F430334

General Info

Members Datasets Scaffolds Average Seq Length
385 220 770 200

Family's Representative Sequence

Representative Sequence 3300053088|Ga0500644_0123292|Ga0500644_0123292_26_736
Length 236
Sequence MADRNAIRRTVADVSVNGAGHAGRPLGRSLGQTVRVDRSFELREVGRHAVLAEVADSAAAGSLASYARAARVSADEVVPGARTVLFDGVPDTEALAGLLSGWTAEAAPDPGELVELEVTYDGADLGDIAARWGTDVDGVVARHGAVEFVAAFCGFAPGFAYLAGLPEDHAVPRLDTPRPRVPAGAVGLAGSWCGVYPSASPGGWRLLGRTDASLWDPSRSQPALLAPGTRVRFVPG

Samples

Sample ID Description Type Environment
1 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
98 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
99 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
100 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
101 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
102 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
103 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
110 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
111 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
209 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
214 2501939600 Micromonospora sp. L5 Isolate Unclassified
215 2643221615 Nocardioides sp. Root224 Isolate Unclassified
216 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
217 2855683550 Micromonospora sp. RP3T Isolate Unclassified
218 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
219 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
220 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.92
Metatranscriptomes 0.26
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.69
Nodule 0
Rhizoplane 12.73
Rhizosphere 72.21
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500644_0123292 3300053088 Bacteria 1012
2 JGI25406J46586_10052560 3300003203 Bacteria 1357
3 rootL2_10069030 3300003322 Bacteria 1643
4 Ga0070658_10031994 3300005327 Bacteria 4229
5 Ga0070683_100005046 3300005329 Bacteria 10960
6 Ga0070683_100173523 3300005329 Bacteria 2047
7 Ga0068869_100095700 3300005334 Bacteria 2241
8 Ga0068868_100235846 3300005338 Bacteria 1536
9 Ga0068868_101201584 3300005338 Bacteria 701
10 Ga0070692_10164196 3300005345 Bacteria 1275
11 Ga0070668_100259390 3300005347 Bacteria 1445
12 Ga0070675_100595738 3300005354 Bacteria 1002
13 Ga0070671_100206022 3300005355 Bacteria 1668
14 Ga0070674_100453246 3300005356 Bacteria 1059
15 Ga0070674_100971380 3300005356 Bacteria 744
16 Ga0070659_100029351 3300005366 Bacteria 4250
17 Ga0070659_100302374 3300005366 Bacteria 1334
18 Ga0070711_100095929 3300005439 Bacteria 2147
19 Ga0070684_100002405 3300005535 Bacteria 13795
20 Ga0070665_100000723 3300005548 Bacteria 43936
21 Ga0070665_101083795 3300005548 Bacteria 813
22 Ga0070664_100649272 3300005564 Bacteria 981
23 Ga0068857_100007347 3300005577 Bacteria 9486
24 Ga0068856_100032344 3300005614 Bacteria 5120
25 Ga0070702_100074111 3300005615 Bacteria 2019
26 Ga0068859_100137685 3300005617 Bacteria 2515
27 Ga0068864_100055872 3300005618 Bacteria 3410
28 Ga0068861_100091331 3300005719 Bacteria 2404
29 Ga0068861_100181546 3300005719 Bacteria 1752
30 Ga0068870_10544627 3300005840 Bacteria 780
31 Ga0068863_100128734 3300005841 Bacteria 2416
32 Ga0068863_100663611 3300005841 Bacteria 1035
33 Ga0068858_100078297 3300005842 Bacteria 3072
34 Ga0068858_100087248 3300005842 Bacteria 2902
35 Ga0068860_100001739 3300005843 Bacteria 23220
36 Ga0068860_100404011 3300005843 Bacteria 1352
37 Ga0068862_100511628 3300005844 Bacteria 1141
38 Ga0068862_100736207 3300005844 Bacteria 958
39 Ga0081539_10000143 3300005985 Bacteria 165345
40 Ga0081539_10004929 3300005985 Bacteria 14215
41 Ga0075365_10014641 3300006038 Bacteria 4724
42 Ga0075365_10014832 3300006038 Bacteria 4696
43 Ga0075365_10037403 3300006038 Bacteria 3151
44 Ga0075365_10047563 3300006038 Bacteria 2820
45 Ga0075365_10077739 3300006038 Bacteria 2242
