F430166

General Info

Members Datasets Scaffolds Average Seq Length
385 217 770 177

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100187800|Ga0097621_1001878003
Length 214
Sequence VFSWLRVKKRSRLAKVFGVAGSPRRPLPRFEFVVIRGDSWVAMAFDLQPHLKGELIELRPLTPNDWGELFAVASDPLIWEQHPERDRYKEDVFRIFFKEALESGGAFVIIDRKIQRIIGSTRFYGYDPQKSEIEIGWTFLARKHWGGRYNAEMKRLLLNHAFRFVENVVFFVGENNVRSQKAMEKVGAIRVGTATRTYRNHPPTSNLKYVIKQW

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.68
Rhizosphere 95.32
Stem 0
Stem Tuber 0
Unclassified 15.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100187800 3300006237 Bacteria 1788
2 SwRhRL2b_contig_3457847 2162886007 Bacteria 813
3 SwRhRL2b_contig_481403 2162886007 Bacteria 2182
4 MBSR1b_contig_3794957 2162886012 Bacteria 920
5 JGI24035J26624_1001384 3300002126 Bacteria 2291
6 JGI24035J26624_1003583 3300002126 Bacteria 1465
7 Ga0065714_10148894 3300005288 Bacteria 1066
8 Ga0065704_10016401 3300005289 Bacteria 2251
9 Ga0065704_10114149 3300005289 Bacteria 1897
10 Ga0065704_10388067 3300005289 Unclassified 760
11 Ga0065712_10006390 3300005290 Bacteria 3315
12 Ga0065712_10019741 3300005290 Unclassified 1513
13 Ga0065712_10021580 3300005290 Bacteria 1701
14 Ga0065712_10089653 3300005290 Bacteria 2459
15 Ga0065712_10272207 3300005290 Unclassified 902
16 Ga0065715_10150409 3300005293 Bacteria 1730
17 Ga0065715_10195491 3300005293 Bacteria 1390
18 Ga0065715_10222701 3300005293 Bacteria 1265
19 Ga0065715_10292383 3300005293 Bacteria 1053
20 Ga0065715_10335520 3300005293 Unclassified 976
21 Ga0065707_10179657 3300005295 Bacteria 1423
22 Ga0065707_10287897 3300005295 Bacteria 1026
23 Ga0070676_10140183 3300005328 Bacteria 1538
24 Ga0070683_100016243 3300005329 Bacteria 6559
25 Ga0070683_100088852 3300005329 Bacteria 2900
26 Ga0070683_100112660 3300005329 Bacteria 2567
27 Ga0070690_100061558 3300005330 Bacteria 2418
28 Ga0070690_100286653 3300005330 Bacteria 1176
29 Ga0070670_101061035 3300005331 Unclassified 738
30 Ga0070666_10041443 3300005335 Bacteria 3077
31 Ga0070666_10181732 3300005335 Bacteria 1475
32 Ga0070680_100074126 3300005336 Bacteria 2800
33 Ga0070680_101200768 3300005336 Unclassified 656
34 Ga0068868_100047537 3300005338 Bacteria 3364
35 Ga0068868_100158255 3300005338 Bacteria 1869
36 Ga0070660_100450638 3300005339 Bacteria 1067
37 Ga0070689_100235154 3300005340 Bacteria 1507
38 Ga0070689_100610073 3300005340 Bacteria 946
39 Ga0070689_101455508 3300005340 Bacteria 620
40 Ga0070661_100281838 3300005344 Bacteria 1289
41 Ga0070661_100547261 3300005344 Bacteria 931
42 Ga0070692_10044633 3300005345 Bacteria 2284
43 Ga0070675_100005376 3300005354 Bacteria 9786
44 Ga0070671_100057269 3300005355 Bacteria 3243
45 Ga0070674_100520681 3300005356 Unclassified 993
46 Ga0070674_100608964 3300005356 Unclassified 924
47 Ga0070673_100060013 3300005364 Bacteria 3012
48 Ga0070673_100223474 3300005364 Bacteria 1631
49 Ga0070673_100574337 3300005364 Bacteria 1026
50 Ga0070688_100000106 3300005365 Bacteria 43309
51 Ga0070688_100029948 3300005365 Bacteria 3263
52 Ga0070688_100098158 3300005365 Bacteria 1926
53 Ga0070688_100285966 3300005365 Bacteria 1187
54 Ga0070659_100008343 3300005366 Bacteria 7564
55 Ga0070667_100208465 3300005367 Bacteria 1737
56 Ga0070703_10052664 3300005406 Bacteria 1307
57 Ga0070709_10038572 3300005434 Bacteria 2926
58 Ga0070709_11131324 3300005434 Bacteria 627
59 Ga0070714_100047822 3300005435 Bacteria 3636
60 Ga0070713_100214700 3300005436 Bacteria 1743
61 Ga0070713_100303465 3300005436 Bacteria 1470
62 Ga0070710_10116442 3300005437 Bacteria 1612
63 Ga0070701_10120365 3300005438 Bacteria 1478
64 Ga0070711_100109553 3300005439 Unclassified 2025
65 Ga0070711_100176683 3300005439 Unclassified 1631
