F430418

General Info

Members Datasets Scaffolds Average Seq Length
386 234 772 200

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100047788|Ga0070675_1000477882
Length 229
Sequence MDSDPFVASRLRMTPESYARVVLRFDTMSPISRGFVGKRPSTDPRRLPPGQYVTTDFPVLSAGPTPHSPLAAWSFTIRGAVAQTKTWTWSEFTAIPPETIKTDIHCVTKWSKFDTTWSGVSLDVLLSESGVDPSAKFLTAWSDGGYTTNLPLEAVTGGKAWVAFSYDGKPLTPEHGGPARLLVPRLYFWKSAKWVRGIELLREDVPGFWEVNGYNNYGDPWKEQRYQGD

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
77 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
127 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
132 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
220 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
221 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
232 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
233 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
234 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 94.82
Metatranscriptomes 4.4
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 7.77
Rhizosphere 84.97
Stem 0
Stem Tuber 0.26
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100047788 3300005354 Bacteria 3507
2 Ga0070676_10227595 3300005328 Bacteria 1234
3 Ga0070683_100012706 3300005329 Bacteria 7323
4 Ga0070683_100260940 3300005329 Bacteria 1648
5 Ga0070683_100280284 3300005329 Bacteria 1585
6 Ga0070677_10383465 3300005333 Bacteria 737
7 Ga0070680_100083633 3300005336 Bacteria 2636
8 Ga0070680_100174854 3300005336 Bacteria 1807
9 Ga0070680_100401194 3300005336 Bacteria 1169
10 Ga0070682_100071574 3300005337 Bacteria 2220
11 Ga0070682_100267205 3300005337 Bacteria 1241
12 Ga0070682_100678030 3300005337 Bacteria 824
13 Ga0068868_100022858 3300005338 Bacteria 4726
14 Ga0068868_100245733 3300005338 Bacteria 1505
15 Ga0070689_100074143 3300005340 Bacteria 2663
16 Ga0070691_10013685 3300005341 Bacteria 3719
17 Ga0070691_10281282 3300005341 Bacteria 902
18 Ga0070661_100304386 3300005344 Bacteria 1241
19 Ga0070668_100065331 3300005347 Bacteria 2822
20 Ga0070668_100371019 3300005347 Bacteria 1216
21 Ga0070669_100433185 3300005353 Bacteria 1081
22 Ga0070675_100175553 3300005354 Bacteria 1850
23 Ga0070671_100475730 3300005355 Bacteria 1073
24 Ga0070673_100166052 3300005364 Bacteria 1881
25 Ga0070659_100111685 3300005366 Bacteria 2207
26 Ga0070659_100268512 3300005366 Bacteria 1417
27 Ga0070709_10001361 3300005434 Bacteria 13346
28 Ga0070714_100000545 3300005435 Bacteria 27112
29 Ga0070714_100004996 3300005435 Bacteria 10082
30 Ga0070714_100016154 3300005435 Bacteria 6021
31 Ga0070714_100051724 3300005435 Bacteria 3503
32 Ga0070714_100202704 3300005435 Bacteria 1815
33 Ga0070714_100611583 3300005435 Bacteria 1047
34 Ga0070714_100721221 3300005435 Bacteria 963
35 Ga0070713_100000483 3300005436 Bacteria 25351
36 Ga0070713_100023820 3300005436 Bacteria 4758
37 Ga0070713_100146973 3300005436 Bacteria 2093
38 Ga0070713_100262907 3300005436 Bacteria 1577
39 Ga0070713_100491416 3300005436 Bacteria 1157
40 Ga0070710_10000539 3300005437 Bacteria 17930
41 Ga0070710_10032631 3300005437 Bacteria 2822
42 Ga0070711_100029518 3300005439 Bacteria 3619
43 Ga0070700_100004519 3300005441 Bacteria 7274
44 Ga0070663_100059847 3300005455 Bacteria 2738
45 Ga0070678_100104014 3300005456 Bacteria 2207
46 Ga0070681_10034417 3300005458 Bacteria 5086
47 Ga0070681_10689147 3300005458 Bacteria 937
48 Ga0070681_11187284 3300005458 Bacteria 685
49 Ga0070685_10023400 3300005466 Bacteria 3382
50 Ga0070706_100096118 3300005467 Bacteria 2750
51 Ga0070707_100024458 3300005468 Bacteria 5721
52 Ga0070698_100033337 3300005471 Bacteria 5335
53 Ga0070679_100001023 3300005530 Bacteria 24378
54 Ga0070679_100131691 3300005530 Bacteria 2482