46 Ga0075365_10178077 3300006038 Bacteria 1486
47 Ga0075365_10324811 3300006038 Bacteria 1084
48 Ga0075365_10345827 3300006038 Bacteria 1048
49 Ga0075365_10347508 3300006038 Bacteria 1045
50 Ga0075368_10085533 3300006042 Bacteria 1286
51 Ga0075363_100127303 3300006048 Bacteria 1427
52 Ga0075363_100277043 3300006048 Bacteria 970
53 Ga0075364_10039785 3300006051 Bacteria 3048
54 Ga0075364_10044448 3300006051 Bacteria 2889
55 Ga0075364_10073776 3300006051 Bacteria 2249
56 Ga0075364_10242696 3300006051 Bacteria 1224
57 Ga0070712_100139136 3300006175 Bacteria 1850
58 Ga0075367_10014872 3300006178 Bacteria 4216
59 Ga0075367_10163211 3300006178 Bacteria 1386
60 Ga0075367_10344852 3300006178 Bacteria 940
61 Ga0075370_10136314 3300006353 Bacteria 1434
62 Ga0075370_10187596 3300006353 Bacteria 1218
63 Ga0075428_100000233 3300006844 Bacteria 54028
64 Ga0075431_100005203 3300006847 Bacteria 12814
65 Ga0075431_100295125 3300006847 Bacteria 1639
66 Ga0068865_100049321 3300006881 Bacteria 2902
67 Ga0097620_100137691 3300006931 Bacteria 2515
68 Ga0105245_10013870 3300009098 Bacteria 7021
69 Ga0105245_10830059 3300009098 Bacteria 963
70 Ga0105245_11150124 3300009098 Bacteria 823
71 Ga0105243_10139666 3300009148 Bacteria 2065
72 Ga0105243_10557442 3300009148 Bacteria 1096
73 Ga0105242_10236166 3300009176 Bacteria 1641
74 Ga0105249_10360614 3300009553 Bacteria 1475
75 Ga0105249_10535924 3300009553 Bacteria 1220
76 Ga0105249_10721709 3300009553 Bacteria 1058
77 Ga0105249_10936573 3300009553 Bacteria 934
78 Ga0105239_10020784 3300010375 Bacteria 7244
79 Ga0105246_10003412 3300011119 Bacteria 9628
80 Ga0157371_10111855 3300013102 Bacteria 1938
81 Ga0157369_10069621 3300013105 Bacteria 3780
82 Ga0157374_11269720 3300013296 Bacteria 758
83 Ga0157378_11224508 3300013297 Bacteria 790
84 Ga0163162_10029940 3300013306 Bacteria 5390
85 Ga0163162_11826331 3300013306 Bacteria 695
86 Ga0157372_10009657 3300013307 Bacteria 10255
87 Ga0157372_10375705 3300013307 Bacteria 1656
88 Ga0157375_10037289 3300013308 Bacteria 4657
89 Ga0157375_10150052 3300013308 Bacteria 2466
90 Ga0157375_10220964 3300013308 Bacteria 2053
91 Ga0157375_10573894 3300013308 Bacteria 1288
92 Ga0163163_10011519 3300014325 Bacteria 8029
93 Ga0163163_10021538 3300014325 Bacteria 6086
94 Ga0157380_10893641 3300014326 Bacteria 914
95 Ga0157379_10023165 3300014968 Bacteria 5507
96 Ga0206353_11623017 3300020082 Bacteria 1800
97 Ga0207688_10106192 3300025901 Bacteria 1626
98 Ga0207705_10030708 3300025909 Bacteria 3834
99 Ga0207693_10297093 3300025915 Bacteria 1265
100 Ga0207663_10560618 3300025916 Bacteria 894
101 Ga0207687_10801177 3300025927 Bacteria 803
102 Ga0207709_10100386 3300025935 Bacteria 1912
103 Ga0207669_10241761 3300025937 Bacteria 1339
104 Ga0207704_10066838 3300025938 Bacteria 2259
105 Ga0207689_10250226 3300025942 Bacteria 1465
106 Ga0207661_10118129 3300025944 Bacteria 2254
107 Ga0207661_10336255 3300025944 Bacteria 1360
108 Ga0207679_10050122 3300025945 Bacteria 3049
109 Ga0207712_10229667 3300025961 Bacteria 1489
110 Ga0207712_11041140 3300025961 Bacteria 727
111 Ga0207668_10112510 3300025972 Bacteria 2045
112 Ga0207658_10084759 3300025986 Bacteria 2439
113 Ga0207677_10827370 3300026023 Bacteria 830
114 Ga0207703_10053721 3300026035 Bacteria 3274
115 Ga0207703_10417095 3300026035 Bacteria 1248
116 Ga0207639_10991532 3300026041 Bacteria 787
117 Ga0207702_10153755 3300026078 Bacteria 2095
118 Ga0207641_10155864 3300026088 Bacteria 2072
119 Ga0207648_11496724 3300026089 Bacteria 634
120 Ga0207674_10009782 3300026116 Bacteria 10921
121 Ga0207675_100224073 3300026118 Bacteria 1812
122 Ga0207698_10201451 3300026142 Bacteria 1783
123 Ga0268266_10347780 3300028379 Bacteria 1393
124 Ga0268264_10000398 3300028381 Bacteria 62200
125 Ga0307513_10008299 3300031456 Bacteria 13309
