F430325

General Info

Members Datasets Scaffolds Average Seq Length
385 265 770 236

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0119783|Ga0501075_0119783_469_1281
Length 270
Sequence VSDDSTTRWERPVESLADEAAPPDVRIGKPVLEAVDIVAGYIPEVNILNGCNLVVNEGEFVGIIGPNGAGKSTILKAILGQCVIRSGTVHLGDREITGHKAHELVAMGVGYVPQVRNVFPSLTVRENLEMGCFLAKRRFNERFEYVTTLFPRLGERATQRAGALSGGERQMVAMGRALMMEPSILLLDEPSAGLSPALQDEVFVRCRRINQEGVAILMVEQNARRCLQVVHRGYVLDQGQNAYTGTGRELLSDPNVIELYLGTLVKATGG

Samples

Sample ID Description Type Environment
1 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
151 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
152 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
153 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
171 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
176 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
177 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
178 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
227 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
241 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
242 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
245 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
246 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
248 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
249 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
250 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
251 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
252 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
253 2643221570 Acidovorax sp. Root568 Isolate Unclassified
254 2643221596 Acidovorax sp. Root70 Isolate Unclassified
255 2643221652 Acidovorax sp. Root402 Isolate Unclassified
256 2643221693 Rhizobium sp. Root491 Isolate Unclassified
257 2643221717 Acidovorax sp. Root267 Isolate Unclassified
258 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
259 2842747753 Variovorax sp. R-72060 Isolate Unclassified
260 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
261 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
262 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
263 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
264 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
265 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.81
Metatranscriptomes 0.52
Isolates 4.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.35
Nodule 0.52
Rhizoplane 1.04
Rhizosphere 80.26
Stem 0
Stem Tuber 0
Unclassified 3.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501075_0119783 3300049591 Bacteria 2003
2 JGI24751J29686_10011245 3300002459 Bacteria 1846
3 Ga0055526_1020929 3300003771 Bacteria 2300
4 Ga0065707_10018337 3300005295 Bacteria 1474
5 Ga0070676_10201248 3300005328 Bacteria 1305
6 Ga0070683_100002019 3300005329 Bacteria 15947
7 Ga0070683_100222178 3300005329 Bacteria 1795
8 Ga0070670_100212666 3300005331 Unclassified 1681
9 Ga0068869_100002589 3300005334 Bacteria 10924
10 Ga0068868_100044144 3300005338 Bacteria 3484
11 Ga0070660_100154576 3300005339 Bacteria 1846
12 Ga0070689_100314728 3300005340 Unclassified 1306
13 Ga0070692_10018228 3300005345 Bacteria 3371
14 Ga0070668_100039575 3300005347 Bacteria 3605
15 Ga0070669_100013386 3300005353 Bacteria 5833
16 Ga0070669_100383603 3300005353 Bacteria 1146
17 Ga0070675_100020976 3300005354 Bacteria 5217
18 Ga0070675_100376079 3300005354 Bacteria 1264
19 Ga0070671_100251978 3300005355 Bacteria 1500
20 Ga0070673_100012523 3300005364 Bacteria 5826
21 Ga0070673_100174713 3300005364 Unclassified 1835
22 Ga0070659_100009845 3300005366 Bacteria 7030
23 Ga0070709_10181918 3300005434 Bacteria 1477
24 Ga0070714_100005141 3300005435 Bacteria 9958
25 Ga0070714_100056684 3300005435 Bacteria 3352
26 Ga0070713_100228902 3300005436 Bacteria 1689
27 Ga0070711_100201490 3300005439 Bacteria 1536
28 Ga0070700_100280650 3300005441 Bacteria 1208
