001796 Ga0070706_10000179616 152
116 3300005467 Ga0070706_100011523 Ga0070706_1000115233 152
117 3300005467 Ga0070706_100444253 Ga0070706_1004442531 152
118 3300005468 Ga0070707_100000053 Ga0070707_10000005351 152
119 3300005468 Ga0070707_100004457 Ga0070707_1000044575 152
120 3300005468 Ga0070707_100049035 Ga0070707_1000490355 152
121 3300005468 Ga0070707_100139852 Ga0070707_1001398522 152
122 3300005468 Ga0070707_100611880 Ga0070707_1006118801 152
123 3300005471 Ga0070698_100000127 Ga0070698_1000001276 152
124 3300005471 Ga0070698_100068342 Ga0070698_1000683423 152
125 3300005471 Ga0070698_100088599 Ga0070698_1000885992 152
126 3300005471 Ga0070698_100150198 Ga0070698_1001501982 152
127 3300005471 Ga0070698_100151063 Ga0070698_1001510632 152
128 3300005471 Ga0070698_100400269 Ga0070698_1004002692 152
129 3300005471 Ga0070698_100508349 Ga0070698_1005083492 152
130 3300005518 Ga0070699_100057551 Ga0070699_1000575513 152
131 3300005518 Ga0070699_100144861 Ga0070699_1001448612 152
132 3300005518 Ga0070699_100218175 Ga0070699_1002181752 152
133 3300005518 Ga0070699_100549456 Ga0070699_1005494562 152
134 3300005518 Ga0070699_100737093 Ga0070699_1007370931 152
135 3300005518 Ga0070699_100769344 Ga0070699_1007693442 152
136 3300005536 Ga0070697_100003479 Ga0070697_1000034794 152
137 3300005536 Ga0070697_100011445 Ga0070697_1000114453 152
138 3300005536 Ga0070697_100066544 Ga0070697_1000665442 152
139 3300005536 Ga0070697_100180086 Ga0070697_1001800862 152
140 3300005536 Ga0070697_100372475 Ga0070697_1003724752 152
141 3300005536 Ga0070697_100759230 Ga0070697_1007592301 152
142 3300005536 Ga0070697_100865792 Ga0070697_1008657921 152
143 3300005544 Ga0070686_100045973 Ga0070686_1000459733 152
144 3300005544 Ga0070686_100376508 Ga0070686_1003765081 152
145 3300005544 Ga0070686_100535230 Ga0070686_1005352302 152
146 3300005545 Ga0070695_100039557 Ga0070695_1000395572 152
147 3300005545 Ga0070695_100134958 Ga0070695_1001349582 152
148 3300005545 Ga0070695_100496900 Ga0070695_1004969002 152
149 3300005546 Ga0070696_100170390 Ga0070696_1001703903 152
150 3300005546 Ga0070696_100405914 Ga0070696_1004059141 152
151 3300005546 Ga0070696_100869253 Ga0070696_1008692532 152
152 3300005548 Ga0070665_101478328 Ga0070665_1014783281 152
153 3300005549 Ga0070704_100002410 Ga0070704_10000241011 152
154 3300005549 Ga0070704_100018567 Ga0070704_1000185673 152
155 3300005549 Ga0070704_100061952 Ga0070704_1000619522 152
156 3300005549 Ga0070704_100207803 Ga0070704_1002078032 152
157 3300005549 Ga0070704_100750614 Ga0070704_1007506142 152
158 3300005563 Ga0068855_100976096 Ga0068855_1009760961 152
159 3300005615 Ga0070702_100379367 Ga0070702_1003793672 152
160 3300005617 Ga0068859_100103258 Ga0068859_1001032583 152
161 3300005617 Ga0068859_100134390 Ga0068859_1001343903 152
162 3300005617 Ga0068859_100523639 Ga0068859_1005236392 152
163 3300005617 Ga0068859_100564554 Ga0068859_1005645542 152
164 3300005617 Ga0068859_101065629 Ga0068859_1010656291 152
165 3300005617 Ga0068859_101146083 Ga0068859_1011460832 152
166 3300005618 Ga0068864_100149448 Ga0068864_1001494484 152
167 3300005618 Ga0068864_100291258 Ga0068864_1002912583 152
168 3300005718 Ga0068866_10032214 Ga0068866_100322143 152
169 3300005719 Ga0068861_100004992 Ga0068861_1000049923 152
170 3300005719 Ga0068861_101117195 Ga0068861_1011171952 152
171 3300005841 Ga0068863_100235735 Ga0068863_1002357352 152
172 3300005841 Ga0068863_100955209 Ga0068863_1009552091 152
173 3300005842 Ga0068858_100000005 Ga0068858_100000005250 152
174 3300005842 Ga0068858_100098723 Ga0068858_1000987234 152