55 Ga0070679_100188263 3300005530 Bacteria 2033
56 Ga0070684_100021431 3300005535 Bacteria 5378
57 Ga0070684_100625467 3300005535 Bacteria 1002
58 Ga0070684_100882506 3300005535 Bacteria 838
59 Ga0070697_100083457 3300005536 Bacteria 2635
60 Ga0070686_100498301 3300005544 Bacteria 945
61 Ga0070693_100578196 3300005547 Bacteria 808
62 Ga0070665_100167926 3300005548 Bacteria 2196
63 Ga0068855_100000002 3300005563 Bacteria 616881
64 Ga0068855_100443693 3300005563 Bacteria 1417
65 Ga0070664_100193927 3300005564 Bacteria 1811
66 Ga0068857_100092980 3300005577 Bacteria 2700
67 Ga0068857_100325277 3300005577 Bacteria 1421
68 Ga0068856_100050989 3300005614 Bacteria 4080
69 Ga0068856_100480991 3300005614 Bacteria 1263
70 Ga0068852_100458142 3300005616 Bacteria 1264
71 Ga0068859_100028126 3300005617 Bacteria 5636
72 Ga0068864_100046225 3300005618 Bacteria 3735
73 Ga0068864_100914425 3300005618 Bacteria 867
74 Ga0068851_10182777 3300005834 Bacteria 1162
75 Ga0068863_100084199 3300005841 Bacteria 3014
76 Ga0068862_100018134 3300005844 Bacteria 5861
77 Ga0081455_10026174 3300005937 Bacteria 5373
78 Ga0081455_10041852 3300005937 Bacteria 4024
79 Ga0070717_10002239 3300006028 Bacteria 13559
80 Ga0070717_10002725 3300006028 Bacteria 12478
81 Ga0070717_10006081 3300006028 Bacteria 8857
82 Ga0070717_10069155 3300006028 Bacteria 2940
83 Ga0070717_10155248 3300006028 Bacteria 1982
84 Ga0070717_11186483 3300006028 Bacteria 695
85 Ga0070716_100001415 3300006173 Bacteria 10653
86 Ga0070716_100032735 3300006173 Bacteria 2838
87 Ga0070712_100005120 3300006175 Bacteria 8114
88 Ga0070712_100009787 3300006175 Bacteria 6039
89 Ga0070712_100016504 3300006175 Bacteria 4772
90 Ga0070712_100100711 3300006175 Bacteria 2135
91 Ga0070712_100145990 3300006175 Bacteria 1811
92 Ga0097621_100459111 3300006237 Bacteria 1148
93 Ga0068871_100386761 3300006358 Bacteria 1244
94 Ga0075429_100468970 3300006880 Bacteria 1103
95 Ga0068865_100185505 3300006881 Bacteria 1605
96 Ga0075436_100071339 3300006914 Bacteria 2401
97 Ga0097620_100028126 3300006931 Bacteria 5636
98 Ga0075435_100046743 3300007076 Bacteria 3473
99 Ga0105240_10691047 3300009093 Bacteria 1114
100 Ga0105240_10717623 3300009093 Bacteria 1090
101 Ga0105245_10027560 3300009098 Bacteria 5006
102 Ga0105245_10389392 3300009098 Bacteria 1390
103 Ga0105245_10519230 3300009098 Bacteria 1209
104 Ga0114129_10819690 3300009147 Bacteria 1185
105 Ga0105243_10086044 3300009148 Bacteria 2578
106 Ga0105243_10273599 3300009148 Bacteria 1518
107 Ga0105243_10581690 3300009148 Bacteria 1075
108 Ga0105242_10268771 3300009176 Bacteria 1544
109 Ga0105242_10818949 3300009176 Bacteria 923
110 Ga0105248_10376872 3300009177 Bacteria 1597
111 Ga0105248_11032966 3300009177 Bacteria 929
112 Ga0105238_10466254 3300009551 Bacteria 1261
113 Ga0105249_10077868 3300009553 Bacteria 3075
114 Ga0105239_10116229 3300010375 Bacteria 2968
115 Ga0157369_10047051 3300013105 Bacteria 4685
116 Ga0157369_10450366 3300013105 Bacteria 1333
117 Ga0157369_10498392 3300013105 Bacteria 1260
118 Ga0157374_10327260 3300013296 Bacteria 1520
119 Ga0157378_10728642 3300013297 Bacteria 1013
120 Ga0157372_10038525 3300013307 Bacteria 5275
121 Ga0157375_10359693 3300013308 Bacteria 1621
122 Ga0163163_10068617 3300014325 Bacteria 3528
123 Ga0157380_10040779 3300014326 Bacteria 3619
124 Ga0157377_10002661 3300014745 Bacteria 7928
125 Ga0157376_10133319 3300014969 Bacteria 2220
126 Ga0157376_11127841 3300014969 Bacteria 811
127 Ga0206356_11093735 3300020070 Bacteria 3503
128 Ga0206349_1859487 3300020075 Bacteria 1436
129 Ga0206355_1379035 3300020076 Bacteria 1269
130 Ga0206351_10172657 3300020077 Bacteria 2193
131 Ga0206351_10470278 3300020077 Bacteria 2151
132 Ga0206350_10470171 3300020080 Bacteria 2256