29 Ga0070663_100131734 3300005455 Bacteria 1899
30 Ga0070678_100075584 3300005456 Bacteria 2534
31 Ga0068867_100064389 3300005459 Bacteria 2726
32 Ga0068867_100156950 3300005459 Bacteria 1792
33 Ga0070685_10010667 3300005466 Bacteria 4782
34 Ga0070707_100025356 3300005468 Bacteria 5624
35 Ga0070698_100170192 3300005471 Bacteria 2120
36 Ga0070684_100000882 3300005535 Bacteria 21206
37 Ga0068853_100013133 3300005539 Bacteria 6758
38 Ga0068853_100043479 3300005539 Bacteria 3843
39 Ga0070672_100067684 3300005543 Bacteria 2830
40 Ga0070672_100580085 3300005543 Bacteria 975
41 Ga0070704_100046186 3300005549 Bacteria 3035
42 Ga0068855_100250425 3300005563 Bacteria 1976
43 Ga0070664_100033324 3300005564 Bacteria 4314
44 Ga0068857_100224039 3300005577 Bacteria 1718
45 Ga0068857_100422595 3300005577 Bacteria 1243
46 Ga0068854_100009845 3300005578 Bacteria 6182
47 Ga0068856_100407993 3300005614 Bacteria 1378
48 Ga0068856_100871922 3300005614 Bacteria 919
49 Ga0068852_100061370 3300005616 Bacteria 3267
50 Ga0068859_100395035 3300005617 Bacteria 1479
51 Ga0068859_101079790 3300005617 Bacteria 883
52 Ga0068864_100054863 3300005618 Bacteria 3440
53 Ga0068866_10177671 3300005718 Bacteria 1255
54 Ga0068861_100459445 3300005719 Bacteria 1143
55 Ga0068851_10004997 3300005834 Bacteria 6007
56 Ga0068870_10036376 3300005840 Bacteria 2533
57 Ga0068870_10341776 3300005840 Bacteria 957
58 Ga0068863_100984768 3300005841 Unclassified 845
59 Ga0068862_100086436 3300005844 Bacteria 2726
60 Ga0081455_10007592 3300005937 Bacteria 11398
61 Ga0081455_10105904 3300005937 Bacteria 2246
62 Ga0081538_10022939 3300005981 Bacteria 4503
63 Ga0081538_10062677 3300005981 Bacteria 2118
64 Ga0081539_10100720 3300005985 Bacteria 1473
65 Ga0075365_10029144 3300006038 Bacteria 3525
66 Ga0075365_10031118 3300006038 Bacteria 3421
67 Ga0075365_10057574 3300006038 Bacteria 2586
68 Ga0075363_100012620 3300006048 Bacteria 4075
69 Ga0075363_100036518 3300006048 Bacteria 2577
70 Ga0075363_100088329 3300006048 Bacteria 1704
71 Ga0075364_10003158 3300006051 Bacteria 9324
72 Ga0075364_10022293 3300006051 Bacteria 3998
73 Ga0075432_10117749 3300006058 Bacteria 995
74 Ga0075362_10000157 3300006177 Bacteria 18434
75 Ga0075367_10001613 3300006178 Bacteria 9787
76 Ga0075367_10141282 3300006178 Bacteria 1491
77 Ga0075369_10000069 3300006186 Bacteria 26983
78 Ga0075369_10127521 3300006186 Bacteria 1155
79 Ga0097621_100311927 3300006237 Unclassified 1391
80 Ga0075370_10002506 3300006353 Bacteria 8525
81 Ga0075428_100038451 3300006844 Bacteria 5265
82 Ga0075428_100065639 3300006844 Bacteria 3975
83 Ga0075428_100069667 3300006844 Bacteria 3845
84 Ga0075428_100145433 3300006844 Bacteria 2576
85 Ga0075428_100193408 3300006844 Bacteria 2200
86 Ga0075430_100031408 3300006846 Bacteria 4507
87 Ga0075430_100041137 3300006846 Bacteria 3911
88 Ga0075431_100068500 3300006847 Bacteria 3662
89 Ga0075431_100070341 3300006847 Bacteria 3610
90 Ga0075431_100480356 3300006847 Bacteria 1235
91 Ga0075433_10024497 3300006852 Bacteria 5094
92 Ga0075434_100101867 3300006871 Bacteria 2879
93 Ga0075429_100137127 3300006880 Bacteria 2141
94 Ga0075436_100096289 3300006914 Bacteria 2059
95 Ga0097620_100395040 3300006931 Bacteria 1479
96 Ga0097620_101079831 3300006931 Bacteria 883
97 Ga0075435_100025955 3300007076 Bacteria 4567
98 Ga0105240_10074965 3300009093 Bacteria 4174
99 Ga0105240_11093435 3300009093 Bacteria 849
100 Ga0111539_10036741 3300009094 Bacteria 5919
101 Ga0111539_10329572 3300009094 Bacteria 1777
102 Ga0111539_10429965 3300009094 Bacteria 1537
103 Ga0111539_10459886 3300009094 Bacteria 1482
104 Ga0105245_10038840 3300009098 Bacteria 4236
105 Ga0105247_10007267 3300009101 Bacteria 6804
106 Ga0114129_10029392 3300009147 Bacteria 7786
107 Ga0114129_10091606 3300009147 Bacteria 4211
108 Ga0114129_10342674 3300009147 Bacteria 1982
109 Ga0114129_10408971 3300009147 Bacteria 1787
110 Ga0114129_10539979 3300009147 Bacteria 1518
