F430289

General Info

Members Datasets Scaffolds Average Seq Length
385 240 770 331

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0000829|Ga0495630_0000829_20280_21404
Length 374
Sequence VARIRLVAALHTARGNILQVRYDGFFEVCPETFLNREEKQFMSHHYSGPDFGFPHGDARLDLTDLYAFPKPGDASKSILIMNVHPSVGVNPPGSTTEQAFATDAIYELRIDTNGDAIADIAYRVRFSPSQGGTQTATVRRVEGEQAAGMGDDGQGIIEGAPVSAGSDAKITEAGDYRFFAGWRSDPFFFDVEGALNNLQFTGHDAFADYDVCSIVLEVPNSVLGSNKLGLWARTVDGATGKWVQADRGARPNQTPFLAGEQNAAYLAAEPADDARFIPVFAHALEHTGGYTSSEATLVATTLLPDILHYDPTRPAFFPKNGRALADDVVDFFLPLLTNGKVKQDNVGPHKDLLSEFPYLGAPHVSRQAKLGAGA

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
158 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
239 2739367700 Dyella sp. YR388 Isolate Unclassified
240 2928963466 Dyella japonica 1073 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 1.82
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0
Rhizoplane 8.57
Rhizosphere 88.31
Stem 0
Stem Tuber 0
Unclassified 15.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0000829 3300046517 Bacteria 21787
2 MBSR1b_contig_13840370 2162886012 Unclassified 1063
3 JGI25162J39368_1007885 3300002737 Unclassified 1592
4 Ga0055542_1000189 3300003762 Bacteria 75158
5 Ga0058862_11818722 3300004803 Bacteria 1266
6 Ga0058862_12712774 3300004803 Unclassified 1659
7 Ga0070658_10081657 3300005327 Bacteria 2655
8 Ga0070676_10189646 3300005328 Unclassified 1341
9 Ga0070683_100006761 3300005329 Bacteria 9634
10 Ga0070683_100117673 3300005329 Unclassified 2509
11 Ga0070690_100041761 3300005330 Bacteria 2904
12 Ga0070670_100125482 3300005331 Bacteria 2215
13 Ga0068869_100115878 3300005334 Unclassified 2044
14 Ga0070666_10077685 3300005335 Bacteria 2265
15 Ga0070680_100052538 3300005336 Bacteria 3325
16 Ga0070680_100087431 3300005336 Bacteria 2578
17 Ga0070680_100492575 3300005336 Bacteria 1048
18 Ga0068868_100025692 3300005338 Bacteria 4483
19 Ga0068868_100064729 3300005338 Bacteria 2903
20 Ga0068868_100065103 3300005338 Plasmid 2895
21 Ga0070687_100014813 3300005343 Bacteria 3512
22 Ga0070661_100445719 3300005344 Unclassified 1029
23 Ga0070692_10185000 3300005345 Unclassified 1210
24 Ga0070669_100062485 3300005353 Bacteria 2738
25 Ga0070671_100461423 3300005355 Unclassified 1090
26 Ga0070674_100045355 3300005356 Bacteria 3004
27 Ga0070674_100220147 3300005356 Bacteria 1476
28 Ga0070659_100033391 3300005366 Plasmid 3996
29 Ga0070709_10003156 3300005434 Bacteria 8839
30 Ga0070714_100018909 3300005435 Bacteria 5605
31 Ga0070714_100231335 3300005435 Unclassified 1703
32 Ga0070713_100000421 3300005436 Bacteria 27054
33 Ga0070713_100009215 3300005436 Bacteria 7047
34 Ga0070713_100292339 3300005436 Unclassified 1498
35 Ga0070711_100000693 3300005439 Bacteria 17683
36 Ga0070700_100019942 3300005441 Bacteria 3876
37 Ga0070663_100129160 3300005455 Bacteria 1917
38 Ga0070663_100391974 3300005455 Bacteria 1133
39 Ga0070662_100182169 3300005457 Bacteria 1656
40 Ga0070681_10018281 3300005458 Bacteria 7006
41 Ga0070681_10141884 3300005458 Bacteria 2332
42 Ga0070685_10016557 3300005466 Bacteria 3930
43 Ga0070707_100031415 3300005468 Bacteria 5059
44 Ga0070679_100000899 3300005530 Bacteria 25811
45 Ga0070679_100002957 3300005530 Bacteria 15489
46 Ga0070684_100009359 3300005535 Bacteria 7713
47 Ga0070684_100078227 3300005535 Bacteria 2922
48 Ga0070697_100354433 3300005536 Bacteria 1268
49 Ga0068853_100127530 3300005539 Bacteria 2274
50 Ga0070686_100019706 3300005544 Bacteria 3979
51 Ga0068855_100143044 3300005563 Bacteria 2724
52 Ga0070664_100250190 3300005564 Bacteria 1593
53 Ga0068857_100020379 3300005577 Bacteria 5831
54 Ga0068856_100365779 3300005614 Bacteria 1461
55 Ga0070702_100021399 3300005615 Bacteria 3403
56 Ga0070702_100122056 3300005615 Bacteria 1633
57 Ga0068852_100019978 3300005616 Bacteria 5318