66 Ga0070711_100197391 3300005439 Bacteria 1550
67 Ga0070711_100370465 3300005439 Bacteria 1156
68 Ga0070700_100070217 3300005441 Bacteria 2233
69 Ga0070708_100651194 3300005445 Bacteria 993
70 Ga0070708_100871958 3300005445 Unclassified 845
71 Ga0070708_101104522 3300005445 Unclassified 743
72 Ga0070663_100575841 3300005455 Bacteria 944
73 Ga0070678_100268650 3300005456 Bacteria 1437
74 Ga0070662_100060078 3300005457 Bacteria 2770
75 Ga0070662_100380048 3300005457 Bacteria 1162
76 Ga0070681_10108997 3300005458 Bacteria 2709
77 Ga0070681_10799220 3300005458 Unclassified 860
78 Ga0070685_10038480 3300005466 Bacteria 2712
79 Ga0070685_10045884 3300005466 Bacteria 2507
80 Ga0070706_100006158 3300005467 Bacteria 11346
81 Ga0070706_100030101 3300005467 Bacteria 5000
82 Ga0070706_100158227 3300005467 Bacteria 2115
83 Ga0070706_100253456 3300005467 Bacteria 1643
84 Ga0070707_100047252 3300005468 Unclassified 4120
85 Ga0070698_100010357 3300005471 Bacteria 9955
86 Ga0070698_100082291 3300005471 Bacteria 3211
87 Ga0070698_100623261 3300005471 Unclassified 1019
88 Ga0070699_100180442 3300005518 Bacteria 1873
89 Ga0070679_100114482 3300005530 Bacteria 2682
90 Ga0070679_100568268 3300005530 Bacteria 1078
91 Ga0070684_100001068 3300005535 Bacteria 19615
92 Ga0070684_100025999 3300005535 Bacteria 4927
93 Ga0070684_100039855 3300005535 Bacteria 4042
94 Ga0070697_100060097 3300005536 Bacteria 3096
95 Ga0070697_100143132 3300005536 Bacteria 2012
96 Ga0070697_100374765 3300005536 Bacteria 1232
97 Ga0070697_100738297 3300005536 Bacteria 870
98 Ga0070672_100045832 3300005543 Bacteria 3385
99 Ga0070686_100033692 3300005544 Bacteria 3149
100 Ga0070665_100070102 3300005548 Bacteria 3512
101 Ga0070665_100386811 3300005548 Bacteria 1406
102 Ga0070665_101405613 3300005548 Unclassified 707
103 Ga0070664_100062895 3300005564 Bacteria 3164
104 Ga0070664_100184023 3300005564 Bacteria 1858
105 Ga0070664_100384333 3300005564 Bacteria 1282
106 Ga0070664_100384938 3300005564 Bacteria 1281
107 Ga0068856_100067729 3300005614 Bacteria 3528
108 Ga0068852_100592894 3300005616 Bacteria 1112
109 Ga0068859_100668387 3300005617 Bacteria 1130
110 Ga0068859_100675084 3300005617 Bacteria 1124
111 Ga0068864_100084218 3300005618 Bacteria 2793
112 Ga0068861_100313036 3300005719 Bacteria 1365
113 Ga0068863_100081781 3300005841 Bacteria 3060
114 Ga0068863_100086626 3300005841 Bacteria 2968
115 Ga0068858_100018257 3300005842 Bacteria 6568
116 Ga0068858_100383578 3300005842 Bacteria 1349
117 Ga0068858_100477902 3300005842 Bacteria 1202
118 Ga0068858_100912051 3300005842 Bacteria 859
119 Ga0068860_100014680 3300005843 Bacteria 7662
120 Ga0068860_100469975 3300005843 Bacteria 1252
121 Ga0081455_10005079 3300005937 Bacteria 14529
122 Ga0081455_10014876 3300005937 Bacteria 7587
123 Ga0081455_10027828 3300005937 Bacteria 5175
124 Ga0081455_10056336 3300005937 Bacteria 3339
125 Ga0081540_1054024 3300005983 Bacteria 1966
126 Ga0081540_1070617 3300005983 Bacteria 1617
127 Ga0070717_10053077 3300006028 Unclassified 3341
128 Ga0070717_10056405 3300006028 Bacteria 3245
129 Ga0070717_10686809 3300006028 Unclassified 930
130 Ga0070716_100063160 3300006173 Bacteria 2149
131 Ga0070712_100029013 3300006175 Bacteria 3707
132 Ga0070712_100098316 3300006175 Unclassified 2159
133 Ga0070712_100142429 3300006175 Bacteria 1831
134 Ga0070712_100312478 3300006175 Bacteria 1275
135 Ga0070712_100405770 3300006175 Bacteria 1126
136 Ga0097621_100210736 3300006237 Bacteria 1690
137 Ga0097621_100972477 3300006237 Bacteria 793
138 Ga0068871_100145810 3300006358 Bacteria 2015
139 Ga0068871_100357318 3300006358 Bacteria 1293
140 Ga0068871_100404756 3300006358 Bacteria 1216
141 Ga0068871_100582485 3300006358 Bacteria 1016