111 Ga0114129_11155494 3300009147 Bacteria 966
112 Ga0105243_10246312 3300009148 Bacteria 1593
113 Ga0105241_10033861 3300009174 Bacteria 3836
114 Ga0105241_10047833 3300009174 Bacteria 3253
115 Ga0105242_10005240 3300009176 Bacteria 10006
116 Ga0105249_10177653 3300009553 Bacteria 2069
117 Ga0105249_10376179 3300009553 Bacteria 1445
118 Ga0105239_10317027 3300010375 Bacteria 1758
119 Ga0105246_10632417 3300011119 Bacteria 929
120 Ga0105246_10777471 3300011119 Bacteria 847
121 Ga0157373_10001823 3300013100 Bacteria 16229
122 Ga0157373_10021979 3300013100 Bacteria 4629
123 Ga0157371_10000660 3300013102 Bacteria 40985
124 Ga0157371_10035660 3300013102 Bacteria 3565
125 Ga0157378_10295296 3300013297 Bacteria 1566
126 Ga0163162_11022886 3300013306 Bacteria 934
127 Ga0157372_10388842 3300013307 Bacteria 1625
128 Ga0157380_10231232 3300014326 Bacteria 1661
129 Ga0157380_10400562 3300014326 Bacteria 1302
130 Ga0157379_10426671 3300014968 Bacteria 1221
131 Ga0163161_10166762 3300017792 Bacteria 1682
132 Ga0206356_10859539 3300020070 Bacteria 1352
133 Ga0206353_10097257 3300020082 Bacteria 1029
134 Ga0213875_10002202 3300021388 Bacteria 11873
135 Ga0213875_10231906 3300021388 Bacteria 870
136 Ga0209563_105814 3300025230 Bacteria 2191
137 Ga0209564_1000204 3300025295 Bacteria 136175
138 Ga0209758_1025268 3300025297 Bacteria 2612
139 Ga0207426_1007133 3300025302 Bacteria 4721
140 Ga0207682_10008979 3300025893 Bacteria 3950
141 Ga0207642_10238974 3300025899 Bacteria 1025
142 Ga0207680_10297246 3300025903 Bacteria 1125
143 Ga0207699_10144091 3300025906 Bacteria 1569
144 Ga0207645_10202670 3300025907 Bacteria 1306
145 Ga0207643_10084534 3300025908 Bacteria 1842
146 Ga0207643_10138289 3300025908 Bacteria 1453
147 Ga0207654_10016535 3300025911 Bacteria 3843
148 Ga0207707_10735230 3300025912 Bacteria 826
149 Ga0207695_10021512 3300025913 Bacteria 7357
150 Ga0207663_10350450 3300025916 Bacteria 1117
151 Ga0207660_10051456 3300025917 Bacteria 2928
152 Ga0207662_10013612 3300025918 Bacteria 4552
153 Ga0207657_10008164 3300025919 Bacteria 10668
154 Ga0207649_10058098 3300025920 Bacteria 2421
155 Ga0207649_10565122 3300025920 Bacteria 872
156 Ga0207652_10181371 3300025921 Bacteria 1892
157 Ga0207646_10868813 3300025922 Bacteria 801
158 Ga0207681_10003538 3300025923 Bacteria 9727
159 Ga0207681_10043711 3300025923 Bacteria 3000
160 Ga0207681_10201443 3300025923 Bacteria 1529
161 Ga0207694_10047509 3300025924 Bacteria 3320
162 Ga0207694_10096698 3300025924 Bacteria 2336
163 Ga0207650_10141095 3300025925 Unclassified 1894
164 Ga0207664_10021723 3300025929 Bacteria 4780
165 Ga0207706_10128332 3300025933 Bacteria 2230
166 Ga0207686_10029963 3300025934 Bacteria 3216
167 Ga0207709_10093616 3300025935 Bacteria 1970
168 Ga0207670_10189559 3300025936 Bacteria 1555
169 Ga0207704_10123653 3300025938 Bacteria 1776
170 Ga0207691_10015733 3300025940 Bacteria 7190
171 Ga0207691_10245124 3300025940 Bacteria 1548
172 Ga0207661_10000041 3300025944 Bacteria 122817
173 Ga0207679_10049028 3300025945 Bacteria 3078
174 Ga0207679_10055711 3300025945 Bacteria 2916
175 Ga0207667_10016950 3300025949 Bacteria 8218
176 Ga0207712_10096706 3300025961 Bacteria 2186
177 Ga0207668_10223588 3300025972 Bacteria 1513
178 Ga0207668_10302284 3300025972 Bacteria 1321
179 Ga0207668_10464641 3300025972 Bacteria 1083
180 Ga0207658_10649094 3300025986 Unclassified 951
181 Ga0207677_10397752 3300026023 Unclassified 1168
182 Ga0207703_10210095 3300026035 Bacteria 1735
183 Ga0207703_10343385 3300026035 Bacteria 1373
184 Ga0207703_10658999 3300026035 Bacteria 993
185 Ga0207639_10107932 3300026041 Bacteria 2262
186 Ga0207678_10007560 3300026067 Bacteria 9603
187 Ga0207678_10857637 3300026067 Unclassified 802
188 Ga0207702_10094921 3300026078 Bacteria 2619
189 Ga0207641_10949411 3300026088 Unclassified 855
190 Ga0207648_10013613 3300026089 Bacteria 7554
191 Ga0207648_10163771 3300026089 Bacteria 1965