58 Ga0068859_100106344 3300005617 Bacteria 2865
59 Ga0068864_100019576 3300005618 Bacteria 5662
60 Ga0068864_100546895 3300005618 Bacteria 1119
61 Ga0068866_10060275 3300005718 Unclassified 1966
62 Ga0068861_100067943 3300005719 Bacteria 2753
63 Ga0068851_10007301 3300005834 Bacteria 5069
64 Ga0068851_10215871 3300005834 Bacteria 1076
65 Ga0068870_10002334 3300005840 Bacteria 7894
66 Ga0068863_100062626 3300005841 Bacteria 3518
67 Ga0068863_100065912 3300005841 Bacteria 3427
68 Ga0068858_100199089 3300005842 Bacteria 1894
69 Ga0068862_100114835 3300005844 Bacteria 2367
70 Ga0070717_10000618 3300006028 Bacteria 22826
71 Ga0070717_10088328 3300006028 Bacteria 2612
72 Ga0070715_10006331 3300006163 Bacteria 4018
73 Ga0070715_10074732 3300006163 Unclassified 1523
74 Ga0070716_100002556 3300006173 Bacteria 8413
75 Ga0070716_100066972 3300006173 Bacteria 2096
76 Ga0070716_100128705 3300006173 Bacteria 1597
77 Ga0070712_100002993 3300006175 Bacteria 10458
78 Ga0070712_100011608 3300006175 Bacteria 5593
79 Ga0070712_100063824 3300006175 Bacteria 2609
80 Ga0070712_100070503 3300006175 Bacteria 2497
81 Ga0070712_100140486 3300006175 Bacteria 1842
82 Ga0097621_100003510 3300006237 Bacteria 10824
83 Ga0097621_100008042 3300006237 Bacteria 7571
84 Ga0097621_100139613 3300006237 Bacteria 2070
85 Ga0097621_100169639 3300006237 Bacteria 1880
86 Ga0097621_100200457 3300006237 Bacteria 1732
87 Ga0097621_100212048 3300006237 Bacteria 1685
88 Ga0068871_100004536 3300006358 Bacteria 9681
89 Ga0068871_100007904 3300006358 Bacteria 7625
90 Ga0068871_100287254 3300006358 Bacteria 1440
91 Ga0075430_100072482 3300006846 Bacteria 2889
92 Ga0075431_100241081 3300006847 Bacteria 1839
93 Ga0075433_10031559 3300006852 Bacteria 4529
94 Ga0075434_100152321 3300006871 Bacteria 2332
95 Ga0075434_100403735 3300006871 Bacteria 1387
96 Ga0075434_100530143 3300006871 Bacteria 1198
97 Ga0075429_100029341 3300006880 Bacteria 4778
98 Ga0068865_100024331 3300006881 Bacteria 3972
99 Ga0075436_100142175 3300006914 Bacteria 1687
100 Ga0075436_100178717 3300006914 Bacteria 1499
101 Ga0097620_100106346 3300006931 Bacteria 2865
102 Ga0075435_100163954 3300007076 Bacteria 1873
103 Ga0099794_10008026 3300007265 Bacteria 4368
104 Ga0099795_10000963 3300007788 Bacteria 5848
105 Ga0099795_10029763 3300007788 Unclassified 1868
106 Ga0105251_10081494 3300009011 Bacteria 1495
107 Ga0111539_10061827 3300009094 Bacteria 4436
108 Ga0111539_10086473 3300009094 Bacteria 3684
109 Ga0111539_10206794 3300009094 Bacteria 2288
110 Ga0105245_10267814 3300009098 Unclassified 1665
111 Ga0105247_10008962 3300009101 Bacteria 6097
112 Ga0105247_10022183 3300009101 Unclassified 3822
113 Ga0105247_10110078 3300009101 Bacteria 1772
114 Ga0114129_10103138 3300009147 Bacteria 3944
115 Ga0114129_10406660 3300009147 Unclassified 1793
116 Ga0114129_10469294 3300009147 Bacteria 1648
117 Ga0105248_10022244 3300009177 Bacteria 7030
118 Ga0105248_10153462 3300009177 Unclassified 2598
119 Ga0105237_10018997 3300009545 Bacteria 7103
120 Ga0105237_10170662 3300009545 Bacteria 2175
121 Ga0105238_10112868 3300009551 Bacteria 2697
122 Ga0105249_10040124 3300009553 Bacteria 4251
123 Ga0099796_10008257 3300010159 Bacteria 2768
124 Ga0105239_10182741 3300010375 Bacteria 2346
125 Ga0105239_10467380 3300010375 Bacteria 1432
126 Ga0157373_10042089 3300013100 Bacteria 3265
127 Ga0157371_10104729 3300013102 Bacteria 2007
128 Ga0157374_10043056 3300013296 Bacteria 4169
129 Ga0157374_10050511 3300013296 Unclassified 3866
130 Ga0157374_10157685 3300013296 Unclassified 2210
131 Ga0157378_10004304 3300013297 Bacteria 12537
132 Ga0163162_10002560 3300013306 Bacteria 17209
133 Ga0163162_10224924 3300013306 Bacteria 2006
134 Ga0157372_10014170 3300013307 Bacteria 8518
135 Ga0157372_10062612 3300013307 Unclassified 4169