142 Ga0075428_100254029 3300006844 Bacteria 1894
143 Ga0075431_100015122 3300006847 Bacteria 7816
144 Ga0075431_100731667 3300006847 Bacteria 965
145 Ga0075433_10495302 3300006852 Bacteria 1076
146 Ga0075433_10664035 3300006852 Bacteria 914
147 Ga0075434_100401589 3300006871 Bacteria 1391
148 Ga0075434_100517519 3300006871 Bacteria 1214
149 Ga0075434_101274586 3300006871 Unclassified 746
150 Ga0075429_100637998 3300006880 Bacteria 933
151 Ga0068865_100857540 3300006881 Bacteria 787
152 Ga0097620_100668516 3300006931 Bacteria 1130
153 Ga0097620_100675074 3300006931 Bacteria 1124
154 Ga0099795_10135721 3300007788 Unclassified 996
155 Ga0105251_10207698 3300009011 Unclassified 882
156 Ga0105240_10926824 3300009093 Bacteria 936
157 Ga0111539_11197840 3300009094 Bacteria 882
158 Ga0105245_10334331 3300009098 Bacteria 1496
159 Ga0105245_10401914 3300009098 Bacteria 1369
160 Ga0105247_10559202 3300009101 Bacteria 842
161 Ga0114129_10132578 3300009147 Bacteria 3421
162 Ga0114129_10212365 3300009147 Bacteria 2615
163 Ga0114129_10242760 3300009147 Bacteria 2421
164 Ga0114129_10642751 3300009147 Bacteria 1370
165 Ga0105243_12001500 3300009148 Unclassified 614
166 Ga0105241_10396874 3300009174 Bacteria 1209
167 Ga0105248_10116505 3300009177 Bacteria 3013
168 Ga0105248_10171740 3300009177 Bacteria 2443
169 Ga0105237_11911361 3300009545 Unclassified 602
170 Ga0105249_10142071 3300009553 Bacteria 2303
171 Ga0105249_10457071 3300009553 Bacteria 1316
172 Ga0099796_10048303 3300010159 Bacteria 1467
173 Ga0105239_10350411 3300010375 Unclassified 1667
174 Ga0105239_10519775 3300010375 Bacteria 1354
175 Ga0105239_10888088 3300010375 Unclassified 1023
176 Ga0105246_10352755 3300011119 Bacteria 1206
177 Ga0157371_10652436 3300013102 Unclassified 785
178 Ga0157374_10049039 3300013296 Bacteria 3921
179 Ga0157374_10120934 3300013296 Bacteria 2527
180 Ga0157374_10140571 3300013296 Bacteria 2343
181 Ga0157374_10455256 3300013296 Unclassified 1281
182 Ga0157374_10776480 3300013296 Unclassified 973
183 Ga0157378_10092470 3300013297 Bacteria 2752
184 Ga0157378_10302662 3300013297 Bacteria 1548
185 Ga0157378_10506999 3300013297 Bacteria 1206
186 Ga0163162_10159404 3300013306 Bacteria 2378
187 Ga0163162_10198020 3300013306 Bacteria 2138
188 Ga0163162_10722845 3300013306 Bacteria 1116
189 Ga0163162_11785528 3300013306 Bacteria 703
190 Ga0157372_10486088 3300013307 Bacteria 1439
191 Ga0157375_10001548 3300013308 Bacteria 19783
192 Ga0157375_10103963 3300013308 Bacteria 2928
193 Ga0157375_10133512 3300013308 Bacteria 2604
194 Ga0163163_10102765 3300014325 Bacteria 2882
195 Ga0163163_10291827 3300014325 Unclassified 1683
196 Ga0163163_10561387 3300014325 Unclassified 1204
197 Ga0163163_10627923 3300014325 Bacteria 1138
198 Ga0163163_11260743 3300014325 Unclassified 801
199 Ga0182008_10194337 3300014497 Unclassified 1030
200 Ga0157377_10110043 3300014745 Bacteria 1654
201 Ga0157379_10021940 3300014968 Bacteria 5658
202 Ga0157376_10044333 3300014969 Bacteria 3656
203 Ga0157376_10186438 3300014969 Bacteria 1900
204 Ga0157376_10215788 3300014969 Bacteria 1774
205 Ga0157376_10393175 3300014969 Unclassified 1339
206 Ga0182006_1006808 3300015261 Bacteria 5273
207 Ga0182005_1037331 3300015265 Bacteria 1321
208 Ga0163161_10945424 3300017792 Unclassified 733
209 Ga0207666_1003656 3300025271 Bacteria 1897
210 Ga0207666_1008882 3300025271 Bacteria 1349
211 Ga0207673_1007625 3300025290 Bacteria 1360
212 Ga0207673_1017384 3300025290 Bacteria 960
213 Ga0207697_10003532 3300025315 Bacteria 7711
214 Ga0207697_10004804 3300025315 Bacteria 6389
215 Ga0207697_10027020 3300025315 Bacteria 2347
216 Ga0207697_10154444 3300025315 Unclassified 999
217 Ga0207653_10043399 3300025885 Bacteria 1481
218 Ga0207692_10038496 3300025898 Unclassified 2346