126 Ga0307513_10102374 3300031456 Bacteria 2883
127 Ga0307509_10005707 3300031507 Bacteria 17162
128 Ga0307508_10022052 3300031616 Bacteria 5793
129 Ga0307405_10131331 3300031731 Bacteria 1731
130 Ga0307405_10319481 3300031731 Bacteria 1185
131 Ga0307413_10058894 3300031824 Bacteria 2357
132 Ga0307410_10453700 3300031852 Bacteria 1046
133 Ga0326468_10001098 3300031889 Bacteria 2506
134 Ga0307406_10028621 3300031901 Bacteria 3368
135 Ga0307406_10297591 3300031901 Bacteria 1238
136 Ga0307407_10114776 3300031903 Bacteria 1697
137 Ga0307407_10121476 3300031903 Bacteria 1657
138 Ga0307412_10005112 3300031911 Bacteria 7342
139 Ga0307412_10155960 3300031911 Bacteria 1690
140 Ga0307412_10215601 3300031911 Bacteria 1468
141 Ga0307409_100027732 3300031995 Bacteria 4020
142 Ga0307409_100145962 3300031995 Bacteria 2046
143 Ga0307409_100151438 3300031995 Bacteria 2014
144 Ga0307409_100493786 3300031995 Bacteria 1190
145 Ga0307409_101212577 3300031995 Bacteria 778
146 Ga0307416_100003635 3300032002 Bacteria 9110
147 Ga0307416_100007209 3300032002 Bacteria 7042
148 Ga0307416_100603061 3300032002 Bacteria 1178
149 Ga0307414_10861587 3300032004 Bacteria 829
150 Ga0307415_100028313 3300032126 Bacteria 3563
151 Ga0307415_100064115 3300032126 Bacteria 2556
152 Ga0307415_100398077 3300032126 Bacteria 1175
153 Ga0307415_100593663 3300032126 Bacteria 984
154 Ga0373948_0007982 3300034817 Bacteria 1793
155 Ga0373950_0009700 3300034818 Bacteria 1542
156 Ga0373938_0061876 3300034957 Bacteria 877
157 Ga0373932_0147253 3300035112 Bacteria 805
158 Ga0373941_0069944 3300035115 Bacteria 1163
159 Ga0373942_0000455 3300035207 Bacteria 11526
160 Ga0373942_0181449 3300035207 Bacteria 690
161 Ga0373962_0004816 3300035242 Bacteria 3260
162 Ga0373931_0158983 3300035691 Bacteria 1323
163 Ga0373931_0689989 3300035691 Bacteria 674
164 Ga0373935_0003205 3300035692 Bacteria 9443
165 Ga0395900_0096283 3300037418 Bacteria 3041
166 Ga0395905_0041292 3300037471 Bacteria 4329
167 Ga0395901_0061520 3300038443 Bacteria 3907
168 Ga0395901_0371807 3300038443 Bacteria 1472
169 Ga0439431_0043424 3300041997 Unclassified 1150
170 Ga0439463_063440 3300042016 Bacteria 944
171 Ga0439434_0006277 3300042435 Bacteria 3469
172 Ga0466972_0112264 3300044658 Bacteria 1287
173 Ga0466965_0014259 3300044683 Bacteria 3761
174 Ga0466966_0099456 3300044684 Bacteria 1800
175 Ga0466961_0087930 3300044693 Bacteria 1963
176 Ga0466961_0248405 3300044693 Bacteria 1093
177 Ga0466963_0028520 3300044694 Bacteria 3585
178 Ga0466963_0175800 3300044694 Bacteria 1494
179 Ga0466963_0238394 3300044694 Bacteria 1275
180 Ga0466964_0006221 3300044706 Bacteria 4450
181 Ga0466964_0204201 3300044706 Bacteria 950
182 Ga0466971_0145497 3300044719 Bacteria 1105
183 Ga0466970_0196974 3300044765 Bacteria 1120
184 Ga0466970_0283032 3300044765 Bacteria 933
185 Ga0466957_0058065 3300044842 Bacteria 2370
186 Ga0466960_0013580 3300044901 Bacteria 3465
187 Ga0466960_0070960 3300044901 Bacteria 1734
188 Ga0466959_0189100 3300045049 Bacteria 1437
189 Ga0451576_1322704 3300045051 Bacteria 751
190 Ga0466958_0210614 3300045836 Bacteria 1238
191 Ga0466967_0010369 3300045976 Bacteria 6985
192 Ga0466967_0043237 3300045976 Bacteria 3899
193 Ga0466967_0047106 3300045976 Bacteria 3757
194 Ga0466967_0080626 3300045976 Bacteria 2937
195 Ga0466967_0097359 3300045976 Bacteria 2685
196 Ga0466967_0174284 3300045976 Bacteria 2026
197 Ga0466967_0248276 3300045976 Bacteria 1699
198 Ga0466967_0931709 3300045976 Bacteria 864
199 Ga0495629_0340289 3300046459 Bacteria 1024
200 Ga0495653_0008390 3300046463 Bacteria 8469
201 Ga0495662_0014990 3300046476 Bacteria 3765
202 Ga0495664_0017201 3300046477 Bacteria 4130
203 Ga0495594_0020465 3300046499 Bacteria 3524
204 Ga0495608_0002406 3300046511 Bacteria 13470