136 Ga0157372_10531509 3300013307 Bacteria 1371
137 Ga0157375_10005743 3300013308 Bacteria 10793
138 Ga0157375_10675724 3300013308 Unclassified 1187
139 Ga0163163_10026918 3300014325 Bacteria 5502
140 Ga0163163_10053888 3300014325 Bacteria 3972
141 Ga0157380_10100402 3300014326 Bacteria 2409
142 Ga0157377_10009005 3300014745 Plasmid 4886
143 Ga0157376_10058608 3300014969 Bacteria 3226
144 Ga0157376_10128430 3300014969 Bacteria 2258
145 Ga0163161_10055455 3300017792 Bacteria 2877
146 Ga0163161_10141843 3300017792 Bacteria 1820
147 Ga0206349_1714155 3300020075 Unclassified 1101
148 Ga0213872_10007615 3300021361 Bacteria 5309
149 Ga0213872_10029201 3300021361 Bacteria 2528
150 Ga0213872_10091523 3300021361 Bacteria 1361
151 Ga0213871_10000001 3300021441 Bacteria 27505
152 Ga0213871_10022656 3300021441 Unclassified 1576
153 Ga0213871_10037292 3300021441 Bacteria 1293
154 Ga0209672_101637 3300025228 Bacteria 7361
155 Ga0209437_100228 3300025233 Bacteria 98265
156 Ga0209026_1001226 3300025250 Bacteria 11796
157 Ga0209148_1000005 3300025254 Bacteria 1806504
158 Ga0207688_10030501 3300025901 Bacteria 2973
159 Ga0207680_10233312 3300025903 Bacteria 1265
160 Ga0207647_10011898 3300025904 Bacteria 6079
161 Ga0207699_10004867 3300025906 Bacteria 6429
162 Ga0207645_10020674 3300025907 Unclassified 4304
163 Ga0207643_10005960 3300025908 Bacteria 6512
164 Ga0207705_10095207 3300025909 Bacteria 2185
165 Ga0207707_10026780 3300025912 Bacteria 5039
166 Ga0207707_10049868 3300025912 Unclassified 3647
167 Ga0207671_10073077 3300025914 Plasmid 2561
168 Ga0207671_10311093 3300025914 Bacteria 1245
169 Ga0207693_10000010 3300025915 Bacteria 162031
170 Ga0207693_10083378 3300025915 Unclassified 2504
171 Ga0207693_10083694 3300025915 Unclassified 2499
172 Ga0207663_10001761 3300025916 Bacteria 10209
173 Ga0207663_10088944 3300025916 Bacteria 2044
174 Ga0207660_10185770 3300025917 Bacteria 1617
175 Ga0207660_10196556 3300025917 Bacteria 1573
176 Ga0207662_10023776 3300025918 Bacteria 3523
177 Ga0207657_10014446 3300025919 Bacteria 7710
178 Ga0207649_10001007 3300025920 Bacteria 17408
179 Ga0207652_10025580 3300025921 Bacteria 4908
180 Ga0207652_10043850 3300025921 Bacteria 3809
181 Ga0207646_10017282 3300025922 Bacteria 6754
182 Ga0207694_10077799 3300025924 Bacteria 2600
183 Ga0207650_10000053 3300025925 Bacteria 164599
184 Ga0207700_10000187 3300025928 Bacteria 37186
185 Ga0207700_10054599 3300025928 Bacteria 3000
186 Ga0207700_10250530 3300025928 Bacteria 1513
187 Ga0207700_10357634 3300025928 Bacteria 1272
188 Ga0207664_10023081 3300025929 Bacteria 4656
189 Ga0207664_10333353 3300025929 Unclassified 1340
190 Ga0207644_10363336 3300025931 Unclassified 1178
191 Ga0207690_10169782 3300025932 Bacteria 1633
192 Ga0207706_10019744 3300025933 Bacteria 6061
193 Ga0207670_10021047 3300025936 Bacteria 4017
194 Ga0207669_10185286 3300025937 Bacteria 1496
195 Ga0207704_10007469 3300025938 Bacteria 5168
196 Ga0207704_10413719 3300025938 Unclassified 1067
197 Ga0207665_10004553 3300025939 Bacteria 9200
198 Ga0207665_10058332 3300025939 Bacteria 2610
199 Ga0207665_10128834 3300025939 Bacteria 1794
200 Ga0207691_10007527 3300025940 Bacteria 10482
201 Ga0207711_10019715 3300025941 Bacteria 5617
202 Ga0207711_10042900 3300025941 Unclassified 3856
203 Ga0207711_10128423 3300025941 Bacteria 2270
204 Ga0207689_10054990 3300025942 Bacteria 3277
205 Ga0207689_10154314 3300025942 Bacteria 1893
206 Ga0207661_10001423 3300025944 Bacteria 16125
207 Ga0207661_10156428 3300025944 Bacteria 1975
208 Ga0207679_10005370 3300025945 Bacteria 8031
209 Ga0207667_10095314 3300025949 Bacteria 3072
210 Ga0207651_10101878 3300025960 Bacteria 2132
211 Ga0207712_10304171 3300025961 Bacteria 1310
212 Ga0207668_10367208 3300025972 Bacteria 1208