175 3300005842 Ga0068858_100248401 Ga0068858_1002484012 152
176 3300005842 Ga0068858_100792898 Ga0068858_1007928982 152
177 3300005843 Ga0068860_100217400 Ga0068860_1002174003 152
178 3300005843 Ga0068860_100587915 Ga0068860_1005879152 152
179 3300005843 Ga0068860_100822237 Ga0068860_1008222372 152
180 3300005843 Ga0068860_102739560 Ga0068860_1027395601 152
181 3300005844 Ga0068862_100066794 Ga0068862_1000667943 152
182 3300005985 Ga0081539_10023777 Ga0081539_100237775 152
183 3300006173 Ga0070716_100090955 Ga0070716_1000909552 152
184 3300006237 Ga0097621_100301985 Ga0097621_1003019852 152
185 3300006358 Ga0068871_100497019 Ga0068871_1004970191 152
186 3300006358 Ga0068871_100797684 Ga0068871_1007976842 152
187 3300006844 Ga0075428_100046685 Ga0075428_1000466854 152
188 3300006846 Ga0075430_100217672 Ga0075430_1002176722 152
189 3300006852 Ga0075433_10085270 Ga0075433_100852703 152
190 3300006852 Ga0075433_10487486 Ga0075433_104874863 152
191 3300006871 Ga0075434_100006736 Ga0075434_1000067366 152
192 3300006880 Ga0075429_100034266 Ga0075429_1000342664 152
193 3300006881 Ga0068865_100210061 Ga0068865_1002100612 152
194 3300006881 Ga0068865_100487965 Ga0068865_1004879652 152
195 3300006914 Ga0075436_100000002 Ga0075436_100000002103 152
196 3300006931 Ga0097620_100103254 Ga0097620_1001032542 152
197 3300006931 Ga0097620_100134390 Ga0097620_1001343903 152
198 3300006931 Ga0097620_100523608 Ga0097620_1005236082 152
199 3300006931 Ga0097620_100564620 Ga0097620_1005646202 152
200 3300006931 Ga0097620_101065529 Ga0097620_1010655291 152
201 3300007076 Ga0075435_100042820 Ga0075435_1000428203 152
202 3300007076 Ga0075435_101789785 Ga0075435_1017897851 152
203 3300007265 Ga0099794_10005650 Ga0099794_100056505 152
204 3300007265 Ga0099794_10157590 Ga0099794_101575902 152
205 3300007265 Ga0099794_10368217 Ga0099794_103682171 152
206 3300009094 Ga0111539_10103546 Ga0111539_101035463 152
207 3300009094 Ga0111539_10318920 Ga0111539_103189203 152
208 3300009094 Ga0111539_11737703 Ga0111539_117377031 152
209 3300009098 Ga0105245_10189025 Ga0105245_101890253 152
210 3300009098 Ga0105245_11249332 Ga0105245_112493321 152
211 3300009098 Ga0105245_12561735 Ga0105245_125617351 152
212 3300009101 Ga0105247_10000002 Ga0105247_10000002496 152
213 3300009147 Ga0114129_10017168 Ga0114129_100171687 152
214 3300009147 Ga0114129_10026989 Ga0114129_100269895 152
215 3300009147 Ga0114129_10050453 Ga0114129_100504536 152
216 3300009147 Ga0114129_10090258 Ga0114129_100902584 152
217 3300009147 Ga0114129_10328153 Ga0114129_103281534 152
218 3300009148 Ga0105243_10000493 Ga0105243_1000049314 152
219 3300009148 Ga0105243_10000558 Ga0105243_100005588 152
220 3300009148 Ga0105243_10031687 Ga0105243_100316874 152
221 3300009148 Ga0105243_10392778 Ga0105243_103927783 152
222 3300009148 Ga0105243_10653506 Ga0105243_106535061 152
223 3300009148 Ga0105243_10788136 Ga0105243_107881361 152
224 3300009148 Ga0105243_12072754 Ga0105243_120727541 152
225 3300009176 Ga0105242_10000817 Ga0105242_1000081710 152
226 3300009176 Ga0105242_10001631 Ga0105242_100016313 152
227 3300009176 Ga0105242_10009656 Ga0105242_100096565 152
228 3300009176 Ga0105242_10203246 Ga0105242_102032463 152
229 3300009176 Ga0105242_10531730 Ga0105242_105317302 152
230 3300009176 Ga0105242_10617309 Ga0105242_106173092 152
231 3300009176 Ga0105242_10740851 Ga0105242_107408512 152
232 3300009177 Ga0105248_10078914 Ga0105248_100789144 152
233 3300009177 Ga0105248_10634435 Ga0105248_106344352 152
234 3300009177 Ga0105248_10978660 Ga0105248_109786601 152
235 3300009553 Ga0105249_10000201 Ga0105249_1000020143 152
