F430010

General Info

Members Datasets Scaffolds Average Seq Length
384 219 384 109

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0532266|Ga0496109_0532266_567_899
Length 110
Sequence VPQSWTDKQERKYEHIVDSEKDSGVSEKRAKEIAARTVNKERAQKGQTKTASRSSVDDISSSRRGGLRSGRPGPRGRTRDQLYNEARQMGIKGRSSMNKAQLRRAVDAKK

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
114 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
115 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
116 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
117 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
118 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
119 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
120 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
121 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
199 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 3.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.94
Nodule 0.26
Rhizoplane 8.07
Rhizosphere 75.52
Stem 0
Stem Tuber 0
Unclassified 5.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100066613 3300005329 Bacteria 3355
2 Ga0070690_101327021 3300005330 Bacteria 577
3 Ga0070670_101335233 3300005331 Bacteria 657
4 Ga0070680_100878721 3300005336 Bacteria 773
5 Ga0070680_100965008 3300005336 Bacteria 736
6 Ga0068868_100152439 3300005338 Bacteria 1904
7 Ga0070660_100239398 3300005339 Bacteria 1478
8 Ga0070689_101618404 3300005340 Bacteria 588
9 Ga0070687_101430146 3300005343 Unclassified 518
10 Ga0070671_100000926 3300005355 Bacteria 21442
11 Ga0070703_10074026 3300005406 Bacteria 1144
12 Ga0070713_101314049 3300005436 Bacteria 701
13 Ga0070700_100187986 3300005441 Bacteria 1442
14 Ga0070694_100069345 3300005444 Bacteria 2425
15 Ga0070678_101972506 3300005456 Bacteria 552
16 Ga0070681_10089655 3300005458 Bacteria 3027
17 Ga0070681_10175838 3300005458 Bacteria 2063
18 Ga0070699_100856917 3300005518 Bacteria 832
19 Ga0070679_100079559 3300005530 Bacteria 3267
20 Ga0070684_100113814 3300005535 Bacteria 2428
21 Ga0070684_100549000 3300005535 Bacteria 1072
22 Ga0070695_100012543 3300005545 Bacteria 5088
23 Ga0070696_100056068 3300005546 Bacteria 2748
24 Ga0070665_100190954 3300005548 Bacteria 2049
25 Ga0070704_100115230 3300005549 Bacteria 2053
26 Ga0070704_101114791 3300005549 Bacteria 717
27 Ga0068856_100198638 3300005614 Bacteria 2020
28 Ga0070702_100524643 3300005615 Bacteria 874
29 Ga0068859_100065147 3300005617 Bacteria 3678
30 Ga0068870_10031184 3300005840 Bacteria 2699
31 Ga0068858_100259628 3300005842 Bacteria 1651
32 Ga0068860_100296148 3300005843 Bacteria 1584
33 Ga0068860_100514722 3300005843 Bacteria 1196
34 Ga0081455_10000760 3300005937 Bacteria 41934
35 Ga0075365_10193285 3300006038 Bacteria 1424
36 Ga0075368_10023483 3300006042 Bacteria 2356
37 Ga0075363_100017167 3300006048 Bacteria 3585
38 Ga0075363_100190942 3300006048 Unclassified 1168
39 Ga0075363_100841909 3300006048 Unclassified 559
40 Ga0075364_10001154 3300006051 Bacteria 14124
41 Ga0075364_10002443 3300006051 Bacteria 10410
42 Ga0075364_10009529 3300006051 Bacteria 5830
43 Ga0075364_10233182 3300006051 Bacteria 1250
44 Ga0075364_10601845 3300006051 Bacteria 751
45 Ga0075364_11255898 3300006051 Bacteria 502
46 Ga0075362_10058800 3300006177 Bacteria 1735
47 Ga0075367_10120107 3300006178 Bacteria 1619
48 Ga0075367_10194697 3300006178 Bacteria 1265
49 Ga0075367_10245808 3300006178 Bacteria 1121
50 Ga0075367_10327201 3300006178 Bacteria 966
51 Ga0075367_10667145 3300006178 Bacteria 661
52 Ga0075369_10157245 3300006186 Bacteria 1041
53 Ga0075427_10002290 3300006194 Bacteria 2555
54 Ga0075366_10452422 3300006195 Unclassified 792
55 Ga0075370_10208728 3300006353 Unclassified 1153
56 Ga0068871_100312845 3300006358 Bacteria 1381
57 Ga0068871_100925301 3300006358 Bacteria 809
58 Ga0075428_100241768 3300006844 Bacteria 1947
59 Ga0075428_101846670 3300006844 Bacteria 628
60 Ga0075430_100033121 3300006846 Bacteria 4386
61 Ga0075431_100062975 3300006847 Bacteria 3827
62 Ga0075431_100215062 3300006847 Bacteria 1962
63 Ga0075433_10084784 3300006852 Bacteria 2797
64 Ga0075434_100378603 3300006871 Bacteria 1436
65 Ga0075429_100039247 3300006880 Bacteria 4121
66 Ga0075429_100049412 3300006880 Bacteria 3657
67 Ga0075429_100770676 3300006880 Bacteria 843