219 Ga0207692_10434800 3300025898 Bacteria 823
220 Ga0207710_10261977 3300025900 Bacteria 866
221 Ga0207680_10129090 3300025903 Bacteria 1664
222 Ga0207680_10337159 3300025903 Bacteria 1057
223 Ga0207647_10004405 3300025904 Bacteria 10442
224 Ga0207685_10034445 3300025905 Bacteria 1840
225 Ga0207699_10042324 3300025906 Bacteria 2638
226 Ga0207645_10152498 3300025907 Bacteria 1509
227 Ga0207684_10005743 3300025910 Bacteria 11392
228 Ga0207684_10084152 3300025910 Bacteria 2709
229 Ga0207684_10719908 3300025910 Unclassified 847
230 Ga0207654_10488327 3300025911 Bacteria 868
231 Ga0207707_10091621 3300025912 Bacteria 2656
232 Ga0207671_11170954 3300025914 Unclassified 602
233 Ga0207693_10017408 3300025915 Bacteria 5733
234 Ga0207693_10022897 3300025915 Bacteria 4960
235 Ga0207693_10042612 3300025915 Bacteria 3573
236 Ga0207693_10095416 3300025915 Bacteria 2331
237 Ga0207693_10111084 3300025915 Bacteria 2149
238 Ga0207693_10224368 3300025915 Unclassified 1476
239 Ga0207663_10017140 3300025916 Bacteria 4030
240 Ga0207663_10036444 3300025916 Unclassified 2960
241 Ga0207663_10477185 3300025916 Unclassified 966
242 Ga0207663_11302222 3300025916 Unclassified 585
243 Ga0207660_10104835 3300025917 Bacteria 2118
244 Ga0207657_10074058 3300025919 Bacteria 2876
245 Ga0207657_10214053 3300025919 Bacteria 1545
246 Ga0207649_10051186 3300025920 Bacteria 2557
247 Ga0207652_10039007 3300025921 Bacteria 4029
248 Ga0207646_10002049 3300025922 Bacteria 24194
249 Ga0207646_11244901 3300025922 Bacteria 651
250 Ga0207650_10309891 3300025925 Bacteria 1291
251 Ga0207659_10142780 3300025926 Bacteria 1860
252 Ga0207659_10297558 3300025926 Bacteria 1324
253 Ga0207687_11138043 3300025927 Bacteria 671
254 Ga0207664_10340500 3300025929 Bacteria 1326
255 Ga0207664_10804461 3300025929 Unclassified 845
256 Ga0207644_10076930 3300025931 Bacteria 2456
257 Ga0207690_10211697 3300025932 Bacteria 1478
258 Ga0207690_10262316 3300025932 Unclassified 1339
259 Ga0207690_10450498 3300025932 Bacteria 1034
260 Ga0207706_10016988 3300025933 Bacteria 6565
261 Ga0207706_10132144 3300025933 Bacteria 2195
262 Ga0207670_10000106 3300025936 Bacteria 57615
263 Ga0207670_10284626 3300025936 Bacteria 1289
264 Ga0207670_10876058 3300025936 Bacteria 751
265 Ga0207669_10278811 3300025937 Unclassified 1260
266 Ga0207665_10085562 3300025939 Bacteria 2177
267 Ga0207665_10187352 3300025939 Bacteria 1502
268 Ga0207691_10263739 3300025940 Bacteria 1485
269 Ga0207711_10460403 3300025941 Bacteria 1184
270 Ga0207711_10585622 3300025941 Bacteria 1041
271 Ga0207661_10091295 3300025944 Bacteria 2537
272 Ga0207661_10117575 3300025944 Bacteria 2258
273 Ga0207661_10426633 3300025944 Bacteria 1205
274 Ga0207661_10541435 3300025944 Bacteria 1066
275 Ga0207679_10047745 3300025945 Bacteria 3113
276 Ga0207679_10676618 3300025945 Unclassified 935
277 Ga0207651_10009023 3300025960 Bacteria 5424
278 Ga0207712_10079754 3300025961 Bacteria 2379
279 Ga0207712_10357375 3300025961 Bacteria 1216
280 Ga0207658_10112261 3300025986 Bacteria 2157
281 Ga0207677_10149799 3300026023 Bacteria 1798
282 Ga0207703_10069283 3300026035 Bacteria 2909
283 Ga0207703_10226171 3300026035 Bacteria 1675
284 Ga0207703_10300214 3300026035 Bacteria 1464
285 Ga0207703_10856642 3300026035 Bacteria 869
286 Ga0207678_10000816 3300026067 Bacteria 28552
287 Ga0207678_10487699 3300026067 Bacteria 1073
288 Ga0207708_10093058 3300026075 Bacteria 2327
289 Ga0207708_10935466 3300026075 Unclassified 751
290 Ga0207702_10047461 3300026078 Bacteria 3619
291 Ga0207702_10509889 3300026078 Bacteria 1173
292 Ga0207641_10103359 3300026088 Bacteria 2513
293 Ga0207641_10146886 3300026088 Bacteria 2133
294 Ga0207641_10444406 3300026088 Bacteria 1252