236 3300009553 Ga0105249_10013960 Ga0105249_100139604 152
237 3300009553 Ga0105249_10545546 Ga0105249_105455462 152
238 3300010375 Ga0105239_10057361 Ga0105239_100573612 152
239 3300010375 Ga0105239_10525639 Ga0105239_105256392 152
240 3300013104 Ga0157370_10743841 Ga0157370_107438411 152
241 3300013296 Ga0157374_11246177 Ga0157374_112461771 152
242 3300013297 Ga0157378_10000077 Ga0157378_1000007728 152
243 3300013297 Ga0157378_10004689 Ga0157378_100046897 152
244 3300013297 Ga0157378_10032765 Ga0157378_100327653 152
245 3300013297 Ga0157378_10050211 Ga0157378_100502114 152
246 3300013297 Ga0157378_10097908 Ga0157378_100979083 152
247 3300013297 Ga0157378_10168865 Ga0157378_101688652 152
248 3300013297 Ga0157378_10272672 Ga0157378_102726722 152
249 3300013297 Ga0157378_10404655 Ga0157378_104046551 152
250 3300013306 Ga0163162_10000128 Ga0163162_1000012843 152
251 3300013306 Ga0163162_10029921 Ga0163162_100299213 152
252 3300013306 Ga0163162_10058391 Ga0163162_100583914 152
253 3300013306 Ga0163162_10093748 Ga0163162_100937483 152
254 3300013308 Ga0157375_10004099 Ga0157375_1000409910 152
255 3300013308 Ga0157375_10039220 Ga0157375_100392204 152
256 3300013308 Ga0157375_10359982 Ga0157375_103599823 152
257 3300013308 Ga0157375_10373450 Ga0157375_103734502 152
258 3300013308 Ga0157375_10444411 Ga0157375_104444112 152
259 3300014325 Ga0163163_10026850 Ga0163163_100268503 152
260 3300014326 Ga0157380_10019160 Ga0157380_100191604 152
261 3300014326 Ga0157380_11733122 Ga0157380_117331221 152
262 3300014326 Ga0157380_12227519 Ga0157380_122275191 152
263 3300014326 Ga0157380_12390012 Ga0157380_123900121 152
264 3300017792 Ga0163161_10777763 Ga0163161_107777631 152
265 3300017792 Ga0163161_11035315 Ga0163161_110353152 152
266 3300017792 Ga0163161_11502918 Ga0163161_115029181 152
267 3300020080 Ga0206350_11396361 Ga0206350_113963612 152
268 3300025223 Ga0207672_1000032 Ga0207672_100003210 152
269 3300025885 Ga0207653_10000154 Ga0207653_1000015437 152
270 3300025885 Ga0207653_10267055 Ga0207653_102670551 152
271 3300025899 Ga0207642_10086711 Ga0207642_100867113 152
272 3300025900 Ga0207710_10000002 Ga0207710_10000002496 152
273 3300025901 Ga0207688_10048768 Ga0207688_100487682 152
274 3300025907 Ga0207645_10554984 Ga0207645_105549841 152
275 3300025910 Ga0207684_10004349 Ga0207684_100043496 152
276 3300025910 Ga0207684_10161920 Ga0207684_101619202 152
277 3300025910 Ga0207684_10193920 Ga0207684_101939202 152
278 3300025913 Ga0207695_10227920 Ga0207695_102279202 152
279 3300025916 Ga0207663_10531445 Ga0207663_105314452 152
280 3300025916 Ga0207663_10618805 Ga0207663_106188051 152
281 3300025917 Ga0207660_10725210 Ga0207660_107252101 152
282 3300025918 Ga0207662_10008830 Ga0207662_100088308 152
283 3300025918 Ga0207662_10028282 Ga0207662_100282823 152
284 3300025918 Ga0207662_10049790 Ga0207662_100497902 152
285 3300025918 Ga0207662_10453752 Ga0207662_104537522 152
286 3300025922 Ga0207646_10000575 Ga0207646_100005759 152
287 3300025922 Ga0207646_10001854 Ga0207646_1000185418 152
288 3300025922 Ga0207646_10109812 Ga0207646_101098124 152
289 3300025922 Ga0207646_10119472 Ga0207646_101194722 152
290 3300025922 Ga0207646_10161041 Ga0207646_101610412 152
291 3300025922 Ga0207646_10858150 Ga0207646_108581502 152
292 3300025922 Ga0207646_11583803 Ga0207646_115838031 152
293 3300025923 Ga0207681_10000966 Ga0207681_1000096611 152
294 3300025923 Ga0207681_10202758 Ga0207681_102027582 152
295 3300025923 Ga0207681_11144855 Ga0207681_111448551 152
296 3300025925 Ga0207650_10211897 Ga0207650_102118972 152