205 Ga0495628_0005970 3300046516 Bacteria 10660
206 Ga0495630_0075751 3300046517 Bacteria 2534
207 Ga0495666_0002884 3300046526 Bacteria 8607
208 Ga0495666_0200028 3300046526 Bacteria 918
209 Ga0495652_0039942 3300046529 Bacteria 4055
210 Ga0495665_0009024 3300046531 Bacteria 5410
211 Ga0495640_0043611 3300046533 Bacteria 3122
212 Ga0495587_0033566 3300046536 Bacteria 3097
213 Ga0495645_0013698 3300046543 Bacteria 5745
214 Ga0495645_0429366 3300046543 Bacteria 837
215 Ga0495634_0123488 3300046642 Bacteria 1656
216 Ga0495657_0033088 3300046675 Bacteria 3602
217 Ga0495599_0064697 3300046678 Bacteria 2284
218 Ga0495623_0068372 3300046679 Bacteria 2215
219 Ga0495646_0085255 3300046680 Bacteria 1833
220 Ga0495613_0001806 3300046689 Bacteria 16262
221 Ga0495613_0520382 3300046689 Bacteria 799
222 Ga0495600_0006371 3300046809 Bacteria 7181
223 Ga0495581_0003122 3300047315 Bacteria 9479
224 Ga0495581_0101195 3300047315 Bacteria 1674
225 Ga0495604_0001219 3300047317 Bacteria 21127
226 Ga0495674_0007388 3300047319 Bacteria 10506
227 Ga0495675_0016815 3300047444 Bacteria 4627
228 Ga0495675_0096741 3300047444 Bacteria 1850
229 Ga0495602_0007389 3300048088 Bacteria 11502
230 Ga0496100_0716279 3300048903 Bacteria 781
231 Ga0496101_0055113 3300048904 Bacteria 2871
232 Ga0496101_0839139 3300048904 Bacteria 724
233 Ga0496102_0006977 3300048905 Bacteria 9638
234 Ga0496102_0102017 3300048905 Bacteria 2667
235 Ga0496102_0407785 3300048905 Bacteria 1277
236 Ga0496104_0182704 3300048907 Bacteria 2007
237 Ga0496104_0716134 3300048907 Bacteria 908
238 Ga0496105_0040682 3300048908 Bacteria 3833
239 Ga0496105_0075446 3300048908 Bacteria 2784
240 Ga0496105_0559465 3300048908 Bacteria 892
241 Ga0496105_0686940 3300048908 Bacteria 787
242 Ga0496106_0506528 3300048909 Bacteria 970
243 Ga0496106_0564529 3300048909 Bacteria 913
244 Ga0496107_0021933 3300048910 Bacteria 4511
245 Ga0496107_0741049 3300048910 Bacteria 721
246 Ga0496108_0000074 3300048911 Bacteria 108445
247 Ga0496108_0016350 3300048911 Bacteria 6051
248 Ga0496108_0371245 3300048911 Bacteria 1249
249 Ga0496108_0389419 3300048911 Bacteria 1217
250 Ga0496108_0823888 3300048911 Bacteria 800
251 Ga0496108_0840204 3300048911 Bacteria 791
252 Ga0496109_0008689 3300048912 Bacteria 8646
253 Ga0496109_0044051 3300048912 Bacteria 4047
254 Ga0496109_0058580 3300048912 Bacteria 3518
255 Ga0496109_0066797 3300048912 Bacteria 3294
256 Ga0496109_0100967 3300048912 Bacteria 2677
257 Ga0496109_0171752 3300048912 Bacteria 2034
258 Ga0496109_0743771 3300048912 Bacteria 918
259 Ga0496110_0018212 3300048913 Bacteria 5885
260 Ga0496110_0299587 3300048913 Bacteria 1464
261 Ga0496110_0958672 3300048913 Bacteria 762
262 Ga0496111_0022214 3300048914 Bacteria 4438
263 Ga0496111_0031277 3300048914 Bacteria 3791
264 Ga0496111_0042926 3300048914 Bacteria 3248
265 Ga0496112_0262319 3300048915 Bacteria 1677
266 Ga0496112_0554090 3300048915 Bacteria 1083
267 Ga0496112_1225860 3300048915 Bacteria 667
268 Ga0496113_0038798 3300048916 Bacteria 3503
269 Ga0496113_0151605 3300048916 Bacteria 1829
270 Ga0496114_0001929 3300048917 Bacteria 15789
271 Ga0496114_0027004 3300048917 Bacteria 4702
272 Ga0496114_0037634 3300048917 Bacteria 4002
273 Ga0496114_0126361 3300048917 Bacteria 2205
274 Ga0496114_0148426 3300048917 Bacteria 2033
275 Ga0496114_0357798 3300048917 Bacteria 1291
276 Ga0496114_0625840 3300048917 Bacteria 948
277 Ga0496115_0097047 3300048918 Bacteria 2414
278 Ga0496115_0147391 3300048918 Bacteria 1943
279 Ga0496126_0000090 3300048929 Bacteria 210538
280 Ga0501031_0044553 3300049568 Bacteria 2895
281 Ga0501031_0456067 3300049568 Bacteria 826
282 Ga0501032_0018183 3300049569 Bacteria 4926
283 Ga0501032_0025463 3300049569 Bacteria 4078
284 Ga0501033_0091017 3300049570 Bacteria 2231
285 Ga0501033_0216906 3300049570 Bacteria 1363