295 Ga0207676_10499623 3300026095 Bacteria 1155
296 Ga0207675_100157751 3300026118 Bacteria 2163
297 Ga0207675_100562325 3300026118 Bacteria 1141
298 Ga0207683_10205177 3300026121 Bacteria 1793
299 Ga0207683_10448549 3300026121 Bacteria 1189
300 Ga0268266_10054147 3300028379 Bacteria 3447
301 Ga0268266_10071298 3300028379 Bacteria 3011
302 Ga0268266_10159352 3300028379 Bacteria 2041
303 Ga0268264_10415562 3300028381 Bacteria 1296
304 Ga0307413_10358005 3300031824 Unclassified 1129
305 Ga0373953_0076764 3300035117 Bacteria 1385
306 Ga0373955_0588973 3300035172 Unclassified 681
307 Ga0373927_0292913 3300035695 Bacteria 1071
308 Ga0373933_0176399 3300035724 Bacteria 1362
309 Ga0373933_0365520 3300035724 Unclassified 939
310 Ga0373947_0007986 3300035725 Bacteria 6103
311 Ga0373947_0102211 3300035725 Bacteria 1802
312 Ga0373937_0067887 3300036401 Bacteria 3286
313 Ga0373937_0110985 3300036401 Bacteria 2551
314 Ga0373937_0244786 3300036401 Unclassified 1690
315 Ga0373937_1103977 3300036401 Unclassified 742
316 Ga0395899_0225817 3300037312 Bacteria 1295
317 Ga0395900_0015282 3300037418 Bacteria 7827
318 Ga0395900_0248308 3300037418 Bacteria 1782
319 Ga0395898_0105565 3300037466 Bacteria 2701
320 Ga0395905_0023943 3300037471 Bacteria 5765
321 Ga0395901_0006855 3300038443 Bacteria 11506
322 Ga0439454_007253 3300042011 Bacteria 1384
323 Ga0466963_0465790 3300044694 Bacteria 892
324 Ga0466967_0373085 3300045976 Bacteria 1384
325 Ga0495592_0038012 3300046454 Bacteria 3622
326 Ga0495603_0257237 3300046455 Bacteria 1005
327 Ga0495629_0227351 3300046459 Unclassified 1286
328 Ga0495629_0250924 3300046459 Unclassified 1218
329 Ga0495651_0255800 3300046462 Bacteria 1194
330 Ga0495653_0395285 3300046463 Unclassified 880
331 Ga0495580_0026839 3300046472 Bacteria 4195
332 Ga0495582_0477582 3300046473 Unclassified 720
333 Ga0495664_0635591 3300046477 Bacteria 633
334 Ga0495608_0260898 3300046511 Unclassified 1079
335 Ga0495618_0203246 3300046514 Bacteria 1254
336 Ga0495652_0026641 3300046529 Bacteria 5104
337 Ga0495640_0152024 3300046533 Bacteria 1487
338 Ga0495586_0100721 3300046535 Bacteria 1603
339 Ga0495586_0326303 3300046535 Bacteria 881
340 Ga0495621_0003209 3300046539 Bacteria 4489
341 Ga0495645_0038151 3300046543 Bacteria 3504
342 Ga0495656_0203797 3300046615 Bacteria 983
343 Ga0495634_0034145 3300046642 Bacteria 3492
344 Ga0495599_0004710 3300046678 Bacteria 8099
345 Ga0495646_0018746 3300046680 Bacteria 4383
346 Ga0495669_0015781 3300046684 Bacteria 3233
347 Ga0495624_0360125 3300046690 Bacteria 875
348 Ga0495581_0235187 3300047315 Bacteria 1072
349 Ga0495604_0166821 3300047317 Bacteria 1552
350 Ga0495674_0225594 3300047319 Bacteria 1548
351 Ga0495674_0346587 3300047319 Bacteria 1206
352 Ga0495680_0075069 3300047322 Bacteria 2565
353 Ga0495675_0024551 3300047444 Bacteria 3844
354 Ga0495684_0078635 3300047471 Bacteria 2503
355 Ga0496101_0345262 3300048904 Bacteria 1169
356 Ga0496102_0336632 3300048905 Bacteria 1421
357 Ga0496104_0290210 3300048907 Bacteria 1548
358 Ga0496104_0294066 3300048907 Unclassified 1537
359 Ga0496104_0381679 3300048907 Bacteria 1322
360 Ga0496105_0108394 3300048908 Bacteria 2293
361 Ga0496105_0461151 3300048908 Bacteria 1002
362 Ga0496107_0120027 3300048910 Bacteria 1937
363 Ga0496108_0192353 3300048911 Bacteria 1768
364 Ga0496109_0025052 3300048912 Bacteria 5311
365 Ga0496110_0261866 3300048913 Bacteria 1574
366 Ga0496112_0077664 3300048915 Bacteria 3284
367 Ga0496112_0092720 3300048915 Bacteria 2990
368 Ga0496112_0137792 3300048915 Bacteria 2410
369 Ga0496113_0152262 3300048916 Bacteria 1825
370 Ga0496114_1062103 3300048917 Unclassified 694
371 Ga0496115_0187846 3300048918 Bacteria 1707
372 Ga0496115_0190380 3300048918 Bacteria 1695