133 Ga0206353_10798595 3300020082 Bacteria 968
134 Ga0213874_10047354 3300021377 Bacteria 1307
135 Ga0213876_10034777 3300021384 Bacteria 2658
136 Ga0213876_10049905 3300021384 Bacteria 2211
137 Ga0213876_10065376 3300021384 Bacteria 1919
138 Ga0213875_10004629 3300021388 Bacteria 7502
139 Ga0213875_10011525 3300021388 Bacteria 4397
140 Ga0213875_10027008 3300021388 Bacteria 2731
141 Ga0224712_10003482 3300022467 Bacteria 4099
142 Ga0224712_10094034 3300022467 Bacteria 1261
143 Ga0207692_10001094 3300025898 Bacteria 9936
144 Ga0207692_10011366 3300025898 Bacteria 3785
145 Ga0207692_10079913 3300025898 Bacteria 1746
146 Ga0207688_10002357 3300025901 Bacteria 10159
147 Ga0207688_10370389 3300025901 Bacteria 885
148 Ga0207647_10072839 3300025904 Bacteria 2071
149 Ga0207699_10001830 3300025906 Bacteria 10004
150 Ga0207645_10037651 3300025907 Bacteria 3103
151 Ga0207705_10132980 3300025909 Bacteria 1852
152 Ga0207684_10006648 3300025910 Bacteria 10509
153 Ga0207707_10625446 3300025912 Bacteria 909
154 Ga0207693_10001078 3300025915 Bacteria 24478
155 Ga0207693_10074934 3300025915 Bacteria 2650
156 Ga0207693_10287923 3300025915 Bacteria 1287
157 Ga0207663_10025857 3300025916 Bacteria 3401
158 Ga0207663_10028066 3300025916 Bacteria 3289
159 Ga0207663_10054978 3300025916 Bacteria 2495
160 Ga0207660_10365174 3300025917 Bacteria 1158
161 Ga0207660_10518063 3300025917 Bacteria 968
162 Ga0207657_10057759 3300025919 Bacteria 3343
163 Ga0207657_10147669 3300025919 Bacteria 1917
164 Ga0207657_10430637 3300025919 Bacteria 1036
165 Ga0207649_10260349 3300025920 Bacteria 1253
166 Ga0207649_10490434 3300025920 Bacteria 933
167 Ga0207652_10000562 3300025921 Bacteria 37499
168 Ga0207652_10084539 3300025921 Bacteria 2780
169 Ga0207652_10340687 3300025921 Bacteria 1353
170 Ga0207646_10008232 3300025922 Bacteria 10472
171 Ga0207681_10605351 3300025923 Bacteria 906
172 Ga0207650_10036523 3300025925 Bacteria 3575
173 Ga0207687_10063820 3300025927 Bacteria 2609
174 Ga0207687_10664363 3300025927 Bacteria 882
175 Ga0207700_10005055 3300025928 Bacteria 7845
176 Ga0207700_10048232 3300025928 Bacteria 3161
177 Ga0207700_10142732 3300025928 Bacteria 1970
178 Ga0207700_10145942 3300025928 Bacteria 1950
179 Ga0207700_10284504 3300025928 Bacteria 1423
180 Ga0207700_10440549 3300025928 Bacteria 1147
181 Ga0207700_10845220 3300025928 Bacteria 819
182 Ga0207664_10000427 3300025929 Bacteria 30029
183 Ga0207664_10004793 3300025929 Bacteria 9194
184 Ga0207664_10040503 3300025929 Bacteria 3624
185 Ga0207664_10309596 3300025929 Bacteria 1391
186 Ga0207690_10046315 3300025932 Bacteria 2879
187 Ga0207690_10375119 3300025932 Bacteria 1129
188 Ga0207709_10104640 3300025935 Bacteria 1879
189 Ga0207704_10375778 3300025938 Bacteria 1114
190 Ga0207665_10002491 3300025939 Bacteria 12398
191 Ga0207665_10048440 3300025939 Bacteria 2852
192 Ga0207689_10358067 3300025942 Bacteria 1213
193 Ga0207661_10028357 3300025944 Bacteria 4287
194 Ga0207661_10222693 3300025944 Bacteria 1668
195 Ga0207661_10226630 3300025944 Bacteria 1653
196 Ga0207679_10683455 3300025945 Bacteria 930
197 Ga0207679_10862511 3300025945 Bacteria 827
198 Ga0207667_10000005 3300025949 Bacteria 715503
199 Ga0207667_10359621 3300025949 Bacteria 1484
200 Ga0207651_10237449 3300025960 Bacteria 1484
201 Ga0207712_10105385 3300025961 Bacteria 2104
202 Ga0207668_10129308 3300025972 Bacteria 1926
203 Ga0207668_10403876 3300025972 Bacteria 1156
204 Ga0207658_10305269 3300025986 Bacteria 1373
205 Ga0207678_10084288 3300026067 Bacteria 2718
206 Ga0207678_10116955 3300026067 Bacteria 2275
207 Ga0207678_10145698 3300026067 Bacteria 2021
208 Ga0207708_10023235 3300026075 Bacteria 4684
209 Ga0207702_10074437 3300026078 Bacteria 2931