192 Ga0207676_10034010 3300026095 Bacteria 3856
193 Ga0207674_10012653 3300026116 Bacteria 9430
194 Ga0207674_10013848 3300026116 Bacteria 8923
195 Ga0207675_100115617 3300026118 Bacteria 2535
196 Ga0207683_10059697 3300026121 Bacteria 3350
197 Ga0207698_10746401 3300026142 Bacteria 977
198 Ga0207428_10062848 3300027907 Bacteria 2934
199 Ga0268265_10189093 3300028380 Bacteria 1776
200 Ga0268265_10289925 3300028380 Unclassified 1469
201 Ga0268264_10283927 3300028381 Bacteria 1552
202 Ga0268264_10450887 3300028381 Unclassified 1246
203 Ga0265325_10061369 3300031241 Bacteria 1907
204 Ga0265340_10123285 3300031247 Bacteria 1191
205 Ga0265339_10095934 3300031249 Bacteria 1549
206 Ga0265331_10079356 3300031250 Bacteria 1527
207 Ga0307408_100295857 3300031548 Bacteria 1354
208 Ga0307409_100004914 3300031995 Bacteria 7607
209 Ga0307416_100028063 3300032002 Bacteria 4180
210 Ga0307510_10000928 3300033180 Bacteria 31078
211 Ga0373948_0010658 3300034817 Bacteria 1610
212 Ga0373958_0006918 3300034819 Bacteria 1787
213 Ga0373938_0014275 3300034957 Bacteria 1522
214 Ga0373929_0028188 3300035085 Bacteria 1185
215 Ga0373940_0028007 3300035088 Bacteria 1484
216 Ga0373949_0003793 3300035090 Bacteria 3526
217 Ga0373949_0037137 3300035090 Bacteria 1184
218 Ga0373932_0024742 3300035112 Bacteria 1619
219 Ga0373939_0009746 3300035114 Bacteria 2388
220 Ga0373939_0023689 3300035114 Bacteria 1703
221 Ga0373941_0036435 3300035115 Bacteria 1496
222 Ga0373960_0045747 3300035121 Bacteria 1282
223 Ga0373961_0007335 3300035241 Bacteria 2666
224 Ga0373931_0001748 3300035691 Bacteria 9426
225 Ga0373931_0008351 3300035691 Bacteria 4906
226 Ga0316584_0034140 3300036712 Bacteria 3771
227 Ga0373925_0311878 3300037068 Bacteria 1272
228 Ga0395899_0149861 3300037312 Bacteria 1654
229 Ga0395900_0121386 3300037418 Bacteria 2681
230 Ga0395900_0476303 3300037418 Bacteria 1201
231 Ga0395898_0106754 3300037466 Bacteria 2686
232 Ga0395898_0438345 3300037466 Bacteria 1245
233 Ga0395905_0101226 3300037471 Bacteria 2705
234 Ga0395905_0140680 3300037471 Bacteria 2270
235 Ga0436364_0246265 3300037853 Bacteria 23283
236 Ga0436364_1055139 3300037853 Bacteria 1245
237 Ga0395901_0226075 3300038443 Bacteria 1955
238 Ga0395901_0893058 3300038443 Bacteria 871
239 Ga0400483_194569 3300039062 Bacteria 12264
240 Ga0400489_63543 3300039093 Bacteria 130825
241 Ga0436360_0834330 3300039438 Bacteria 832
242 Ga0436361_0107608 3300039447 Bacteria 1635
243 Ga0436363_0997913 3300039450 Bacteria 1550
244 Ga0451837_1064323 3300041494 Bacteria 926
245 Ga0439432_049733 3300042006 Bacteria 1310
246 Ga0439446_0009143 3300042156 Bacteria 2646
247 Ga0439459_0036758 3300042438 Unclassified 1023
248 Ga0451577_0002082 3300042876 Bacteria 24635
249 Ga0453684_0018700 3300044712 Bacteria 10616
250 Ga0453684_0213976 3300044712 Bacteria 2238
251 Ga0466957_0069968 3300044842 Bacteria 2168
252 Ga0451576_0004443 3300045051 Bacteria 18205
253 Ga0495650_0111894 3300046471 Bacteria 1013
254 Ga0495606_0102509 3300046507 Bacteria 1740
255 Ga0495621_0011895 3300046539 Bacteria 2705
256 Ga0495668_0112270 3300046616 Bacteria 1491
257 Ga0495672_0001179 3300047320 Bacteria 26520
258 Ga0495676_0085641 3300047321 Bacteria 2374
259 Ga0495687_006656 3300047443 Bacteria 7022
260 Ga0496108_0543630 3300048911 Bacteria 1014
261 Ga0496110_0036314 3300048913 Bacteria 4279
262 Ga0496114_0119370 3300048917 Bacteria 2267
263 Ga0496115_0101440 3300048918 Bacteria 2360
264 Ga0496117_0249087 3300048920 Bacteria 970
265 Ga0496120_0212582 3300048923 Bacteria 929
266 Ga0496121_0108103 3300048924 Bacteria 2128
267 Ga0496122_0000450 3300048925 Bacteria 85686
268 Ga0496122_0025009 3300048925 Bacteria 5206
269 Ga0496123_0000176 3300048926 Bacteria 130010
270 Ga0496123_0016869 3300048926 Bacteria 5903
271 Ga0496124_0011214 3300048927 Bacteria 8984
272 Ga0496124_0138333 3300048927 Bacteria 1925
273 Ga0496126_0004109 3300048929 Bacteria 17613