213 Ga0207640_10005194 3300025981 Bacteria 7083
214 Ga0207640_10032595 3300025981 Bacteria 3232
215 Ga0207640_10424221 3300025981 Unclassified 1089
216 Ga0207658_10055624 3300025986 Bacteria 2933
217 Ga0207677_10088377 3300026023 Bacteria 2246
218 Ga0207703_10101525 3300026035 Bacteria 2439
219 Ga0207639_10024665 3300026041 Unclassified 4355
220 Ga0207678_10000840 3300026067 Bacteria 28166
221 Ga0207678_10153054 3300026067 Bacteria 1969
222 Ga0207702_10544565 3300026078 Unclassified 1135
223 Ga0207641_10000104 3300026088 Bacteria 122307
224 Ga0207641_10075172 3300026088 Bacteria 2917
225 Ga0207648_10012547 3300026089 Bacteria 7928
226 Ga0207648_10024816 3300026089 Bacteria 5347
227 Ga0207676_10036036 3300026095 Unclassified 3760
228 Ga0207676_10400782 3300026095 Bacteria 1282
229 Ga0207674_10001318 3300026116 Bacteria 32302
230 Ga0207674_10003737 3300026116 Bacteria 18571
231 Ga0207675_100011901 3300026118 Bacteria 8130
232 Ga0207675_100096446 3300026118 Bacteria 2784
233 Ga0207683_10039164 3300026121 Bacteria 4135
234 Ga0207698_10020058 3300026142 Bacteria 4593
235 Ga0207428_10040617 3300027907 Bacteria 3771
236 Ga0265355_1000173 3300028036 Unclassified 2765
237 Ga0268266_10013029 3300028379 Bacteria 7168
238 Ga0268266_10025365 3300028379 Bacteria 5043
239 Ga0268265_10033603 3300028380 Plasmid 3730
240 Ga0268264_10121419 3300028381 Bacteria 2303
241 Ga0268264_10279032 3300028381 Bacteria 1564
242 Ga0265336_10027020 3300028666 Bacteria 1800
243 Ga0265338_10004478 3300028800 Bacteria 18845
244 Ga0265338_10007071 3300028800 Bacteria 14072
245 Ga0265338_10027016 3300028800 Bacteria 5772
246 Ga0265338_10035204 3300028800 Unclassified 4820
247 Ga0265324_10005750 3300029957 Bacteria 5283
248 Ga0265760_10000006 3300031090 Bacteria 143747
249 Ga0265760_10000188 3300031090 Bacteria 16203
250 Ga0265760_10003409 3300031090 Unclassified 4621
251 Ga0265760_10022745 3300031090 Unclassified 1818
252 Ga0265332_10046583 3300031238 Bacteria 1867
253 Ga0265320_10000836 3300031240 Bacteria 23203
254 Ga0265325_10012699 3300031241 Bacteria 4811
255 Ga0265339_10003367 3300031249 Bacteria 11188
256 Ga0265331_10002192 3300031250 Bacteria 13408
257 Ga0265316_10001372 3300031344 Bacteria 26246
258 Ga0265316_10043564 3300031344 Bacteria 3576
259 Ga0265314_10077454 3300031711 Bacteria 2205
260 Ga0307409_100029126 3300031995 Bacteria 3947
261 Ga0373934_0090063 3300035086 Unclassified 1236
262 Ga0373945_0055203 3300035116 Bacteria 1470
263 Ga0373943_0018941 3300035170 Bacteria 3165
264 Ga0373931_0094556 3300035691 Bacteria 1671
265 Ga0373931_0148774 3300035691 Bacteria 1363
266 Ga0373935_0000751 3300035692 Bacteria 17246
267 Ga0373927_0019951 3300035695 Bacteria 4396
268 Ga0373927_0158001 3300035695 Bacteria 1485
269 Ga0373933_0094254 3300035724 Bacteria 1851
270 Ga0373947_0010651 3300035725 Bacteria 5277
271 Ga0373947_0016367 3300035725 Bacteria 4262
272 Ga0373947_0233127 3300035725 Bacteria 1213
273 Ga0373937_0315996 3300036401 Bacteria 1478
274 Ga0373925_0015422 3300037068 Bacteria 5525
275 Ga0373925_0034421 3300037068 Bacteria 3733
276 Ga0395900_0002342 3300037418 Bacteria 20977
277 Ga0395898_0067846 3300037466 Bacteria 3452
278 Ga0395905_0040415 3300037471 Bacteria 4375
279 Ga0395901_0009209 3300038443 Bacteria 10002
280 Ga0436360_0095845 3300039438 Unclassified 3990
281 Ga0436360_0169122 3300039438 Bacteria 3705
282 Ga0436360_0339996 3300039438 Bacteria 29371
283 Ga0436360_0715365 3300039438 Bacteria 10253
284 Ga0436360_0763377 3300039438 Bacteria 1960
285 Ga0436360_0768361 3300039438 Bacteria 1684
286 Ga0436360_0851767 3300039438 Bacteria 5049
287 Ga0436361_0104968 3300039447 Bacteria 10983
288 Ga0436361_0555528 3300039447 Bacteria 2025
289 Ga0436361_0561416 3300039447 Bacteria 1932
290 Ga0436361_0565313 3300039447 Bacteria 61483