210 Ga0207676_10318660 3300026095 Bacteria 1426
211 Ga0207676_10589395 3300026095 Bacteria 1067
212 Ga0207674_10069615 3300026116 Bacteria 3539
213 Ga0207675_100696371 3300026118 Bacteria 1025
214 Ga0207683_10049885 3300026121 Bacteria 3664
215 Ga0207698_10419461 3300026142 Bacteria 1284
216 Ga0207698_10632278 3300026142 Bacteria 1058
217 Ga0207698_10667916 3300026142 Bacteria 1031
218 Ga0268266_10567602 3300028379 Bacteria 1088
219 Ga0268264_10817855 3300028381 Bacteria 931
220 Ga0265337_1000139 3300028556 Bacteria 36279
221 Ga0265326_10001897 3300028558 Bacteria 7162
222 Ga0265319_1001580 3300028563 Bacteria 13351
223 Ga0265334_10000881 3300028573 Bacteria 15032
224 Ga0265318_10008159 3300028577 Bacteria 4680
225 Ga0265323_10017689 3300028653 Bacteria 2766
226 Ga0265336_10001858 3300028666 Bacteria 9147
227 Ga0265338_10001072 3300028800 Bacteria 45406
228 Ga0265338_10003430 3300028800 Bacteria 22337
229 Ga0265338_10037959 3300028800 Bacteria 4573
230 Ga0265324_10002085 3300029957 Bacteria 10579
231 Ga0265332_10002999 3300031238 Bacteria 8280
232 Ga0265320_10008860 3300031240 Bacteria 6118
233 Ga0265325_10011746 3300031241 Bacteria 5023
234 Ga0265340_10002439 3300031247 Bacteria 10580
235 Ga0265339_10035661 3300031249 Bacteria 2789
236 Ga0265313_10013877 3300031595 Bacteria 4800
237 Ga0307508_10301822 3300031616 Bacteria 1194
238 Ga0265314_10009482 3300031711 Bacteria 8210
239 Ga0265342_10001481 3300031712 Bacteria 21785
240 Ga0307405_10090003 3300031731 Bacteria 2029
241 Ga0307413_10044779 3300031824 Bacteria 2618
242 Ga0307410_10227530 3300031852 Bacteria 1438
243 Ga0307406_10299264 3300031901 Bacteria 1235
244 Ga0307407_10053457 3300031903 Bacteria 2324
245 Ga0307407_10911368 3300031903 Bacteria 675
246 Ga0307409_100075440 3300031995 Bacteria 2700
247 Ga0307409_100097077 3300031995 Bacteria 2433
248 Ga0307409_100362296 3300031995 Bacteria 1372
249 Ga0307409_101036694 3300031995 Bacteria 839
250 Ga0307416_100066032 3300032002 Bacteria 2977
251 Ga0307416_100075134 3300032002 Bacteria 2827
252 Ga0307416_100286146 3300032002 Bacteria 1629
253 Ga0307416_100654539 3300032002 Bacteria 1136
254 Ga0307416_100980272 3300032002 Bacteria 948
255 Ga0307415_100000531 3300032126 Bacteria 16623
256 Ga0307415_100044434 3300032126 Bacteria 2970
257 Ga0307415_100191078 3300032126 Bacteria 1616
258 Ga0307415_100515290 3300032126 Bacteria 1048
259 Ga0373924_0176123 3300035410 Bacteria 941
260 Ga0373937_0071288 3300036401 Bacteria 3205
261 Ga0395899_0036791 3300037312 Bacteria 3670
262 Ga0395900_0403038 3300037418 Bacteria 1331
263 Ga0395900_0819289 3300037418 Bacteria 858
264 Ga0395898_0032615 3300037466 Bacteria 5200
265 Ga0395898_0103493 3300037466 Bacteria 2732
266 Ga0395898_0308520 3300037466 Bacteria 1509
267 Ga0395898_0695088 3300037466 Bacteria 959
268 Ga0395905_0083848 3300037471 Bacteria 2986
269 Ga0395905_0250912 3300037471 Bacteria 1653
270 Ga0436364_0046194 3300037853 Bacteria 794
271 Ga0436364_0094210 3300037853 Bacteria 1234
272 Ga0436364_0282082 3300037853 Bacteria 13841
273 Ga0436364_1186598 3300037853 Bacteria 27732
274 Ga0436364_1260739 3300037853 Bacteria 17238
275 Ga0395901_0063504 3300038443 Bacteria 3843
276 Ga0395901_0157702 3300038443 Bacteria 2383
277 Ga0395901_0672186 3300038443 Bacteria 1036
278 Ga0395901_0890624 3300038443 Bacteria 872
279 Ga0436365_0813952 3300039437 Bacteria 18562
280 Ga0436365_0977136 3300039437 Bacteria 4932
281 Ga0436365_1286106 3300039437 Bacteria 2796
282 Ga0436365_1583762 3300039437 Bacteria 917
283 Ga0436363_0060364 3300039450 Bacteria 5734
284 Ga0436363_0099119 3300039450 Bacteria 5537
285 Ga0436363_1102066 3300039450 Bacteria 1615
286 Ga0436362_0187069 3300039453 Bacteria 3044