274 Ga0496126_0036025 3300048929 Bacteria 4631
275 Ga0496126_0405801 3300048929 Bacteria 1104
276 Ga0501031_0031237 3300049568 Bacteria 3474
277 Ga0501032_0099227 3300049569 Bacteria 1929
278 Ga0501033_0094542 3300049570 Bacteria 2185
279 Ga0501033_0121186 3300049570 Bacteria 1898
280 Ga0501033_0153182 3300049570 Bacteria 1662
281 Ga0501034_0022761 3300049571 Bacteria 6383
282 Ga0501034_0287181 3300049571 Bacteria 1584
283 Ga0501036_0105998 3300049572 Bacteria 2377
284 Ga0501036_0164176 3300049572 Bacteria 1872
285 Ga0501037_0047377 3300049573 Bacteria 3150
286 Ga0501037_0259430 3300049573 Bacteria 1214
287 Ga0501038_0111874 3300049574 Bacteria 2261
288 Ga0501038_0168694 3300049574 Bacteria 1774
289 Ga0501038_0314045 3300049574 Bacteria 1227
290 Ga0501039_0478426 3300049575 Bacteria 978
291 Ga0501040_0000145 3300049576 Bacteria 38616
292 Ga0501040_0109252 3300049576 Bacteria 1933
293 Ga0501040_0353199 3300049576 Bacteria 1053
294 Ga0501042_0001811 3300049578 Bacteria 12811
295 Ga0501042_0028061 3300049578 Bacteria 3961
296 Ga0501042_0423881 3300049578 Bacteria 964
297 Ga0501043_0042632 3300049579 Bacteria 3566
298 Ga0501046_0158863 3300049580 Bacteria 1701
299 Ga0501046_0355029 3300049580 Bacteria 1064
300 Ga0501047_0159418 3300049581 Bacteria 2128
301 Ga0501047_0220227 3300049581 Bacteria 1754
302 Ga0501047_0422657 3300049581 Bacteria 1164
303 Ga0501048_0073605 3300049582 Bacteria 2411
304 Ga0501068_0039330 3300049584 Bacteria 2836
305 Ga0501069_0259293 3300049585 Bacteria 1015
306 Ga0501070_0159812 3300049586 Bacteria 1858
307 Ga0501070_0689473 3300049586 Bacteria 808
308 Ga0501071_0574275 3300049587 Bacteria 866
309 Ga0501072_0014348 3300049588 Bacteria 6074
310 Ga0501072_0161115 3300049588 Bacteria 1790
311 Ga0501072_0189571 3300049588 Bacteria 1640
312 Ga0501075_0051632 3300049591 Bacteria 3092
313 Ga0501075_0309043 3300049591 Bacteria 1205
314 Ga0501076_0027388 3300049592 Bacteria 4421
315 Ga0501080_0513747 3300049742 Bacteria 1069
316 Ga0501083_0010444 3300049744 Bacteria 6537
317 Ga0501083_0032426 3300049744 Bacteria 3581
318 Ga0501035_0061749 3300049822 Bacteria 3335
319 Ga0501035_0290290 3300049822 Bacteria 1380
320 Ga0501044_0023767 3300049823 Bacteria 6517
321 Ga0501044_0255098 3300049823 Bacteria 1693
322 Ga0501044_0410534 3300049823 Bacteria 1265
323 Ga0501044_0430409 3300049823 Bacteria 1229
324 Ga0501045_0026665 3300049824 Bacteria 4158
325 Ga0501045_0056146 3300049824 Bacteria 2880
326 nmdc:mga03683_250028_c1 3300050489 Bacteria 823
327 nmdc:mga03683_38177_c1 3300050489 Bacteria 1960
328 nmdc:mga03683_3949_c1 3300050489 Bacteria 4856
329 nmdc:mga03n38_80179_c1 3300050490 Bacteria 1532
330 nmdc:mga00v17_212773_c1 3300050491 Bacteria 1251
331 nmdc:mga00v17_24_c1 3300050491 Bacteria 102283
332 nmdc:mga0yw44_174_c1 3300050492 Bacteria 22566
333 nmdc:mga0yw44_6517_c1 3300050492 Bacteria 5651
334 nmdc:mga0yw44_8126_c1 3300050492 Bacteria 5210
335 nmdc:mga06z11_2820_c1 3300050494 Bacteria 6668
336 nmdc:mga07m45_4353_c1 3300050496 Bacteria 6927
337 nmdc:mga05p37_1165878_c1 3300050507 Bacteria 800
338 nmdc:mga05p37_397954_c1 3300050507 Bacteria 1609
339 nmdc:mga09592_101585_c1 3300050508 Bacteria 2463
340 nmdc:mga09592_223596_c1 3300050508 Bacteria 1631
341 nmdc:mga09592_80469_c1 3300050508 Bacteria 2775
342 nmdc:mga0qj67_270216_c1 3300050509 Bacteria 1379
343 nmdc:mga0qj67_425472_c1 3300050509 Bacteria 1070
344 nmdc:mga0qj67_90804_c1 3300050509 Bacteria 2454
345 nmdc:mga06r32_234330_c1 3300050510 Bacteria 1824
346 nmdc:mga06r32_34086_c1 3300050510 Bacteria 4800
347 nmdc:mga06r32_35183_c1 3300050510 Bacteria 4726
348 nmdc:mga06r32_551995_c1 3300050510 Bacteria 1126
349 nmdc:mga06r32_83440_c1 3300050510 Bacteria 3114
350 nmdc:mga08y16_212885_c1 3300050511 Bacteria 2001
351 nmdc:mga08y16_77077_c1 3300050511 Bacteria 3475
352 nmdc:mga0n895_6579_c1 3300050512 Bacteria 9888
353 nmdc:mga08x19_63215_c1 3300050514 Bacteria 2401