297 3300025926 Ga0207659_10209460 Ga0207659_102094602 152
298 3300025927 Ga0207687_11185720 Ga0207687_111857201 152
299 3300025931 Ga0207644_10000361 Ga0207644_1000036126 152
300 3300025934 Ga0207686_10000257 Ga0207686_1000025714 152
301 3300025934 Ga0207686_10000802 Ga0207686_1000080218 152
302 3300025934 Ga0207686_10002748 Ga0207686_100027486 152
303 3300025934 Ga0207686_10201592 Ga0207686_102015922 152
304 3300025934 Ga0207686_10221793 Ga0207686_102217932 152
305 3300025934 Ga0207686_10437496 Ga0207686_104374962 152
306 3300025935 Ga0207709_10000325 Ga0207709_1000032531 152
307 3300025935 Ga0207709_10000427 Ga0207709_1000042723 152
308 3300025935 Ga0207709_10095954 Ga0207709_100959543 152
309 3300025935 Ga0207709_10349433 Ga0207709_103494332 152
310 3300025935 Ga0207709_10832751 Ga0207709_108327511 152
311 3300025935 Ga0207709_11005920 Ga0207709_110059201 152
312 3300025936 Ga0207670_10244036 Ga0207670_102440362 152
313 3300025938 Ga0207704_10220146 Ga0207704_102201462 152
314 3300025938 Ga0207704_10372103 Ga0207704_103721032 152
315 3300025939 Ga0207665_10091955 Ga0207665_100919553 152
316 3300025942 Ga0207689_10005332 Ga0207689_100053324 152
317 3300025942 Ga0207689_10080898 Ga0207689_100808982 152
318 3300025942 Ga0207689_10211504 Ga0207689_102115042 152
319 3300025960 Ga0207651_10012392 Ga0207651_100123925 152
320 3300025960 Ga0207651_10090316 Ga0207651_100903162 152
321 3300025960 Ga0207651_10166071 Ga0207651_101660712 152
322 3300025961 Ga0207712_10000259 Ga0207712_1000025912 152
323 3300025961 Ga0207712_10069479 Ga0207712_100694792 152
324 3300025972 Ga0207668_10002115 Ga0207668_100021159 152
325 3300025981 Ga0207640_11005117 Ga0207640_110051172 152
326 3300026023 Ga0207677_10519777 Ga0207677_105197772 152
327 3300026023 Ga0207677_10590988 Ga0207677_105909882 152
328 3300026035 Ga0207703_10001954 Ga0207703_100019542 152
329 3300026035 Ga0207703_10207627 Ga0207703_102076272 152
330 3300026075 Ga0207708_10037147 Ga0207708_100371475 152
331 3300026075 Ga0207708_10507019 Ga0207708_105070191 152
332 3300026075 Ga0207708_10625373 Ga0207708_106253731 152
333 3300026088 Ga0207641_10489830 Ga0207641_104898302 152
334 3300026088 Ga0207641_10517172 Ga0207641_105171722 152
335 3300026088 Ga0207641_10585523 Ga0207641_105855232 152
336 3300026089 Ga0207648_10220773 Ga0207648_102207732 152
337 3300026095 Ga0207676_10260174 Ga0207676_102601743 152
338 3300026095 Ga0207676_11000373 Ga0207676_110003731 152
339 3300026095 Ga0207676_11236565 Ga0207676_112365652 152
340 3300026118 Ga0207675_100000853 Ga0207675_1000008533 152
341 3300026118 Ga0207675_100152941 Ga0207675_1001529411 152
342 3300026118 Ga0207675_100500556 Ga0207675_1005005562 152
343 3300026118 Ga0207675_100918871 Ga0207675_1009188711 152
344 3300026121 Ga0207683_10366889 Ga0207683_103668892 152
345 3300027907 Ga0207428_10026232 Ga0207428_100262322 152
346 3300027907 Ga0207428_10872933 Ga0207428_108729331 152
347 3300028379 Ga0268266_11345991 Ga0268266_113459912 152
348 3300028381 Ga0268264_10573411 Ga0268264_105734111 152
349 3300031727 Ga0316576_10054666 Ga0316576_100546662 152
350 3300032133 Ga0316583_10018939 Ga0316583_100189394 152
351 3300038996 Ga0242420_039395 Ga0242420_039395_364_828 152
352 3300041512 Ga0451853_1569424 Ga0451853_1569424_19_477 152
353 3300042993 Ga0439440_0262414 Ga0439440_0262414_42_500 152
354 3300044673 Ga0453683_0071734 Ga0453683_0071734_1406_1870 152
355 3300045051 Ga0451576_0055815 Ga0451576_0055815_3032_3496 152
356 3300046472 Ga0495580_0000528 Ga0495580_0000528_10768_11232 152
357 3300046473 Ga0495582_0107886 Ga0495582_0107886_82_549 152