286 Ga0501034_0006134 3300049571 Bacteria 12964
287 Ga0501034_0031840 3300049571 Bacteria 5357
288 Ga0501036_0004499 3300049572 Bacteria 11261
289 Ga0501036_0009684 3300049572 Bacteria 7930
290 Ga0501036_0245407 3300049572 Bacteria 1501
291 Ga0501037_0009266 3300049573 Bacteria 7217
292 Ga0501037_0010403 3300049573 Bacteria 6827
293 Ga0501038_0001385 3300049574 Bacteria 22157
294 Ga0501038_0292706 3300049574 Bacteria 1279
295 Ga0501039_0031027 3300049575 Bacteria 4120
296 Ga0501039_0049791 3300049575 Bacteria 3240
297 Ga0501039_0138003 3300049575 Bacteria 1915
298 Ga0501039_0193475 3300049575 Bacteria 1599
299 Ga0501039_0231609 3300049575 Bacteria 1452
300 Ga0501040_0105300 3300049576 Bacteria 1970
301 Ga0501041_0137200 3300049577 Bacteria 1524
302 Ga0501041_0264234 3300049577 Bacteria 1082
303 Ga0501042_0046102 3300049578 Bacteria 3108
304 Ga0501042_0086818 3300049578 Bacteria 2244
305 Ga0501042_0130790 3300049578 Bacteria 1809
306 Ga0501043_0045981 3300049579 Bacteria 3432
307 Ga0501043_0047948 3300049579 Bacteria 3358
308 Ga0501043_0203465 3300049579 Bacteria 1536
309 Ga0501043_1076189 3300049579 Bacteria 569
310 Ga0501046_0004768 3300049580 Bacteria 12236
311 Ga0501046_0005459 3300049580 Bacteria 11369
312 Ga0501046_0048164 3300049580 Bacteria 3376
313 Ga0501047_0040360 3300049581 Bacteria 4513
314 Ga0501047_0086732 3300049581 Bacteria 3007
315 Ga0501048_0022060 3300049582 Bacteria 4659
316 Ga0501048_0031810 3300049582 Bacteria 3816
317 Ga0501048_0106809 3300049582 Bacteria 1976
318 Ga0501048_0183808 3300049582 Bacteria 1482
319 Ga0501067_0029816 3300049583 Bacteria 3024
320 Ga0501068_0019756 3300049584 Bacteria 3917
321 Ga0501069_0015056 3300049585 Bacteria 4142
322 Ga0501069_0353746 3300049585 Bacteria 866
323 Ga0501070_0035329 3300049586 Bacteria 4177
324 Ga0501070_0572857 3300049586 Bacteria 902
325 Ga0501071_0090675 3300049587 Bacteria 2245
326 Ga0501072_0079318 3300049588 Bacteria 2600
327 Ga0501072_0102146 3300049588 Bacteria 2279
328 Ga0501073_0011894 3300049589 Bacteria 6353
329 Ga0501075_0134155 3300049591 Bacteria 1886
330 Ga0501075_0418756 3300049591 Unclassified 1021
331 Ga0501076_0009617 3300049592 Bacteria 7142
332 Ga0501076_0167341 3300049592 Bacteria 1792
333 Ga0501079_0167273 3300049741 Bacteria 1715
334 Ga0501080_0206403 3300049742 Bacteria 1802
335 Ga0501081_0020462 3300049743 Bacteria 4411
336 Ga0501081_0634917 3300049743 Bacteria 800
337 Ga0501083_0162439 3300049744 Bacteria 1461
338 Ga0501035_0005649 3300049822 Bacteria 11810
339 Ga0501035_0206951 3300049822 Bacteria 1680
340 Ga0501044_0042789 3300049823 Bacteria 4709
341 Ga0501045_0097974 3300049824 Bacteria 2169
342 Ga0501045_0151918 3300049824 Bacteria 1723
343 Ga0501045_0213202 3300049824 Bacteria 1438
344 nmdc:mga03683_28647_c1 3300050489 Bacteria 2216
345 nmdc:mga03n38_16862_c1 3300050490 Bacteria 2850
346 nmdc:mga03n38_173865_c1 3300050490 Bacteria 1099
347 nmdc:mga03n38_34224_c1 3300050490 Bacteria 2168
348 nmdc:mga00v17_204411_c1 3300050491 Bacteria 1277
349 nmdc:mga00v17_30875_c1 3300050491 Bacteria 3155
350 nmdc:mga00v17_49892_c1 3300050491 Bacteria 2540
351 nmdc:mga0yw44_126225_c1 3300050492 Bacteria 1652
352 nmdc:mga0yw44_137020_c1 3300050492 Bacteria 1589
353 nmdc:mga0yw44_1752_c1 3300050492 Bacteria 8838
354 nmdc:mga0yw44_309833_c1 3300050492 Bacteria 1059
355 nmdc:mga0yw44_385045_c1 3300050492 Bacteria 947
356 nmdc:mga0yw44_575361_c1 3300050492 Bacteria 765
357 nmdc:mga0yw44_629646_c1 3300050492 Bacteria 729
358 nmdc:mga0yw44_6611_c1 3300050492 Bacteria 5619
359 nmdc:mga06z11_36349_c1 3300050494 Bacteria 2431
360 nmdc:mga06z11_451610_c1 3300050494 Bacteria 776
361 nmdc:mga06z11_490781_c1 3300050494 Bacteria 744
362 nmdc:mga07m45_325668_c1 3300050496 Bacteria 893
363 nmdc:mga06r32_4122_c1 3300050510 Bacteria 13011