354 nmdc:mga0a205_27279_c1 3300050515 Bacteria 5454
355 nmdc:mga0a205_6039_c1 3300050515 Bacteria 10925
356 nmdc:mga0sz30_14156_c1 3300050516 Bacteria 3136
357 Ga0500559_0001223 3300053136 Bacteria 15216
358 Ga0500561_0003466 3300053137 Bacteria 2764
359 Ga0500616_0000270 3300053153 Bacteria 77614
360 Ga0500622_0069090 3300053156 Bacteria 1790
361 Ga0500645_007986 3300053730 Bacteria 3646
362 Ga0501082_0000002 3300060353 Bacteria 186546
363 Ga0501082_0128280 3300060353 Bacteria 2201
364 Ga0501082_0203247 3300060353 Bacteria 1724
365 Ga0501082_0487621 3300060353 Bacteria 1077
366 Ga0530510_0044547 3300061734 Bacteria 3206
367 Ga0530510_0114709 3300061734 Bacteria 1975
368 2501074448 2501025501 Bacteria 7768574
369 2501413432 2501025504 Bacteria 8008976
370 2511101805 2510917014 Bacteria 8296963
371 2511106215 2510917015 Bacteria 7950052
372 2554249632 2554235003 Bacteria 5877155
373 2643867596 2643221570 Bacteria 5103772
374 2643990517 2643221596 Bacteria 5006805
375 2644294968 2643221652 Bacteria 5140275
376 2644519921 2643221693 Bacteria 5513853
377 2644648861 2643221717 Bacteria 5676132
378 2842720261 2842718218 Bacteria 4560148
379 2842748503 2842747753 Bacteria 5578255
380 2894026642 2894023352 Bacteria 5167372
381 2895516017 2895511927 Bacteria 6802080
382 2899846124 2899845264 Bacteria 5672268
383 2926765428 2926760298 Bacteria 5505990
384 2974322760 2974320154 Bacteria 4571377
385 643598003 643348564 Bacteria 8839022
386 Ga0501075_0119783
387 JGI24751J29686_10011245
388 Ga0055526_1020929
389 Ga0065707_10018337
390 Ga0070676_10201248
391 Ga0070683_100002019
392 Ga0070683_100222178
393 Ga0070670_100212666
394 Ga0068869_100002589
395 Ga0068868_100044144
396 Ga0070660_100154576
397 Ga0070689_100314728
398 Ga0070692_10018228
399 Ga0070668_100039575
400 Ga0070669_100013386
401 Ga0070669_100383603
402 Ga0070675_100020976
403 Ga0070675_100376079
404 Ga0070671_100251978
405 Ga0070673_100012523
406 Ga0070673_100174713
407 Ga0070659_100009845
408 Ga0070709_10181918
409 Ga0070714_100005141
410 Ga0070714_100056684
411 Ga0070713_100228902
412 Ga0070711_100201490
413 Ga0070700_100280650
414 Ga0070663_100131734
415 Ga0070678_100075584
416 Ga0068867_100064389
417 Ga0068867_100156950
418 Ga0070685_10010667
419 Ga0070707_100025356
420 Ga0070698_100170192
421 Ga0070684_100000882
422 Ga0068853_100013133
423 Ga0068853_100043479
424 Ga0070672_100067684
425 Ga0070672_100580085
426 Ga0070704_100046186
427 Ga0068855_100250425
428 Ga0070664_100033324
429 Ga0068857_100224039
430 Ga0068857_100422595
431 Ga0068854_100009845
432 Ga0068856_100407993
433 Ga0068856_100871922
434 Ga0068852_100061370
435 Ga0068859_100395035
436 Ga0068859_101079790
437 Ga0068864_100054863
438 Ga0068866_10177671
439 Ga0068861_100459445
440 Ga0068851_10004997
441 Ga0068870_10036376
442 Ga0068870_10341776
443 Ga0068863_100984768
444 Ga0068862_100086436
445 Ga0081455_10007592
446 Ga0081455_10105904
447 Ga0081538_10022939
448 Ga0081538_10062677
449 Ga0081539_10100720
450 Ga0075365_10029144
451 Ga0075365_10031118
452 Ga0075365_10057574
453 Ga0075363_100012620
454 Ga0075363_100036518
455 Ga0075363_100088329
456 Ga0075364_10003158
457 Ga0075364_10022293
458 Ga0075432_10117749
459 Ga0075362_10000157
460 Ga0075367_10001613
461 Ga0075367_10141282
462 Ga0075369_10000069
463 Ga0075369_10127521
464 Ga0097621_100311927
465 Ga0075370_10002506
466 Ga0075428_100038451
467 Ga0075428_100065639
468 Ga0075428_100069667
469 Ga0075428_100145433
470 Ga0075428_100193408
471 Ga0075430_100031408
472 Ga0075430_100041137
473 Ga0075431_100068500
474 Ga0075431_100070341
475 Ga0075431_100480356
476 Ga0075433_10024497
477 Ga0075434_100101867
478 Ga0075429_100137127
479 Ga0075436_100096289
480 Ga0097620_100395040
481 Ga0097620_101079831
482 Ga0075435_100025955
483 Ga0105240_10074965
484 Ga0105240_11093435
485 Ga0111539_10036741
486 Ga0111539_10329572
487 Ga0111539_10429965
488 Ga0111539_10459886
489 Ga0105245_10038840