291 Ga0436361_0607397 3300039447 Bacteria 7180
292 Ga0436361_1218554 3300039447 Bacteria 10771
293 Ga0436363_0211820 3300039450 Unclassified 3751
294 Ga0436362_0390427 3300039453 Bacteria 9812
295 Ga0436362_0544888 3300039453 Bacteria 9972
296 Ga0466964_0070577 3300044706 Bacteria 1476
297 Ga0466960_0025877 3300044901 Bacteria 2660
298 Ga0495603_0012372 3300046455 Bacteria 5167
299 Ga0495629_0030004 3300046459 Bacteria 3855
300 Ga0495629_0107673 3300046459 Unclassified 1944
301 Ga0495638_0000009 3300046460 Bacteria 525345
302 Ga0495641_0059463 3300046461 Unclassified 1728
303 Ga0495641_0137423 3300046461 Bacteria 1091
304 Ga0495651_0016829 3300046462 Bacteria 5663
305 Ga0495580_0000285 3300046472 Bacteria 41012
306 Ga0495582_0003066 3300046473 Bacteria 9364
307 Ga0495582_0095078 3300046473 Bacteria 1664
308 Ga0495594_0130377 3300046499 Unclassified 1424
309 Ga0495606_0000159 3300046507 Bacteria 118613
310 Ga0495618_0157251 3300046514 Bacteria 1450
311 Ga0495652_0075177 3300046529 Unclassified 2807
312 Ga0495665_0143579 3300046531 Unclassified 1247
313 Ga0495645_0145989 3300046543 Unclassified 1648
314 Ga0495625_0009273 3300046660 Bacteria 8253
315 Ga0495625_0133127 3300046660 Bacteria 1683
316 Ga0495588_0039517 3300046674 Bacteria 2404
317 Ga0495647_0025614 3300046681 Unclassified 2156
318 Ga0495624_0141077 3300046690 Unclassified 1476
319 Ga0495649_0016751 3300046694 Bacteria 4150
320 Ga0495674_0102703 3300047319 Unclassified 2431
321 Ga0495680_0249925 3300047322 Bacteria 1257
322 Ga0495675_0066341 3300047444 Bacteria 2281
323 Ga0495593_0133973 3300047673 Unclassified 1257
324 Ga0495602_0028672 3300048088 Bacteria 5322
325 Ga0496100_0214734 3300048903 Bacteria 1409
326 Ga0496101_0177904 3300048904 Bacteria 1637
327 Ga0496102_0005390 3300048905 Bacteria 10862
328 Ga0496102_0075407 3300048905 Bacteria 3101
329 Ga0496102_0393974 3300048905 Bacteria 1302
330 Ga0496103_0167858 3300048906 Bacteria 1408
331 Ga0496103_0168693 3300048906 Bacteria 1405
332 Ga0496103_0244723 3300048906 Bacteria 1154
333 Ga0496104_0030360 3300048907 Bacteria 5022
334 Ga0496104_0128490 3300048907 Unclassified 2434
335 Ga0496106_0037904 3300048909 Bacteria 3607
336 Ga0496107_0068216 3300048910 Bacteria 2581
337 Ga0496107_0326356 3300048910 Bacteria 1142
338 Ga0496108_0001608 3300048911 Bacteria 17892
339 Ga0496108_0103579 3300048911 Bacteria 2428
340 Ga0496108_0222937 3300048911 Bacteria 1638
341 Ga0496109_0000270 3300048912 Bacteria 49971
342 Ga0496110_0005512 3300048913 Bacteria 9933
343 Ga0496111_0001788 3300048914 Bacteria 12603
344 Ga0496112_0000121 3300048915 Bacteria 48786
345 Ga0496112_0041779 3300048915 Unclassified 4487
346 Ga0496112_0170640 3300048915 Bacteria 2140
347 Ga0496112_0298996 3300048915 Bacteria 1555
348 Ga0496112_0558807 3300048915 Bacteria 1078
349 Ga0496113_0000602 3300048916 Bacteria 17938
350 Ga0496113_0216283 3300048916 Bacteria 1526
351 Ga0496114_0093625 3300048917 Bacteria 2555
352 Ga0496114_0129995 3300048917 Bacteria 2174
353 Ga0496115_0000013 3300048918 Bacteria 213060
354 Ga0496115_0009919 3300048918 Bacteria 7094
355 Ga0496115_0071928 3300048918 Bacteria 2805
356 Ga0496115_0269642 3300048918 Bacteria 1399
357 Ga0496115_0295916 3300048918 Bacteria 1327
358 Ga0496126_0103324 3300048929 Bacteria 2490
359 nmdc:mga05p37_103339_c1 3300050507 Bacteria 3508
360 nmdc:mga05p37_167541_c1 3300050507 Unclassified 2681
361 nmdc:mga05p37_179969_c1 3300050507 Bacteria 2573
362 nmdc:mga05p37_314217_c1 3300050507 Bacteria 1856
363 nmdc:mga09592_121897_c1 3300050508 Bacteria 2240
364 nmdc:mga06r32_124709_c1 3300050510 Bacteria 2543
365 nmdc:mga08y16_211653_c1 3300050511 Bacteria 2008
366 nmdc:mga08y16_46065_c1 3300050511 Bacteria 4567
367 nmdc:mga08y16_94800_c1 3300050511 Bacteria 3109
368 nmdc:mga0n895_121002_c1 3300050512 Bacteria 2639