364 nmdc:mga06r32_908277_c1 3300050510 Bacteria 837
365 Ga0495601_0003618 3300053077 Bacteria 8887
366 Ga0500644_0000057 3300053088 Bacteria 66407
367 Ga0500583_0108071 3300053092 Bacteria 1368
368 Ga0500556_0002012 3300053104 Bacteria 7110
369 Ga0500593_001462 3300053117 Bacteria 8506
370 Ga0501084_0142746 3300054114 Bacteria 2017
371 Ga0501084_0161657 3300054114 Bacteria 1889
372 Ga0501082_0215800 3300060353 Bacteria 1669
373 Ga0501082_0722256 3300060353 Bacteria 872
374 Ga0466962_0348240 3300061719 Bacteria 738
375 Ga0530510_0352644 3300061734 Bacteria 1105
376 Ga0530510_0362283 3300061734 Bacteria 1090
377 Ga0530510_0438661 3300061734 Bacteria 987
378 Ga0530510_0556342 3300061734 Bacteria 871
379 2501944337 2501939600 Bacteria 6907073
380 2644089493 2643221615 Bacteria 5487866
381 2644319338 2643221657 Bacteria 5490246
382 2855685772 2855683550 Bacteria 7134265
383 2856859800 2856858025 Bacteria 7255264
384 2857482577 2857481737 Bacteria 4761446
385 649810288 649633069 Bacteria 6962533
386 Ga0500644_0123292
387 JGI25406J46586_10052560
388 rootL2_10069030
389 Ga0070658_10031994
390 Ga0070683_100005046
391 Ga0070683_100173523
392 Ga0068869_100095700
393 Ga0068868_100235846
394 Ga0068868_101201584
395 Ga0070692_10164196
396 Ga0070668_100259390
397 Ga0070675_100595738
398 Ga0070671_100206022
399 Ga0070674_100453246
400 Ga0070674_100971380
401 Ga0070659_100029351
402 Ga0070659_100302374
403 Ga0070711_100095929
404 Ga0070684_100002405
405 Ga0070665_100000723
406 Ga0070665_101083795
407 Ga0070664_100649272
408 Ga0068857_100007347
409 Ga0068856_100032344
410 Ga0070702_100074111
411 Ga0068859_100137685
412 Ga0068864_100055872
413 Ga0068861_100091331
414 Ga0068861_100181546
415 Ga0068870_10544627
416 Ga0068863_100128734
417 Ga0068863_100663611
418 Ga0068858_100078297
419 Ga0068858_100087248
420 Ga0068860_100001739
421 Ga0068860_100404011
422 Ga0068862_100511628
423 Ga0068862_100736207
424 Ga0081539_10000143
425 Ga0081539_10004929
426 Ga0075365_10014641
427 Ga0075365_10014832
428 Ga0075365_10037403
429 Ga0075365_10047563
430 Ga0075365_10077739
431 Ga0075365_10178077
432 Ga0075365_10324811
433 Ga0075365_10345827
434 Ga0075365_10347508
435 Ga0075368_10085533
436 Ga0075363_100127303
437 Ga0075363_100277043
438 Ga0075364_10039785
439 Ga0075364_10044448
440 Ga0075364_10073776
441 Ga0075364_10242696
442 Ga0070712_100139136
443 Ga0075367_10014872
444 Ga0075367_10163211
445 Ga0075367_10344852
446 Ga0075370_10136314
447 Ga0075370_10187596
448 Ga0075428_100000233
449 Ga0075431_100005203
450 Ga0075431_100295125
451 Ga0068865_100049321
452 Ga0097620_100137691
453 Ga0105245_10013870
454 Ga0105245_10830059
455 Ga0105245_11150124
456 Ga0105243_10139666
457 Ga0105243_10557442
458 Ga0105242_10236166
459 Ga0105249_10360614
460 Ga0105249_10535924
461 Ga0105249_10721709
462 Ga0105249_10936573
463 Ga0105239_10020784
464 Ga0105246_10003412
465 Ga0157371_10111855
466 Ga0157369_10069621
467 Ga0157374_11269720
468 Ga0157378_11224508
469 Ga0163162_10029940
470 Ga0163162_11826331
471 Ga0157372_10009657
472 Ga0157372_10375705
473 Ga0157375_10037289
474 Ga0157375_10150052
475 Ga0157375_10220964
476 Ga0157375_10573894
477 Ga0163163_10011519
478 Ga0163163_10021538
479 Ga0157380_10893641
480 Ga0157379_10023165
481 Ga0206353_11623017
482 Ga0207688_10106192
483 Ga0207705_10030708
484 Ga0207693_10297093
485 Ga0207663_10560618
486 Ga0207687_10801177
487 Ga0207709_10100386
488 Ga0207669_10241761
489 Ga0207704_10066838
490 Ga0207689_10250226
491 Ga0207661_10118129
492 Ga0207661_10336255
493 Ga0207679_10050122
494 Ga0207712_10229667
495 Ga0207712_11041140
496 Ga0207668_10112510
497 Ga0207658_10084759
498 Ga0207677_10827370
499 Ga0207703_10053721
500 Ga0207703_10417095
501 Ga0207639_10991532
502 Ga0207702_10153755
503 Ga0207641_10155864
504 Ga0207648_11496724
505 Ga0207674_10009782