490 Ga0105247_10007267
491 Ga0114129_10029392
492 Ga0114129_10091606
493 Ga0114129_10342674
494 Ga0114129_10408971
495 Ga0114129_10539979
496 Ga0114129_11155494
497 Ga0105243_10246312
498 Ga0105241_10033861
499 Ga0105241_10047833
500 Ga0105242_10005240
501 Ga0105249_10177653
502 Ga0105249_10376179
503 Ga0105239_10317027
504 Ga0105246_10632417
505 Ga0105246_10777471
506 Ga0157373_10001823
507 Ga0157373_10021979
508 Ga0157371_10000660
509 Ga0157371_10035660
510 Ga0157378_10295296
511 Ga0163162_11022886
512 Ga0157372_10388842
513 Ga0157380_10231232
514 Ga0157380_10400562
515 Ga0157379_10426671
516 Ga0163161_10166762
517 Ga0206356_10859539
518 Ga0206353_10097257
519 Ga0213875_10002202
520 Ga0213875_10231906
521 Ga0209563_105814
522 Ga0209564_1000204
523 Ga0209758_1025268
524 Ga0207426_1007133
525 Ga0207682_10008979
526 Ga0207642_10238974
527 Ga0207680_10297246
528 Ga0207699_10144091
529 Ga0207645_10202670
530 Ga0207643_10084534
531 Ga0207643_10138289
532 Ga0207654_10016535
533 Ga0207707_10735230
534 Ga0207695_10021512
535 Ga0207663_10350450
536 Ga0207660_10051456
537 Ga0207662_10013612
538 Ga0207657_10008164
539 Ga0207649_10058098
540 Ga0207649_10565122
541 Ga0207652_10181371
542 Ga0207646_10868813
543 Ga0207681_10003538
544 Ga0207681_10043711
545 Ga0207681_10201443
546 Ga0207694_10047509
547 Ga0207694_10096698
548 Ga0207650_10141095
549 Ga0207664_10021723
550 Ga0207706_10128332
551 Ga0207686_10029963
552 Ga0207709_10093616
553 Ga0207670_10189559
554 Ga0207704_10123653
555 Ga0207691_10015733
556 Ga0207691_10245124
557 Ga0207661_10000041
558 Ga0207679_10049028
559 Ga0207679_10055711
560 Ga0207667_10016950
561 Ga0207712_10096706
562 Ga0207668_10223588
563 Ga0207668_10302284
564 Ga0207668_10464641
565 Ga0207658_10649094
566 Ga0207677_10397752
567 Ga0207703_10210095
568 Ga0207703_10343385
569 Ga0207703_10658999
570 Ga0207639_10107932
571 Ga0207678_10007560
572 Ga0207678_10857637
573 Ga0207702_10094921
574 Ga0207641_10949411
575 Ga0207648_10013613
576 Ga0207648_10163771
577 Ga0207676_10034010
578 Ga0207674_10012653
579 Ga0207674_10013848
580 Ga0207675_100115617
581 Ga0207683_10059697
582 Ga0207698_10746401
583 Ga0207428_10062848
584 Ga0268265_10189093
585 Ga0268265_10289925
586 Ga0268264_10283927
587 Ga0268264_10450887
588 Ga0265325_10061369
589 Ga0265340_10123285
590 Ga0265339_10095934
591 Ga0265331_10079356
592 Ga0307408_100295857
593 Ga0307409_100004914
594 Ga0307416_100028063
595 Ga0307510_10000928
596 Ga0373948_0010658
597 Ga0373958_0006918
598 Ga0373938_0014275
599 Ga0373929_0028188
600 Ga0373940_0028007
601 Ga0373949_0003793
602 Ga0373949_0037137
603 Ga0373932_0024742
604 Ga0373939_0009746
605 Ga0373939_0023689
606 Ga0373941_0036435
607 Ga0373960_0045747
608 Ga0373961_0007335
609 Ga0373931_0001748
610 Ga0373931_0008351
611 Ga0316584_0034140
612 Ga0373925_0311878
613 Ga0395899_0149861
614 Ga0395900_0121386
615 Ga0395900_0476303
616 Ga0395898_0106754
617 Ga0395898_0438345
618 Ga0395905_0101226
619 Ga0395905_0140680
620 Ga0436364_0246265
621 Ga0436364_1055139
622 Ga0395901_0226075
623 Ga0395901_0893058
624 Ga0400483_194569
625 Ga0400489_63543
626 Ga0436360_0834330
627 Ga0436361_0107608
628 Ga0436363_0997913
629 Ga0451837_1064323
630 Ga0439432_049733
631 Ga0439446_0009143
632 Ga0439459_0036758
633 Ga0451577_0002082
634 Ga0453684_0018700
635 Ga0453684_0213976
636 Ga0466957_0069968
637 Ga0451576_0004443
638 Ga0495650_0111894
639 Ga0495606_0102509
640 Ga0495621_0011895
641 Ga0495668_0112270
642 Ga0495672_0001179
643 Ga0495676_0085641
644 Ga0495687_006656
645 Ga0496108_0543630
646 Ga0496110_0036314
647 Ga0496114_0119370
648 Ga0496115_0101440
649 Ga0496117_0249087
650 Ga0496120_0212582
651 Ga0496121_0108103
652 Ga0496122_0000450
653 Ga0496122_0025009
654 Ga0496123_0000176
655 Ga0496123_0016869
656 Ga0496124_0011214
657 Ga0496124_0138333
658 Ga0496126_0004109
659 Ga0496126_0036025
660 Ga0496126_0405801
661 Ga0501031_0031237
662 Ga0501032_0099227