373 Ga0501069_0189785 3300049585 Bacteria 1189
374 nmdc:mga05p37_433539_c1 3300050507 Bacteria 1526
375 nmdc:mga05p37_539410_c1 3300050507 Bacteria 1330
376 nmdc:mga09592_615589_c1 3300050508 Bacteria 929
377 nmdc:mga06r32_207650_c1 3300050510 Bacteria 1947
378 nmdc:mga08y16_883432_c1 3300050511 Bacteria 881
379 nmdc:mga0n895_424710_c1 3300050512 Bacteria 1343
380 nmdc:mga0n895_506309_c1 3300050512 Bacteria 1216
381 nmdc:mga0a205_497812_c1 3300050515 Bacteria 1076
382 Ga0495619_0149830 3300053085 Bacteria 1609
383 Ga0590074_000355 3300059423 Bacteria 6411
384 Ga0590075_000129 3300059424 Bacteria 19535
385 Ga0590077_000688 3300059426 Bacteria 8986
386 Ga0097621_100187800
387 SwRhRL2b_contig_3457847
388 SwRhRL2b_contig_481403
389 MBSR1b_contig_3794957
390 JGI24035J26624_1001384
391 JGI24035J26624_1003583
392 Ga0065714_10148894
393 Ga0065704_10016401
394 Ga0065704_10114149
395 Ga0065704_10388067
396 Ga0065712_10006390
397 Ga0065712_10019741
398 Ga0065712_10021580
399 Ga0065712_10089653
400 Ga0065712_10272207
401 Ga0065715_10150409
402 Ga0065715_10195491
403 Ga0065715_10222701
404 Ga0065715_10292383
405 Ga0065715_10335520
406 Ga0065707_10179657
407 Ga0065707_10287897
408 Ga0070676_10140183
409 Ga0070683_100016243
410 Ga0070683_100088852
411 Ga0070683_100112660
412 Ga0070690_100061558
413 Ga0070690_100286653
414 Ga0070670_101061035
415 Ga0070666_10041443
416 Ga0070666_10181732
417 Ga0070680_100074126
418 Ga0070680_101200768
419 Ga0068868_100047537
420 Ga0068868_100158255
421 Ga0070660_100450638
422 Ga0070689_100235154
423 Ga0070689_100610073
424 Ga0070689_101455508
425 Ga0070661_100281838
426 Ga0070661_100547261
427 Ga0070692_10044633
428 Ga0070675_100005376
429 Ga0070671_100057269
430 Ga0070674_100520681
431 Ga0070674_100608964
432 Ga0070673_100060013
433 Ga0070673_100223474
434 Ga0070673_100574337
435 Ga0070688_100000106
436 Ga0070688_100029948
437 Ga0070688_100098158
438 Ga0070688_100285966
439 Ga0070659_100008343
440 Ga0070667_100208465
441 Ga0070703_10052664
442 Ga0070709_10038572
443 Ga0070709_11131324
444 Ga0070714_100047822
445 Ga0070713_100214700
446 Ga0070713_100303465
447 Ga0070710_10116442
448 Ga0070701_10120365
449 Ga0070711_100109553
450 Ga0070711_100176683
451 Ga0070711_100197391
452 Ga0070711_100370465
453 Ga0070700_100070217
454 Ga0070708_100651194
455 Ga0070708_100871958
456 Ga0070708_101104522
457 Ga0070663_100575841
458 Ga0070678_100268650
459 Ga0070662_100060078
460 Ga0070662_100380048
461 Ga0070681_10108997
462 Ga0070681_10799220
463 Ga0070685_10038480
464 Ga0070685_10045884
465 Ga0070706_100006158
466 Ga0070706_100030101
467 Ga0070706_100158227
468 Ga0070706_100253456
469 Ga0070707_100047252
470 Ga0070698_100010357
471 Ga0070698_100082291
472 Ga0070698_100623261
473 Ga0070699_100180442
474 Ga0070679_100114482
475 Ga0070679_100568268
476 Ga0070684_100001068
477 Ga0070684_100025999
478 Ga0070684_100039855
479 Ga0070697_100060097
480 Ga0070697_100143132
481 Ga0070697_100374765
482 Ga0070697_100738297
483 Ga0070672_100045832
484 Ga0070686_100033692
485 Ga0070665_100070102
486 Ga0070665_100386811
487 Ga0070665_101405613
488 Ga0070664_100062895
489 Ga0070664_100184023
490 Ga0070664_100384333
491 Ga0070664_100384938
492 Ga0068856_100067729
493 Ga0068852_100592894
494 Ga0068859_100668387
495 Ga0068859_100675084
496 Ga0068864_100084218
497 Ga0068861_100313036
498 Ga0068863_100081781
499 Ga0068863_100086626
500 Ga0068858_100018257
501 Ga0068858_100383578
502 Ga0068858_100477902
503 Ga0068858_100912051
504 Ga0068860_100014680
505 Ga0068860_100469975
506 Ga0081455_10005079
507 Ga0081455_10014876
508 Ga0081455_10027828
509 Ga0081455_10056336
510 Ga0081540_1054024
511 Ga0081540_1070617
512 Ga0070717_10053077
513 Ga0070717_10056405