506 Ga0207675_100224073
507 Ga0207698_10201451
508 Ga0268266_10347780
509 Ga0268264_10000398
510 Ga0307513_10008299
511 Ga0307513_10102374
512 Ga0307509_10005707
513 Ga0307508_10022052
514 Ga0307405_10131331
515 Ga0307405_10319481
516 Ga0307413_10058894
517 Ga0307410_10453700
518 Ga0326468_10001098
519 Ga0307406_10028621
520 Ga0307406_10297591
521 Ga0307407_10114776
522 Ga0307407_10121476
523 Ga0307412_10005112
524 Ga0307412_10155960
525 Ga0307412_10215601
526 Ga0307409_100027732
527 Ga0307409_100145962
528 Ga0307409_100151438
529 Ga0307409_100493786
530 Ga0307409_101212577
531 Ga0307416_100003635
532 Ga0307416_100007209
533 Ga0307416_100603061
534 Ga0307414_10861587
535 Ga0307415_100028313
536 Ga0307415_100064115
537 Ga0307415_100398077
538 Ga0307415_100593663
539 Ga0373948_0007982
540 Ga0373950_0009700
541 Ga0373938_0061876
542 Ga0373932_0147253
543 Ga0373941_0069944
544 Ga0373942_0000455
545 Ga0373942_0181449
546 Ga0373962_0004816
547 Ga0373931_0158983
548 Ga0373931_0689989
549 Ga0373935_0003205
550 Ga0395900_0096283
551 Ga0395905_0041292
552 Ga0395901_0061520
553 Ga0395901_0371807
554 Ga0439431_0043424
555 Ga0439463_063440
556 Ga0439434_0006277
557 Ga0466972_0112264
558 Ga0466965_0014259
559 Ga0466966_0099456
560 Ga0466961_0087930
561 Ga0466961_0248405
562 Ga0466963_0028520
563 Ga0466963_0175800
564 Ga0466963_0238394
565 Ga0466964_0006221
566 Ga0466964_0204201
567 Ga0466971_0145497
568 Ga0466970_0196974
569 Ga0466970_0283032
570 Ga0466957_0058065
571 Ga0466960_0013580
572 Ga0466960_0070960
573 Ga0466959_0189100
574 Ga0451576_1322704
575 Ga0466958_0210614
576 Ga0466967_0010369
577 Ga0466967_0043237
578 Ga0466967_0047106
579 Ga0466967_0080626
580 Ga0466967_0097359
581 Ga0466967_0174284
582 Ga0466967_0248276
583 Ga0466967_0931709
584 Ga0495629_0340289
585 Ga0495653_0008390
586 Ga0495662_0014990
587 Ga0495664_0017201
588 Ga0495594_0020465
589 Ga0495608_0002406
590 Ga0495628_0005970
591 Ga0495630_0075751
592 Ga0495666_0002884
593 Ga0495666_0200028
594 Ga0495652_0039942
595 Ga0495665_0009024
596 Ga0495640_0043611
597 Ga0495587_0033566
598 Ga0495645_0013698
599 Ga0495645_0429366
600 Ga0495634_0123488
601 Ga0495657_0033088
602 Ga0495599_0064697
603 Ga0495623_0068372
604 Ga0495646_0085255
605 Ga0495613_0001806
606 Ga0495613_0520382
607 Ga0495600_0006371
608 Ga0495581_0003122
609 Ga0495581_0101195
610 Ga0495604_0001219
611 Ga0495674_0007388
612 Ga0495675_0016815
613 Ga0495675_0096741
614 Ga0495602_0007389
615 Ga0496100_0716279
616 Ga0496101_0055113
617 Ga0496101_0839139
618 Ga0496102_0006977
619 Ga0496102_0102017
620 Ga0496102_0407785
621 Ga0496104_0182704
622 Ga0496104_0716134
623 Ga0496105_0040682
624 Ga0496105_0075446
625 Ga0496105_0559465
626 Ga0496105_0686940
627 Ga0496106_0506528
628 Ga0496106_0564529
629 Ga0496107_0021933
630 Ga0496107_0741049
631 Ga0496108_0000074
632 Ga0496108_0016350
633 Ga0496108_0371245
634 Ga0496108_0389419
635 Ga0496108_0823888
636 Ga0496108_0840204
637 Ga0496109_0008689
638 Ga0496109_0044051
639 Ga0496109_0058580
640 Ga0496109_0066797
641 Ga0496109_0100967
642 Ga0496109_0171752
643 Ga0496109_0743771
644 Ga0496110_0018212
645 Ga0496110_0299587
646 Ga0496110_0958672
647 Ga0496111_0022214
648 Ga0496111_0031277
649 Ga0496111_0042926
650 Ga0496112_0262319
651 Ga0496112_0554090
652 Ga0496112_1225860
653 Ga0496113_0038798
654 Ga0496113_0151605
655 Ga0496114_0001929
656 Ga0496114_0027004
657 Ga0496114_0037634
658 Ga0496114_0126361
659 Ga0496114_0148426
660 Ga0496114_0357798
661 Ga0496114_0625840
662 Ga0496115_0097047
663 Ga0496115_0147391
664 Ga0496126_0000090
665 Ga0501031_0044553
666 Ga0501031_0456067
667 Ga0501032_0018183
668 Ga0501032_0025463
669 Ga0501033_0091017
670 Ga0501033_0216906
671 Ga0501034_0006134
672 Ga0501034_0031840
673 Ga0501036_0004499
674 Ga0501036_0009684
675 Ga0501036_0245407