369 nmdc:mga0n895_171930_c1 3300050512 Bacteria 2199
370 nmdc:mga0n895_242841_c1 3300050512 Unclassified 1828
371 nmdc:mga0rr50_92903_c1 3300050513 Bacteria 2353
372 nmdc:mga08x19_202992_c1 3300050514 Bacteria 1359
373 nmdc:mga0a205_116135_c1 3300050515 Unclassified 2575
374 nmdc:mga0a205_286762_c1 3300050515 Bacteria 1521
375 nmdc:mga0a205_32231_c1 3300050515 Bacteria 5024
376 nmdc:mga0a205_98875_c1 3300050515 Bacteria 2816
377 Ga0495601_0030418 3300053077 Bacteria 3353
378 Ga0495601_0214604 3300053077 Bacteria 1257
379 Ga0500635_0000043 3300053080 Bacteria 87854
380 Ga0495595_0167044 3300053084 Bacteria 1088
381 Ga0495619_0049133 3300053085 Unclassified 2781
382 Ga0495619_0259152 3300053085 Bacteria 1205
383 Ga0500637_0001374 3300053178 Bacteria 10328
384 2739731305 2739367700 Bacteria 4747630
385 2928967802 2928963466 Bacteria 5165703
386 Ga0495630_0000829
387 MBSR1b_contig_13840370
388 JGI25162J39368_1007885
389 Ga0055542_1000189
390 Ga0058862_11818722
391 Ga0058862_12712774
392 Ga0070658_10081657
393 Ga0070676_10189646
394 Ga0070683_100006761
395 Ga0070683_100117673
396 Ga0070690_100041761
397 Ga0070670_100125482
398 Ga0068869_100115878
399 Ga0070666_10077685
400 Ga0070680_100052538
401 Ga0070680_100087431
402 Ga0070680_100492575
403 Ga0068868_100025692
404 Ga0068868_100064729
405 Ga0068868_100065103
406 Ga0070687_100014813
407 Ga0070661_100445719
408 Ga0070692_10185000
409 Ga0070669_100062485
410 Ga0070671_100461423
411 Ga0070674_100045355
412 Ga0070674_100220147
413 Ga0070659_100033391
414 Ga0070709_10003156
415 Ga0070714_100018909
416 Ga0070714_100231335
417 Ga0070713_100000421
418 Ga0070713_100009215
419 Ga0070713_100292339
420 Ga0070711_100000693
421 Ga0070700_100019942
422 Ga0070663_100129160
423 Ga0070663_100391974
424 Ga0070662_100182169
425 Ga0070681_10018281
426 Ga0070681_10141884
427 Ga0070685_10016557
428 Ga0070707_100031415
429 Ga0070679_100000899
430 Ga0070679_100002957
431 Ga0070684_100009359
432 Ga0070684_100078227
433 Ga0070697_100354433
434 Ga0068853_100127530
435 Ga0070686_100019706
436 Ga0068855_100143044
437 Ga0070664_100250190
438 Ga0068857_100020379
439 Ga0068856_100365779
440 Ga0070702_100021399
441 Ga0070702_100122056
442 Ga0068852_100019978
443 Ga0068859_100106344
444 Ga0068864_100019576
445 Ga0068864_100546895
446 Ga0068866_10060275
447 Ga0068861_100067943
448 Ga0068851_10007301
449 Ga0068851_10215871
450 Ga0068870_10002334
451 Ga0068863_100062626
452 Ga0068863_100065912
453 Ga0068858_100199089
454 Ga0068862_100114835
455 Ga0070717_10000618
456 Ga0070717_10088328
457 Ga0070715_10006331
458 Ga0070715_10074732
459 Ga0070716_100002556
460 Ga0070716_100066972
461 Ga0070716_100128705
462 Ga0070712_100002993
463 Ga0070712_100011608
464 Ga0070712_100063824
465 Ga0070712_100070503
466 Ga0070712_100140486
467 Ga0097621_100003510
468 Ga0097621_100008042
469 Ga0097621_100139613
470 Ga0097621_100169639
471 Ga0097621_100200457
472 Ga0097621_100212048
473 Ga0068871_100004536
474 Ga0068871_100007904
475 Ga0068871_100287254
476 Ga0075430_100072482
477 Ga0075431_100241081
478 Ga0075433_10031559
479 Ga0075434_100152321
480 Ga0075434_100403735
481 Ga0075434_100530143
482 Ga0075429_100029341
483 Ga0068865_100024331
484 Ga0075436_100142175
485 Ga0075436_100178717
486 Ga0097620_100106346
487 Ga0075435_100163954
488 Ga0099794_10008026
489 Ga0099795_10000963
490 Ga0099795_10029763
491 Ga0105251_10081494
492 Ga0111539_10061827
493 Ga0111539_10086473
494 Ga0111539_10206794
495 Ga0105245_10267814
496 Ga0105247_10008962
497 Ga0105247_10022183
498 Ga0105247_10110078
499 Ga0114129_10103138
500 Ga0114129_10406660
501 Ga0114129_10469294
502 Ga0105248_10022244
503 Ga0105248_10153462
504 Ga0105237_10018997
505 Ga0105237_10170662
506 Ga0105238_10112868
507 Ga0105249_10040124
508 Ga0099796_10008257