287 Ga0436362_0434119 3300039453 Bacteria 1491
288 Ga0436362_0836372 3300039453 Bacteria 1342
289 Ga0436362_1082072 3300039453 Bacteria 972
290 Ga0451577_0374329 3300042876 Bacteria 1292
291 Ga0466961_0038313 3300044693 Bacteria 3075
292 Ga0466963_0006578 3300044694 Bacteria 6889
293 Ga0466963_0038940 3300044694 Bacteria 3111
294 Ga0466963_0303386 3300044694 Bacteria 1123
295 Ga0466971_0353522 3300044719 Bacteria 711
296 Ga0466968_0024929 3300044735 Bacteria 2446
297 Ga0466970_0200535 3300044765 Bacteria 1110
298 Ga0466957_0239738 3300044842 Bacteria 1203
299 Ga0466960_0000013 3300044901 Bacteria 58320
300 Ga0466960_0086969 3300044901 Bacteria 1586
301 Ga0466959_0170523 3300045049 Bacteria 1526
302 Ga0451576_0289694 3300045051 Bacteria 1712
303 Ga0451576_0639378 3300045051 Bacteria 1118
304 Ga0466958_0010142 3300045836 Bacteria 5266
305 Ga0466967_0003426 3300045976 Bacteria 10349
306 Ga0466967_0042007 3300045976 Bacteria 3948
307 Ga0495592_0059103 3300046454 Bacteria 2825
308 Ga0495651_0014392 3300046462 Bacteria 6117
309 Ga0495594_0010022 3300046499 Bacteria 4908
310 Ga0495608_0200222 3300046511 Bacteria 1258
311 Ga0495628_0440199 3300046516 Bacteria 948
312 Ga0495652_0049171 3300046529 Bacteria 3611
313 Ga0495667_0016825 3300046559 Bacteria 4937
314 Ga0495656_0283760 3300046615 Bacteria 845
315 Ga0495657_0036267 3300046675 Bacteria 3409
316 Ga0495599_0155717 3300046678 Bacteria 1414
317 Ga0495604_0035284 3300047317 Bacteria 3950
318 Ga0495680_0003021 3300047322 Bacteria 16778
319 Ga0495675_0040784 3300047444 Bacteria 2959
320 Ga0495602_0006740 3300048088 Bacteria 12055
321 Ga0496104_0110197 3300048907 Bacteria 2639
322 Ga0496104_0751319 3300048907 Bacteria 882
323 Ga0496104_0900213 3300048907 Bacteria 790
324 Ga0496105_0079261 3300048908 Bacteria 2712
325 Ga0496105_0144872 3300048908 Bacteria 1954
326 Ga0496106_0021473 3300048909 Bacteria 4793
327 Ga0496106_0230509 3300048909 Bacteria 1479
328 Ga0496107_0160231 3300048910 Bacteria 1667
329 Ga0496108_0094657 3300048911 Bacteria 2542
330 Ga0496108_0144152 3300048911 Bacteria 2052
331 Ga0496108_0151930 3300048911 Bacteria 1998
332 Ga0496108_0197588 3300048911 Bacteria 1745
333 Ga0496108_0669785 3300048911 Bacteria 901
334 Ga0496108_1068425 3300048911 Bacteria 687
335 Ga0496109_0247266 3300048912 Bacteria 1679
336 Ga0496110_0229552 3300048913 Bacteria 1688
337 Ga0496110_0389317 3300048913 Bacteria 1270
338 Ga0496111_0359027 3300048914 Bacteria 1078
339 Ga0496112_0025325 3300048915 Bacteria 5697
340 Ga0496112_0036533 3300048915 Bacteria 4792
341 Ga0496112_0045022 3300048915 Bacteria 4325
342 Ga0496112_0059771 3300048915 Bacteria 3756
343 Ga0496112_0461709 3300048915 Bacteria 1207
344 Ga0496113_0010296 3300048916 Bacteria 6180
345 Ga0496113_0023202 3300048916 Bacteria 4399
346 Ga0496113_0065321 3300048916 Bacteria 2754
347 Ga0496113_0138479 3300048916 Bacteria 1914
348 Ga0496113_0204352 3300048916 Bacteria 1571
349 Ga0496114_0164478 3300048917 Bacteria 1931
350 Ga0496115_0238234 3300048918 Bacteria 1500
351 Ga0496119_0082210 3300048922 Bacteria 1853
352 Ga0496120_0297271 3300048923 Bacteria 741
353 Ga0496126_0062067 3300048929 Bacteria 3354
354 Ga0496126_0073655 3300048929 Bacteria 3035
355 Ga0501031_0253633 3300049568 Bacteria 1143
356 Ga0501034_0010198 3300049571 Bacteria 9800
357 Ga0501039_0038546 3300049575 Bacteria 3690
358 Ga0501040_0081406 3300049576 Bacteria 2244
359 Ga0501048_0342484 3300049582 Bacteria 1066
360 Ga0501067_0275517 3300049583 Bacteria 937
361 Ga0501069_0183786 3300049585 Bacteria 1209
362 Ga0501071_0189246 3300049587 Bacteria 1543
363 Ga0501075_0011030 3300049591 Bacteria 6378
364 nmdc:mga05p37_448993_c1 3300050507 Bacteria 1493
365 nmdc:mga0qj67_461622_c1 3300050509 Bacteria 1022