676 Ga0501037_0009266
677 Ga0501037_0010403
678 Ga0501038_0001385
679 Ga0501038_0292706
680 Ga0501039_0031027
681 Ga0501039_0049791
682 Ga0501039_0138003
683 Ga0501039_0193475
684 Ga0501039_0231609
685 Ga0501040_0105300
686 Ga0501041_0137200
687 Ga0501041_0264234
688 Ga0501042_0046102
689 Ga0501042_0086818
690 Ga0501042_0130790
691 Ga0501043_0045981
692 Ga0501043_0047948
693 Ga0501043_0203465
694 Ga0501043_1076189
695 Ga0501046_0004768
696 Ga0501046_0005459
697 Ga0501046_0048164
698 Ga0501047_0040360
699 Ga0501047_0086732
700 Ga0501048_0022060
701 Ga0501048_0031810
702 Ga0501048_0106809
703 Ga0501048_0183808
704 Ga0501067_0029816
705 Ga0501068_0019756
706 Ga0501069_0015056
707 Ga0501069_0353746
708 Ga0501070_0035329
709 Ga0501070_0572857
710 Ga0501071_0090675
711 Ga0501072_0079318
712 Ga0501072_0102146
713 Ga0501073_0011894
714 Ga0501075_0134155
715 Ga0501075_0418756
716 Ga0501076_0009617
717 Ga0501076_0167341
718 Ga0501079_0167273
719 Ga0501080_0206403
720 Ga0501081_0020462
721 Ga0501081_0634917
722 Ga0501083_0162439
723 Ga0501035_0005649
724 Ga0501035_0206951
725 Ga0501044_0042789
726 Ga0501045_0097974
727 Ga0501045_0151918
728 Ga0501045_0213202
729 nmdc:mga03683_28647_c1
730 nmdc:mga03n38_16862_c1
731 nmdc:mga03n38_173865_c1
732 nmdc:mga03n38_34224_c1
733 nmdc:mga00v17_204411_c1
734 nmdc:mga00v17_30875_c1
735 nmdc:mga00v17_49892_c1
736 nmdc:mga0yw44_126225_c1
737 nmdc:mga0yw44_137020_c1
738 nmdc:mga0yw44_1752_c1
739 nmdc:mga0yw44_309833_c1
740 nmdc:mga0yw44_385045_c1
741 nmdc:mga0yw44_575361_c1
742 nmdc:mga0yw44_629646_c1
743 nmdc:mga0yw44_6611_c1
744 nmdc:mga06z11_36349_c1
745 nmdc:mga06z11_451610_c1
746 nmdc:mga06z11_490781_c1
747 nmdc:mga07m45_325668_c1
748 nmdc:mga06r32_4122_c1
749 nmdc:mga06r32_908277_c1
750 Ga0495601_0003618
751 Ga0500644_0000057
752 Ga0500583_0108071
753 Ga0500556_0002012
754 Ga0500593_001462
755 Ga0501084_0142746
756 Ga0501084_0161657
757 Ga0501082_0215800
758 Ga0501082_0722256
759 Ga0466962_0348240
760 Ga0530510_0352644
761 Ga0530510_0362283
762 Ga0530510_0438661
763 Ga0530510_0556342
764 2501944337
765 2644089493
766 2644319338
767 2855685772
768 2856859800
769 2857482577
770 649810288

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02682

CT_C_D

Carboxyltransferase domain, subdomain C and D

40

225

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zp2-assembly2.cif.gz_B c-terminal domain of kipi from bacillus subtilis 0.8687 77 196
2zp2-assembly1.cif.gz_A c-terminal domain of kipi from bacillus subtilis 0.8563 77 196
3mml-assembly1.cif.gz_B allophanate hydrolase complex from mycobacterium smegmatis, msmeg0435-msmeg0436 0.837 1 196
2zp2-assembly2.cif.gz_B c-terminal domain of kipi from bacillus subtilis 0.8351 77 196
3mml-assembly1.cif.gz_B allophanate hydrolase complex from mycobacterium smegmatis, msmeg0435-msmeg0436 0.8332 1 196
ID Description Score Start End Superfamily
af_Q2G095_94_231_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9135 79 196 2.40.100.10
3oreA02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9135 77 196 2.40.100.10
3mmlD02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9061 72 196 2.40.100.10
3mmlD02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8791 72 196 2.40.100.10
2zp2A00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.8563 77 196 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A259N1U3-F1-model_v4 Allophanate hydrolase 0.9755 79 196 GO:0005524
GO:0016787
AF-A0A838S8M9-F1-model_v4 Allophanate hydrolase subunit 1 0.9753 81 196 GO:0005524
GO:0016787
AF-A0A5R9FM84-F1-model_v4 Allophanate hydrolase subunit 1 0.9691 1 196 GO:0005524
GO:0016787
AF-A0A0N0N669-F1-model_v4 Allophanate hydrolase subunit 1 0.9669 1 195 GO:0005524
GO:0016787
AF-A0A7U3UZM2-F1-model_v4 Putative inhibitor of KinA 0.9665 2 195 GO:0005524
GO:0016787

Map