509 Ga0105239_10182741
510 Ga0105239_10467380
511 Ga0157373_10042089
512 Ga0157371_10104729
513 Ga0157374_10043056
514 Ga0157374_10050511
515 Ga0157374_10157685
516 Ga0157378_10004304
517 Ga0163162_10002560
518 Ga0163162_10224924
519 Ga0157372_10014170
520 Ga0157372_10062612
521 Ga0157372_10531509
522 Ga0157375_10005743
523 Ga0157375_10675724
524 Ga0163163_10026918
525 Ga0163163_10053888
526 Ga0157380_10100402
527 Ga0157377_10009005
528 Ga0157376_10058608
529 Ga0157376_10128430
530 Ga0163161_10055455
531 Ga0163161_10141843
532 Ga0206349_1714155
533 Ga0213872_10007615
534 Ga0213872_10029201
535 Ga0213872_10091523
536 Ga0213871_10000001
537 Ga0213871_10022656
538 Ga0213871_10037292
539 Ga0209672_101637
540 Ga0209437_100228
541 Ga0209026_1001226
542 Ga0209148_1000005
543 Ga0207688_10030501
544 Ga0207680_10233312
545 Ga0207647_10011898
546 Ga0207699_10004867
547 Ga0207645_10020674
548 Ga0207643_10005960
549 Ga0207705_10095207
550 Ga0207707_10026780
551 Ga0207707_10049868
552 Ga0207671_10073077
553 Ga0207671_10311093
554 Ga0207693_10000010
555 Ga0207693_10083378
556 Ga0207693_10083694
557 Ga0207663_10001761
558 Ga0207663_10088944
559 Ga0207660_10185770
560 Ga0207660_10196556
561 Ga0207662_10023776
562 Ga0207657_10014446
563 Ga0207649_10001007
564 Ga0207652_10025580
565 Ga0207652_10043850
566 Ga0207646_10017282
567 Ga0207694_10077799
568 Ga0207650_10000053
569 Ga0207700_10000187
570 Ga0207700_10054599
571 Ga0207700_10250530
572 Ga0207700_10357634
573 Ga0207664_10023081
574 Ga0207664_10333353
575 Ga0207644_10363336
576 Ga0207690_10169782
577 Ga0207706_10019744
578 Ga0207670_10021047
579 Ga0207669_10185286
580 Ga0207704_10007469
581 Ga0207704_10413719
582 Ga0207665_10004553
583 Ga0207665_10058332
584 Ga0207665_10128834
585 Ga0207691_10007527
586 Ga0207711_10019715
587 Ga0207711_10042900
588 Ga0207711_10128423
589 Ga0207689_10054990
590 Ga0207689_10154314
591 Ga0207661_10001423
592 Ga0207661_10156428
593 Ga0207679_10005370
594 Ga0207667_10095314
595 Ga0207651_10101878
596 Ga0207712_10304171
597 Ga0207668_10367208
598 Ga0207640_10005194
599 Ga0207640_10032595
600 Ga0207640_10424221
601 Ga0207658_10055624
602 Ga0207677_10088377
603 Ga0207703_10101525
604 Ga0207639_10024665
605 Ga0207678_10000840
606 Ga0207678_10153054
607 Ga0207702_10544565
608 Ga0207641_10000104
609 Ga0207641_10075172
610 Ga0207648_10012547
611 Ga0207648_10024816
612 Ga0207676_10036036
613 Ga0207676_10400782
614 Ga0207674_10001318
615 Ga0207674_10003737
616 Ga0207675_100011901
617 Ga0207675_100096446
618 Ga0207683_10039164
619 Ga0207698_10020058
620 Ga0207428_10040617
621 Ga0265355_1000173
622 Ga0268266_10013029
623 Ga0268266_10025365
624 Ga0268265_10033603
625 Ga0268264_10121419
626 Ga0268264_10279032
627 Ga0265336_10027020
628 Ga0265338_10004478
629 Ga0265338_10007071
630 Ga0265338_10027016
631 Ga0265338_10035204
632 Ga0265324_10005750
633 Ga0265760_10000006
634 Ga0265760_10000188
635 Ga0265760_10003409
636 Ga0265760_10022745
637 Ga0265332_10046583
638 Ga0265320_10000836
639 Ga0265325_10012699
640 Ga0265339_10003367
641 Ga0265331_10002192
642 Ga0265316_10001372
643 Ga0265316_10043564
644 Ga0265314_10077454
645 Ga0307409_100029126
646 Ga0373934_0090063
647 Ga0373945_0055203
648 Ga0373943_0018941
649 Ga0373931_0094556
650 Ga0373931_0148774
651 Ga0373935_0000751
652 Ga0373927_0019951
653 Ga0373927_0158001
654 Ga0373933_0094254
655 Ga0373947_0010651
656 Ga0373947_0016367
657 Ga0373947_0233127
658 Ga0373937_0315996
659 Ga0373925_0015422
660 Ga0373925_0034421
661 Ga0395900_0002342
662 Ga0395898_0067846
663 Ga0395905_0040415
664 Ga0395901_0009209
665 Ga0436360_0095845
666 Ga0436360_0169122
667 Ga0436360_0339996
668 Ga0436360_0715365
669 Ga0436360_0763377
670 Ga0436360_0768361
671 Ga0436360_0851767
672 Ga0436361_0104968
673 Ga0436361_0555528
674 Ga0436361_0561416