366 nmdc:mga06r32_935912_c1 3300050510 Bacteria 822
367 nmdc:mga0rr50_239870_c1 3300050513 Bacteria 1502
368 nmdc:mga08x19_589544_c1 3300050514 Bacteria 787
369 nmdc:mga08x19_81034_c1 3300050514 Bacteria 2131
370 Ga0495595_0140328 3300053084 Bacteria 1185
371 Ga0500583_0024832 3300053092 Bacteria 2549
372 Ga0500641_0020764 3300053096 Bacteria 2495
373 Ga0500588_0010089 3300053146 Bacteria 2269
374 Ga0501084_0057706 3300054114 Bacteria 3248
375 Ga0587073_0023506 3300059492 Bacteria 1207
376 Ga0587082_029365 3300059504 Bacteria 949
377 Ga0587085_011501 3300059506 Bacteria 1196
378 Ga0587091_026227 3300059511 Bacteria 1060
379 Ga0587099_018391 3300059622 Bacteria 770
380 Ga0587067_003365 3300059640 Bacteria 1993
381 Ga0587069_001772 3300059642 Bacteria 2060
382 Ga0587076_027010 3300059645 Bacteria 991
383 Ga0466962_0004078 3300061719 Bacteria 6995
384 2547411978 2547132111 Bacteria 8013147
385 2744957208 2744054611 Bacteria 5611514
386 2899376782 2899370129 Bacteria 6781179
387 Ga0070675_100047788
388 Ga0070676_10227595
389 Ga0070683_100012706
390 Ga0070683_100260940
391 Ga0070683_100280284
392 Ga0070677_10383465
393 Ga0070680_100083633
394 Ga0070680_100174854
395 Ga0070680_100401194
396 Ga0070682_100071574
397 Ga0070682_100267205
398 Ga0070682_100678030
399 Ga0068868_100022858
400 Ga0068868_100245733
401 Ga0070689_100074143
402 Ga0070691_10013685
403 Ga0070691_10281282
404 Ga0070661_100304386
405 Ga0070668_100065331
406 Ga0070668_100371019
407 Ga0070669_100433185
408 Ga0070675_100175553
409 Ga0070671_100475730
410 Ga0070673_100166052
411 Ga0070659_100111685
412 Ga0070659_100268512
413 Ga0070709_10001361
414 Ga0070714_100000545
415 Ga0070714_100004996
416 Ga0070714_100016154
417 Ga0070714_100051724
418 Ga0070714_100202704
419 Ga0070714_100611583
420 Ga0070714_100721221
421 Ga0070713_100000483
422 Ga0070713_100023820
423 Ga0070713_100146973
424 Ga0070713_100262907
425 Ga0070713_100491416
426 Ga0070710_10000539
427 Ga0070710_10032631
428 Ga0070711_100029518
429 Ga0070700_100004519
430 Ga0070663_100059847
431 Ga0070678_100104014
432 Ga0070681_10034417
433 Ga0070681_10689147
434 Ga0070681_11187284
435 Ga0070685_10023400
436 Ga0070706_100096118
437 Ga0070707_100024458
438 Ga0070698_100033337
439 Ga0070679_100001023
440 Ga0070679_100131691
441 Ga0070679_100188263
442 Ga0070684_100021431
443 Ga0070684_100625467
444 Ga0070684_100882506
445 Ga0070697_100083457
446 Ga0070686_100498301
447 Ga0070693_100578196
448 Ga0070665_100167926
449 Ga0068855_100000002
450 Ga0068855_100443693
451 Ga0070664_100193927
452 Ga0068857_100092980
453 Ga0068857_100325277
454 Ga0068856_100050989
455 Ga0068856_100480991
456 Ga0068852_100458142
457 Ga0068859_100028126
458 Ga0068864_100046225
459 Ga0068864_100914425
460 Ga0068851_10182777
461 Ga0068863_100084199
462 Ga0068862_100018134
463 Ga0081455_10026174
464 Ga0081455_10041852
465 Ga0070717_10002239
466 Ga0070717_10002725
467 Ga0070717_10006081
468 Ga0070717_10069155
469 Ga0070717_10155248
470 Ga0070717_11186483
471 Ga0070716_100001415
472 Ga0070716_100032735
473 Ga0070712_100005120
474 Ga0070712_100009787
475 Ga0070712_100016504
476 Ga0070712_100100711
477 Ga0070712_100145990
478 Ga0097621_100459111
479 Ga0068871_100386761
480 Ga0075429_100468970
481 Ga0068865_100185505
482 Ga0075436_100071339
483 Ga0097620_100028126
484 Ga0075435_100046743
485 Ga0105240_10691047
486 Ga0105240_10717623
487 Ga0105245_10027560
488 Ga0105245_10389392
489 Ga0105245_10519230
490 Ga0114129_10819690
491 Ga0105243_10086044
492 Ga0105243_10273599
493 Ga0105243_10581690
494 Ga0105242_10268771
495 Ga0105242_10818949
496 Ga0105248_10376872
497 Ga0105248_11032966
498 Ga0105238_10466254
499 Ga0105249_10077868
500 Ga0105239_10116229