663 Ga0501033_0094542
664 Ga0501033_0121186
665 Ga0501033_0153182
666 Ga0501034_0022761
667 Ga0501034_0287181
668 Ga0501036_0105998
669 Ga0501036_0164176
670 Ga0501037_0047377
671 Ga0501037_0259430
672 Ga0501038_0111874
673 Ga0501038_0168694
674 Ga0501038_0314045
675 Ga0501039_0478426
676 Ga0501040_0000145
677 Ga0501040_0109252
678 Ga0501040_0353199
679 Ga0501042_0001811
680 Ga0501042_0028061
681 Ga0501042_0423881
682 Ga0501043_0042632
683 Ga0501046_0158863
684 Ga0501046_0355029
685 Ga0501047_0159418
686 Ga0501047_0220227
687 Ga0501047_0422657
688 Ga0501048_0073605
689 Ga0501068_0039330
690 Ga0501069_0259293
691 Ga0501070_0159812
692 Ga0501070_0689473
693 Ga0501071_0574275
694 Ga0501072_0014348
695 Ga0501072_0161115
696 Ga0501072_0189571
697 Ga0501075_0051632
698 Ga0501075_0309043
699 Ga0501076_0027388
700 Ga0501080_0513747
701 Ga0501083_0010444
702 Ga0501083_0032426
703 Ga0501035_0061749
704 Ga0501035_0290290
705 Ga0501044_0023767
706 Ga0501044_0255098
707 Ga0501044_0410534
708 Ga0501044_0430409
709 Ga0501045_0026665
710 Ga0501045_0056146
711 nmdc:mga03683_250028_c1
712 nmdc:mga03683_38177_c1
713 nmdc:mga03683_3949_c1
714 nmdc:mga03n38_80179_c1
715 nmdc:mga00v17_212773_c1
716 nmdc:mga00v17_24_c1
717 nmdc:mga0yw44_174_c1
718 nmdc:mga0yw44_6517_c1
719 nmdc:mga0yw44_8126_c1
720 nmdc:mga06z11_2820_c1
721 nmdc:mga07m45_4353_c1
722 nmdc:mga05p37_1165878_c1
723 nmdc:mga05p37_397954_c1
724 nmdc:mga09592_101585_c1
725 nmdc:mga09592_223596_c1
726 nmdc:mga09592_80469_c1
727 nmdc:mga0qj67_270216_c1
728 nmdc:mga0qj67_425472_c1
729 nmdc:mga0qj67_90804_c1
730 nmdc:mga06r32_234330_c1
731 nmdc:mga06r32_34086_c1
732 nmdc:mga06r32_35183_c1
733 nmdc:mga06r32_551995_c1
734 nmdc:mga06r32_83440_c1
735 nmdc:mga08y16_212885_c1
736 nmdc:mga08y16_77077_c1
737 nmdc:mga0n895_6579_c1
738 nmdc:mga08x19_63215_c1
739 nmdc:mga0a205_27279_c1
740 nmdc:mga0a205_6039_c1
741 nmdc:mga0sz30_14156_c1
742 Ga0500559_0001223
743 Ga0500561_0003466
744 Ga0500616_0000270
745 Ga0500622_0069090
746 Ga0500645_007986
747 Ga0501082_0000002
748 Ga0501082_0128280
749 Ga0501082_0203247
750 Ga0501082_0487621
751 Ga0530510_0044547
752 Ga0530510_0114709
753 2501074448
754 2501413432
755 2511101805
756 2511106215
757 2554249632
758 2643867596
759 2643990517
760 2644294968
761 2644519921
762 2644648861
763 2842720261
764 2842748503
765 2894026642
766 2895516017
767 2899846124
768 2926765428
769 2974322760
770 643598003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

48

192

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9368 2 234
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9291 2 234
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9194 1 231
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9152 1 220
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9131 1 220
ID Description Score Start End Superfamily
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9672 3 226 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9514 2 233 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9395 2 233 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9228 3 226 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9186 19 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0Q3I2C7-F1-model_v4 ABC transporter ATP-binding protein 0.9874 1 234 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A0Q3I2C7-F1-model_v4 ABC transporter ATP-binding protein 0.9833 1 234 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1G6KYC7-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 2, HAAT family (TC 3.A.1.4.-) 0.9815 2 209 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A5J4F9B5-F1-model_v4 High-affinity branched-chain amino acid transport ATP-binding protein LivF 0.9746 1 234 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-T2J0G5-F1-model_v4 Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1) 0.9738 1 234 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Map