675 Ga0436361_0565313
676 Ga0436361_0607397
677 Ga0436361_1218554
678 Ga0436363_0211820
679 Ga0436362_0390427
680 Ga0436362_0544888
681 Ga0466964_0070577
682 Ga0466960_0025877
683 Ga0495603_0012372
684 Ga0495629_0030004
685 Ga0495629_0107673
686 Ga0495638_0000009
687 Ga0495641_0059463
688 Ga0495641_0137423
689 Ga0495651_0016829
690 Ga0495580_0000285
691 Ga0495582_0003066
692 Ga0495582_0095078
693 Ga0495594_0130377
694 Ga0495606_0000159
695 Ga0495618_0157251
696 Ga0495652_0075177
697 Ga0495665_0143579
698 Ga0495645_0145989
699 Ga0495625_0009273
700 Ga0495625_0133127
701 Ga0495588_0039517
702 Ga0495647_0025614
703 Ga0495624_0141077
704 Ga0495649_0016751
705 Ga0495674_0102703
706 Ga0495680_0249925
707 Ga0495675_0066341
708 Ga0495593_0133973
709 Ga0495602_0028672
710 Ga0496100_0214734
711 Ga0496101_0177904
712 Ga0496102_0005390
713 Ga0496102_0075407
714 Ga0496102_0393974
715 Ga0496103_0167858
716 Ga0496103_0168693
717 Ga0496103_0244723
718 Ga0496104_0030360
719 Ga0496104_0128490
720 Ga0496106_0037904
721 Ga0496107_0068216
722 Ga0496107_0326356
723 Ga0496108_0001608
724 Ga0496108_0103579
725 Ga0496108_0222937
726 Ga0496109_0000270
727 Ga0496110_0005512
728 Ga0496111_0001788
729 Ga0496112_0000121
730 Ga0496112_0041779
731 Ga0496112_0170640
732 Ga0496112_0298996
733 Ga0496112_0558807
734 Ga0496113_0000602
735 Ga0496113_0216283
736 Ga0496114_0093625
737 Ga0496114_0129995
738 Ga0496115_0000013
739 Ga0496115_0009919
740 Ga0496115_0071928
741 Ga0496115_0269642
742 Ga0496115_0295916
743 Ga0496126_0103324
744 nmdc:mga05p37_103339_c1
745 nmdc:mga05p37_167541_c1
746 nmdc:mga05p37_179969_c1
747 nmdc:mga05p37_314217_c1
748 nmdc:mga09592_121897_c1
749 nmdc:mga06r32_124709_c1
750 nmdc:mga08y16_211653_c1
751 nmdc:mga08y16_46065_c1
752 nmdc:mga08y16_94800_c1
753 nmdc:mga0n895_121002_c1
754 nmdc:mga0n895_171930_c1
755 nmdc:mga0n895_242841_c1
756 nmdc:mga0rr50_92903_c1
757 nmdc:mga08x19_202992_c1
758 nmdc:mga0a205_116135_c1
759 nmdc:mga0a205_286762_c1
760 nmdc:mga0a205_32231_c1
761 nmdc:mga0a205_98875_c1
762 Ga0495601_0030418
763 Ga0495601_0214604
764 Ga0500635_0000043
765 Ga0495595_0167044
766 Ga0495619_0049133
767 Ga0495619_0259152
768 Ga0500637_0001374
769 2739731305
770 2928967802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14224

DUF4331

Domain of unknown function (DUF4331)

43

314

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4it9-assembly1.cif.gz_B structure of bacterial enzyme 0.7633 229 260
6ol8-assembly1.cif.gz_A crystal structure of ndm-12 metallo-beta-lactamase in complex with hydrolyzed ampicillin 0.7256 78 102
4gyq-assembly3.cif.gz_C crystal structure of new delhi metallo-beta-lactamase-1 d223a mutant from klebsiella pneumoniae 0.6936 78 102
6x89-assembly1.cif.gz_S3 vigna radiata mitochondrial complex i* 0.6663 19 43
3spu-assembly1.cif.gz_A apo ndm-1 crystal structure 0.6331 67 102
ID Description Score Start End Superfamily
af_Q9VBP6_26_282_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.8847 233 259 3.40.605.10
af_Q8VZC3_51_302_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.8819 234 259 3.40.605.10
af_Q4DYS1_27_279_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.8706 234 258 3.40.605.10
af_Q55CJ9_31_264_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.8452 229 259 3.40.605.10
af_Q551V0_65_289_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.8306 233 261 3.40.605.10
ID Description Score Start End GO Terms
AF-A0A534ZBY8-F1-model_v4 DUF4331 domain-containing protein 0.98 35 323
AF-A0A2V6EKJ9-F1-model_v4 DUF4331 domain-containing protein 0.9757 1 323
AF-A0A534ZBY8-F1-model_v4 DUF4331 domain-containing protein 0.9734 35 323
AF-A0A2V6EKJ9-F1-model_v4 DUF4331 domain-containing protein 0.9727 1 323
AF-A0A843B555-F1-model_v4 DUF4331 family protein 0.9679 19 327

Map