501 Ga0157369_10047051
502 Ga0157369_10450366
503 Ga0157369_10498392
504 Ga0157374_10327260
505 Ga0157378_10728642
506 Ga0157372_10038525
507 Ga0157375_10359693
508 Ga0163163_10068617
509 Ga0157380_10040779
510 Ga0157377_10002661
511 Ga0157376_10133319
512 Ga0157376_11127841
513 Ga0206356_11093735
514 Ga0206349_1859487
515 Ga0206355_1379035
516 Ga0206351_10172657
517 Ga0206351_10470278
518 Ga0206350_10470171
519 Ga0206353_10798595
520 Ga0213874_10047354
521 Ga0213876_10034777
522 Ga0213876_10049905
523 Ga0213876_10065376
524 Ga0213875_10004629
525 Ga0213875_10011525
526 Ga0213875_10027008
527 Ga0224712_10003482
528 Ga0224712_10094034
529 Ga0207692_10001094
530 Ga0207692_10011366
531 Ga0207692_10079913
532 Ga0207688_10002357
533 Ga0207688_10370389
534 Ga0207647_10072839
535 Ga0207699_10001830
536 Ga0207645_10037651
537 Ga0207705_10132980
538 Ga0207684_10006648
539 Ga0207707_10625446
540 Ga0207693_10001078
541 Ga0207693_10074934
542 Ga0207693_10287923
543 Ga0207663_10025857
544 Ga0207663_10028066
545 Ga0207663_10054978
546 Ga0207660_10365174
547 Ga0207660_10518063
548 Ga0207657_10057759
549 Ga0207657_10147669
550 Ga0207657_10430637
551 Ga0207649_10260349
552 Ga0207649_10490434
553 Ga0207652_10000562
554 Ga0207652_10084539
555 Ga0207652_10340687
556 Ga0207646_10008232
557 Ga0207681_10605351
558 Ga0207650_10036523
559 Ga0207687_10063820
560 Ga0207687_10664363
561 Ga0207700_10005055
562 Ga0207700_10048232
563 Ga0207700_10142732
564 Ga0207700_10145942
565 Ga0207700_10284504
566 Ga0207700_10440549
567 Ga0207700_10845220
568 Ga0207664_10000427
569 Ga0207664_10004793
570 Ga0207664_10040503
571 Ga0207664_10309596
572 Ga0207690_10046315
573 Ga0207690_10375119
574 Ga0207709_10104640
575 Ga0207704_10375778
576 Ga0207665_10002491
577 Ga0207665_10048440
578 Ga0207689_10358067
579 Ga0207661_10028357
580 Ga0207661_10222693
581 Ga0207661_10226630
582 Ga0207679_10683455
583 Ga0207679_10862511
584 Ga0207667_10000005
585 Ga0207667_10359621
586 Ga0207651_10237449
587 Ga0207712_10105385
588 Ga0207668_10129308
589 Ga0207668_10403876
590 Ga0207658_10305269
591 Ga0207678_10084288
592 Ga0207678_10116955
593 Ga0207678_10145698
594 Ga0207708_10023235
595 Ga0207702_10074437
596 Ga0207676_10318660
597 Ga0207676_10589395
598 Ga0207674_10069615
599 Ga0207675_100696371
600 Ga0207683_10049885
601 Ga0207698_10419461
602 Ga0207698_10632278
603 Ga0207698_10667916
604 Ga0268266_10567602
605 Ga0268264_10817855
606 Ga0265337_1000139
607 Ga0265326_10001897
608 Ga0265319_1001580
609 Ga0265334_10000881
610 Ga0265318_10008159
611 Ga0265323_10017689
612 Ga0265336_10001858
613 Ga0265338_10001072
614 Ga0265338_10003430
615 Ga0265338_10037959
616 Ga0265324_10002085
617 Ga0265332_10002999
618 Ga0265320_10008860
619 Ga0265325_10011746
620 Ga0265340_10002439
621 Ga0265339_10035661
622 Ga0265313_10013877
623 Ga0307508_10301822
624 Ga0265314_10009482
625 Ga0265342_10001481
626 Ga0307405_10090003
627 Ga0307413_10044779
628 Ga0307410_10227530
629 Ga0307406_10299264
630 Ga0307407_10053457
631 Ga0307407_10911368
632 Ga0307409_100075440
633 Ga0307409_100097077
634 Ga0307409_100362296
635 Ga0307409_101036694
636 Ga0307416_100066032
637 Ga0307416_100075134
638 Ga0307416_100286146
639 Ga0307416_100654539
640 Ga0307416_100980272
641 Ga0307415_100000531
642 Ga0307415_100044434
643 Ga0307415_100191078
644 Ga0307415_100515290
645 Ga0373924_0176123
646 Ga0373937_0071288
647 Ga0395899_0036791
648 Ga0395900_0403038
649 Ga0395900_0819289
650 Ga0395898_0032615
651 Ga0395898_0103493
652 Ga0395898_0308520
653 Ga0395898_0695088
654 Ga0395905_0083848
655 Ga0395905_0250912
656 Ga0436364_0046194
657 Ga0436364_0094210
658 Ga0436364_0282082
659 Ga0436364_1186598
660 Ga0436364_1260739
661 Ga0395901_0063504