514 Ga0070717_10686809
515 Ga0070716_100063160
516 Ga0070712_100029013
517 Ga0070712_100098316
518 Ga0070712_100142429
519 Ga0070712_100312478
520 Ga0070712_100405770
521 Ga0097621_100210736
522 Ga0097621_100972477
523 Ga0068871_100145810
524 Ga0068871_100357318
525 Ga0068871_100404756
526 Ga0068871_100582485
527 Ga0075428_100254029
528 Ga0075431_100015122
529 Ga0075431_100731667
530 Ga0075433_10495302
531 Ga0075433_10664035
532 Ga0075434_100401589
533 Ga0075434_100517519
534 Ga0075434_101274586
535 Ga0075429_100637998
536 Ga0068865_100857540
537 Ga0097620_100668516
538 Ga0097620_100675074
539 Ga0099795_10135721
540 Ga0105251_10207698
541 Ga0105240_10926824
542 Ga0111539_11197840
543 Ga0105245_10334331
544 Ga0105245_10401914
545 Ga0105247_10559202
546 Ga0114129_10132578
547 Ga0114129_10212365
548 Ga0114129_10242760
549 Ga0114129_10642751
550 Ga0105243_12001500
551 Ga0105241_10396874
552 Ga0105248_10116505
553 Ga0105248_10171740
554 Ga0105237_11911361
555 Ga0105249_10142071
556 Ga0105249_10457071
557 Ga0099796_10048303
558 Ga0105239_10350411
559 Ga0105239_10519775
560 Ga0105239_10888088
561 Ga0105246_10352755
562 Ga0157371_10652436
563 Ga0157374_10049039
564 Ga0157374_10120934
565 Ga0157374_10140571
566 Ga0157374_10455256
567 Ga0157374_10776480
568 Ga0157378_10092470
569 Ga0157378_10302662
570 Ga0157378_10506999
571 Ga0163162_10159404
572 Ga0163162_10198020
573 Ga0163162_10722845
574 Ga0163162_11785528
575 Ga0157372_10486088
576 Ga0157375_10001548
577 Ga0157375_10103963
578 Ga0157375_10133512
579 Ga0163163_10102765
580 Ga0163163_10291827
581 Ga0163163_10561387
582 Ga0163163_10627923
583 Ga0163163_11260743
584 Ga0182008_10194337
585 Ga0157377_10110043
586 Ga0157379_10021940
587 Ga0157376_10044333
588 Ga0157376_10186438
589 Ga0157376_10215788
590 Ga0157376_10393175
591 Ga0182006_1006808
592 Ga0182005_1037331
593 Ga0163161_10945424
594 Ga0207666_1003656
595 Ga0207666_1008882
596 Ga0207673_1007625
597 Ga0207673_1017384
598 Ga0207697_10003532
599 Ga0207697_10004804
600 Ga0207697_10027020
601 Ga0207697_10154444
602 Ga0207653_10043399
603 Ga0207692_10038496
604 Ga0207692_10434800
605 Ga0207710_10261977
606 Ga0207680_10129090
607 Ga0207680_10337159
608 Ga0207647_10004405
609 Ga0207685_10034445
610 Ga0207699_10042324
611 Ga0207645_10152498
612 Ga0207684_10005743
613 Ga0207684_10084152
614 Ga0207684_10719908
615 Ga0207654_10488327
616 Ga0207707_10091621
617 Ga0207671_11170954
618 Ga0207693_10017408
619 Ga0207693_10022897
620 Ga0207693_10042612
621 Ga0207693_10095416
622 Ga0207693_10111084
623 Ga0207693_10224368
624 Ga0207663_10017140
625 Ga0207663_10036444
626 Ga0207663_10477185
627 Ga0207663_11302222
628 Ga0207660_10104835
629 Ga0207657_10074058
630 Ga0207657_10214053
631 Ga0207649_10051186
632 Ga0207652_10039007
633 Ga0207646_10002049
634 Ga0207646_11244901
635 Ga0207650_10309891
636 Ga0207659_10142780
637 Ga0207659_10297558
638 Ga0207687_11138043
639 Ga0207664_10340500
640 Ga0207664_10804461
641 Ga0207644_10076930
642 Ga0207690_10211697
643 Ga0207690_10262316
644 Ga0207690_10450498
645 Ga0207706_10016988
646 Ga0207706_10132144
647 Ga0207670_10000106
648 Ga0207670_10284626
649 Ga0207670_10876058
650 Ga0207669_10278811
651 Ga0207665_10085562
652 Ga0207665_10187352
653 Ga0207691_10263739
654 Ga0207711_10460403
655 Ga0207711_10585622
656 Ga0207661_10091295
657 Ga0207661_10117575
658 Ga0207661_10426633
659 Ga0207661_10541435
660 Ga0207679_10047745
661 Ga0207679_10676618
662 Ga0207651_10009023
663 Ga0207712_10079754
664 Ga0207712_10357375
665 Ga0207658_10112261
666 Ga0207677_10149799
667 Ga0207703_10069283
668 Ga0207703_10226171
669 Ga0207703_10300214
670 Ga0207703_10856642
671 Ga0207678_10000816
672 Ga0207678_10487699
673 Ga0207708_10093058