358 3300046476 Ga0495662_0092051 Ga0495662_0092051_389_925 152
359 3300046537 Ga0495598_0149317 Ga0495598_0149317_202_666 152
360 3300046615 Ga0495656_0339899 Ga0495656_0339899_200_664 152
361 3300046664 Ga0495659_0102382 Ga0495659_0102382_479_943 152
362 3300046683 Ga0495658_0198770 Ga0495658_0198770_385_921 152
363 3300046691 Ga0495670_0054189 Ga0495670_0054189_1287_1751 152
364 3300047318 Ga0495636_0458387 Ga0495636_0458387_11_475 152
365 3300047319 Ga0495674_1312967 Ga0495674_1312967_44_511 152
366 3300047445 Ga0495677_0093839 Ga0495677_0093839_72_536 152
367 3300048903 Ga0496100_0330137 Ga0496100_0330137_97_561 152
368 3300048909 Ga0496106_0000981 Ga0496106_0000981_15140_15604 152
369 3300049592 Ga0501076_0116943 Ga0501076_0116943_1222_1689 152
370 3300049593 Ga0501077_0232356 Ga0501077_0232356_306_764 152
371 3300049742 Ga0501080_0493939 Ga0501080_0493939_492_950 152
372 3300049743 Ga0501081_0904178 Ga0501081_0904178_148_615 152
373 3300049823 Ga0501044_0803079 Ga0501044_0803079_222_689 152
374 3300050507 nmdc:mga05p37_127174_c1 nmdc:mga05p37_127174_c1_1116_1574 152
375 3300050507 nmdc:mga05p37_38262_c1 nmdc:mga05p37_38262_c1_5158_5622 152
376 3300050507 nmdc:mga05p37_54431_c1 nmdc:mga05p37_54431_c1_3963_4421 152
377 3300050508 nmdc:mga09592_241896_c1 nmdc:mga09592_241896_c1_131_595 152
378 3300050509 nmdc:mga0qj67_866872_c1 nmdc:mga0qj67_866872_c1_226_690 152
379 3300050511 nmdc:mga08y16_969948_c1 nmdc:mga08y16_969948_c1_133_597 152
380 3300050512 nmdc:mga0n895_113360_c1 nmdc:mga0n895_113360_c1_1772_2236 152
381 3300050512 nmdc:mga0n895_170866_c1 nmdc:mga0n895_170866_c1_896_1360 152
382 3300050513 nmdc:mga0rr50_33812_c1 nmdc:mga0rr50_33812_c1_885_1349 152
383 3300050514 nmdc:mga08x19_9_c1 nmdc:mga08x19_9_c1_298350_298814 152
384 3300050515 nmdc:mga0a205_349141_c1 nmdc:mga0a205_349141_c1_515_979 152
385 3300050515 nmdc:mga0a205_520262_c1 nmdc:mga0a205_520262_c1_539_1003 152
386 3300050515 nmdc:mga0a205_56342_c1 nmdc:mga0a205_56342_c1_42_506 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

32

161

0.99

PF08534

Redoxin

Redoxin

31

177

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9464 11 151
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.9452 11 151
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9413 1 151
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9365 1 149
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.9336 3 151
ID Description Score Start End Superfamily
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9796 3 151 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9791 3 149 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9598 3 149 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9544 3 151 3.40.30.10
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9464 11 151 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A432TGI5-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9973 3 91 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A838F4Z2-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9958 3 151 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A2V8SK77-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9949 21 150 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A1F8SL95-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.991 1 129 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A1I0ZE58-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9894 1 147 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Feature Viewer

pLDDT pTM Quality
95.95 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map