662 Ga0395901_0157702
663 Ga0395901_0672186
664 Ga0395901_0890624
665 Ga0436365_0813952
666 Ga0436365_0977136
667 Ga0436365_1286106
668 Ga0436365_1583762
669 Ga0436363_0060364
670 Ga0436363_0099119
671 Ga0436363_1102066
672 Ga0436362_0187069
673 Ga0436362_0434119
674 Ga0436362_0836372
675 Ga0436362_1082072
676 Ga0451577_0374329
677 Ga0466961_0038313
678 Ga0466963_0006578
679 Ga0466963_0038940
680 Ga0466963_0303386
681 Ga0466971_0353522
682 Ga0466968_0024929
683 Ga0466970_0200535
684 Ga0466957_0239738
685 Ga0466960_0000013
686 Ga0466960_0086969
687 Ga0466959_0170523
688 Ga0451576_0289694
689 Ga0451576_0639378
690 Ga0466958_0010142
691 Ga0466967_0003426
692 Ga0466967_0042007
693 Ga0495592_0059103
694 Ga0495651_0014392
695 Ga0495594_0010022
696 Ga0495608_0200222
697 Ga0495628_0440199
698 Ga0495652_0049171
699 Ga0495667_0016825
700 Ga0495656_0283760
701 Ga0495657_0036267
702 Ga0495599_0155717
703 Ga0495604_0035284
704 Ga0495680_0003021
705 Ga0495675_0040784
706 Ga0495602_0006740
707 Ga0496104_0110197
708 Ga0496104_0751319
709 Ga0496104_0900213
710 Ga0496105_0079261
711 Ga0496105_0144872
712 Ga0496106_0021473
713 Ga0496106_0230509
714 Ga0496107_0160231
715 Ga0496108_0094657
716 Ga0496108_0144152
717 Ga0496108_0151930
718 Ga0496108_0197588
719 Ga0496108_0669785
720 Ga0496108_1068425
721 Ga0496109_0247266
722 Ga0496110_0229552
723 Ga0496110_0389317
724 Ga0496111_0359027
725 Ga0496112_0025325
726 Ga0496112_0036533
727 Ga0496112_0045022
728 Ga0496112_0059771
729 Ga0496112_0461709
730 Ga0496113_0010296
731 Ga0496113_0023202
732 Ga0496113_0065321
733 Ga0496113_0138479
734 Ga0496113_0204352
735 Ga0496114_0164478
736 Ga0496115_0238234
737 Ga0496119_0082210
738 Ga0496120_0297271
739 Ga0496126_0062067
740 Ga0496126_0073655
741 Ga0501031_0253633
742 Ga0501034_0010198
743 Ga0501039_0038546
744 Ga0501040_0081406
745 Ga0501048_0342484
746 Ga0501067_0275517
747 Ga0501069_0183786
748 Ga0501071_0189246
749 Ga0501075_0011030
750 nmdc:mga05p37_448993_c1
751 nmdc:mga0qj67_461622_c1
752 nmdc:mga06r32_935912_c1
753 nmdc:mga0rr50_239870_c1
754 nmdc:mga08x19_589544_c1
755 nmdc:mga08x19_81034_c1
756 Ga0495595_0140328
757 Ga0500583_0024832
758 Ga0500641_0020764
759 Ga0500588_0010089
760 Ga0501084_0057706
761 Ga0587073_0023506
762 Ga0587082_029365
763 Ga0587085_011501
764 Ga0587091_026227
765 Ga0587099_018391
766 Ga0587067_003365
767 Ga0587069_001772
768 Ga0587076_027010
769 Ga0466962_0004078
770 2547411978
771 2744957208
772 2899376782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

62

209

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.9286 46 192
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9281 46 192
2ca3-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella r55m mutant 0.9215 39 182
2xts-assembly1.cif.gz_C crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.9149 38 178
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.9079 39 182
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9293 41 192 3.90.420.10
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9216 38 178 3.90.420.10
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9132 39 182 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9041 37 182 3.90.420.10
2biiB01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9003 36 182 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A7Y6A7Q0-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9795 20 193
AF-A0A7Y5G5U4-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9791 19 199
AF-A0A6B3HZ29-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9767 48 191
AF-A0A3L7QPB5-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9766 19 199
AF-A0A800GB14-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9749 19 199

Map