674 Ga0207708_10935466
675 Ga0207702_10047461
676 Ga0207702_10509889
677 Ga0207641_10103359
678 Ga0207641_10146886
679 Ga0207641_10444406
680 Ga0207676_10499623
681 Ga0207675_100157751
682 Ga0207675_100562325
683 Ga0207683_10205177
684 Ga0207683_10448549
685 Ga0268266_10054147
686 Ga0268266_10071298
687 Ga0268266_10159352
688 Ga0268264_10415562
689 Ga0307413_10358005
690 Ga0373953_0076764
691 Ga0373955_0588973
692 Ga0373927_0292913
693 Ga0373933_0176399
694 Ga0373933_0365520
695 Ga0373947_0007986
696 Ga0373947_0102211
697 Ga0373937_0067887
698 Ga0373937_0110985
699 Ga0373937_0244786
700 Ga0373937_1103977
701 Ga0395899_0225817
702 Ga0395900_0015282
703 Ga0395900_0248308
704 Ga0395898_0105565
705 Ga0395905_0023943
706 Ga0395901_0006855
707 Ga0439454_007253
708 Ga0466963_0465790
709 Ga0466967_0373085
710 Ga0495592_0038012
711 Ga0495603_0257237
712 Ga0495629_0227351
713 Ga0495629_0250924
714 Ga0495651_0255800
715 Ga0495653_0395285
716 Ga0495580_0026839
717 Ga0495582_0477582
718 Ga0495664_0635591
719 Ga0495608_0260898
720 Ga0495618_0203246
721 Ga0495652_0026641
722 Ga0495640_0152024
723 Ga0495586_0100721
724 Ga0495586_0326303
725 Ga0495621_0003209
726 Ga0495645_0038151
727 Ga0495656_0203797
728 Ga0495634_0034145
729 Ga0495599_0004710
730 Ga0495646_0018746
731 Ga0495669_0015781
732 Ga0495624_0360125
733 Ga0495581_0235187
734 Ga0495604_0166821
735 Ga0495674_0225594
736 Ga0495674_0346587
737 Ga0495680_0075069
738 Ga0495675_0024551
739 Ga0495684_0078635
740 Ga0496101_0345262
741 Ga0496102_0336632
742 Ga0496104_0290210
743 Ga0496104_0294066
744 Ga0496104_0381679
745 Ga0496105_0108394
746 Ga0496105_0461151
747 Ga0496107_0120027
748 Ga0496108_0192353
749 Ga0496109_0025052
750 Ga0496110_0261866
751 Ga0496112_0077664
752 Ga0496112_0092720
753 Ga0496112_0137792
754 Ga0496113_0152262
755 Ga0496114_1062103
756 Ga0496115_0187846
757 Ga0496115_0190380
758 Ga0501069_0189785
759 nmdc:mga05p37_433539_c1
760 nmdc:mga05p37_539410_c1
761 nmdc:mga09592_615589_c1
762 nmdc:mga06r32_207650_c1
763 nmdc:mga08y16_883432_c1
764 nmdc:mga0n895_424710_c1
765 nmdc:mga0n895_506309_c1
766 nmdc:mga0a205_497812_c1
767 Ga0495619_0149830
768 Ga0590074_000355
769 Ga0590075_000129
770 Ga0590077_000688

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

56

189

0.82

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

63

188

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pzj-assembly1.cif.gz_A crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472 0.8633 8 170
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.859 2 170
8gxk-assembly2.cif.gz_C pseudomonas jinjuensis n-acetyltransferase 0.8393 4 170
3pzj-assembly1.cif.gz_B crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472 0.8322 8 170
8gxf-assembly2.cif.gz_C pseudomonas flexibilis gcn5 family acetyltransferase 0.827 6 170
ID Description Score Start End Superfamily
af_P40586_15_233_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8698 2 170 3.40.630.30
af_Q54U46_65_201_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8669 73 149 3.40.630.30
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8589 2 170 3.40.630.30
af_E7F6N3_74_217_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8514 74 155 3.40.630.30
af_Q869N8_82_281_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8442 2 170 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2V5PU38-F1-model_v4 GNAT family N-acetyltransferase 0.9922 1 171 GO:0016747
AF-A0A2V6M590-F1-model_v4 N-acetyltransferase 0.9864 1 128 GO:0016747
AF-A0A2W4IVQ1-F1-model_v4 N-acetyltransferase 0.9863 2 171 GO:0016747
AF-A0A162GFJ8-F1-model_v4 Acetyltransferase 0.9863 3 171 GO:0016747
AF-A0A7V7X1L8-F1-model_v4 GNAT family N-acetyltransferase 0.9861 6 143 GO:0016747

Map