68 Ga0068865_100116255 3300006881 Bacteria 1981
69 Ga0068865_100589952 3300006881 Bacteria 938
70 Ga0097620_100065146 3300006931 Bacteria 3678
71 Ga0105240_10551097 3300009093 Bacteria 1276
72 Ga0111539_10093311 3300009094 Bacteria 3536
73 Ga0111539_13407571 3300009094 Bacteria 511
74 Ga0105245_10269341 3300009098 Bacteria 1661
75 Ga0105245_10568004 3300009098 Bacteria 1158
76 Ga0105245_11197180 3300009098 Bacteria 808
77 Ga0105245_11559949 3300009098 Bacteria 712
78 Ga0105245_12730510 3300009098 Bacteria 547
79 Ga0114129_10071562 3300009147 Bacteria 4835
80 Ga0114129_10667219 3300009147 Bacteria 1340
81 Ga0114129_11013554 3300009147 Bacteria 1045
82 Ga0105242_10011248 3300009176 Bacteria 6877
83 Ga0105248_10778851 3300009177 Bacteria 1079
84 Ga0157374_10243695 3300013296 Bacteria 1768
85 Ga0157374_12432536 3300013296 Bacteria 551
86 Ga0157378_10499808 3300013297 Bacteria 1215
87 Ga0163162_11323166 3300013306 Bacteria 819
88 Ga0157375_10051107 3300013308 Bacteria 4058
89 Ga0157375_10595015 3300013308 Bacteria 1266
90 Ga0157375_10979402 3300013308 Bacteria 986
91 Ga0163163_10200381 3300014325 Bacteria 2044
92 Ga0163163_11506145 3300014325 Bacteria 734
93 Ga0157380_10893047 3300014326 Bacteria 914
94 Ga0182008_10037720 3300014497 Bacteria 2417
95 Ga0157379_10028164 3300014968 Bacteria 5001
96 Ga0157379_10169165 3300014968 Bacteria 1973
97 Ga0157379_11167844 3300014968 Bacteria 739
98 Ga0157376_10747331 3300014969 Bacteria 987
99 Ga0157376_11879929 3300014969 Bacteria 635
100 Ga0197907_10161822 3300020069 Bacteria 850
101 Ga0197907_10565082 3300020069 Bacteria 637
102 Ga0206356_10492103 3300020070 Bacteria 811
103 Ga0206349_1803813 3300020075 Bacteria 562
104 Ga0206349_1927451 3300020075 Bacteria 857
105 Ga0206351_10105139 3300020077 Bacteria 822
106 Ga0206350_11232733 3300020080 Bacteria 523
107 Ga0206350_11594340 3300020080 Bacteria 944
108 Ga0206354_10324666 3300020081 Bacteria 874
109 Ga0213876_10076543 3300021384 Bacteria 1767
110 Ga0213876_10166615 3300021384 Bacteria 1172
111 Ga0213875_10077592 3300021388 Bacteria 1550
112 Ga0213875_10278496 3300021388 Bacteria 790
113 Ga0224712_10013437 3300022467 Bacteria 2607
114 Ga0224712_10112030 3300022467 Bacteria 1171
115 Ga0224712_10457563 3300022467 Bacteria 613
116 Ga0224712_10557628 3300022467 Unclassified 557
117 Ga0224712_10582339 3300022467 Bacteria 545
118 Ga0207643_10134079 3300025908 Bacteria 1475
119 Ga0207643_10748337 3300025908 Bacteria 633
120 Ga0207684_11131273 3300025910 Bacteria 651
121 Ga0207707_10157660 3300025912 Bacteria 1985
122 Ga0207707_10440146 3300025912 Bacteria 1116
123 Ga0207695_10591417 3300025913 Bacteria 991
124 Ga0207660_10284187 3300025917 Bacteria 1314
125 Ga0207660_11269889 3300025917 Bacteria 598
126 Ga0207657_10065925 3300025919 Bacteria 3084
127 Ga0207652_10092462 3300025921 Bacteria 2661
128 Ga0207652_10785503 3300025921 Bacteria 846
129 Ga0207694_11827265 3300025924 Bacteria 510
130 Ga0207687_10225395 3300025927 Bacteria 1478
131 Ga0207687_10409117 3300025927 Bacteria 1117
132 Ga0207687_10903175 3300025927 Bacteria 756
133 Ga0207687_11514270 3300025927 Bacteria 576
134 Ga0207687_11621890 3300025927 Bacteria 555
135 Ga0207700_11376224 3300025928 Bacteria 628
136 Ga0207644_10010575 3300025931 Bacteria 6083
137 Ga0207686_10139702 3300025934 Bacteria 1672
138 Ga0207704_10065118 3300025938 Bacteria 2280
139 Ga0207704_10663571 3300025938 Bacteria 860
140 Ga0207661_10176665 3300025944 Bacteria 1862
141 Ga0207667_11172130 3300025949 Bacteria 749
142 Ga0207668_10472609 3300025972 Bacteria 1074
143 Ga0207658_10010916 3300025986 Bacteria 6183
144 Ga0207677_10611203 3300026023 Bacteria 958
145 Ga0207639_11343937 3300026041 Bacteria 671
146 Ga0207708_11416571 3300026075 Bacteria 610
147 Ga0207702_10159777 3300026078 Bacteria 2057
148 Ga0207676_12024040 3300026095 Bacteria 575
149 Ga0207683_10528730 3300026121 Bacteria 1090
150 Ga0209281_1010057 3300027111 Bacteria 2187
151 Ga0209813_10016400 3300027866 Bacteria 2022
152 Ga0207428_10007869 3300027907 Bacteria 9693
153 Ga0268266_10151604 3300028379 Bacteria 2090
154 Ga0268264_10719674 3300028381 Bacteria 992
155 Ga0268264_11247266 3300028381 Bacteria 753
156 Ga0265338_10362289 3300028800 Bacteria 1040
157 Ga0307513_10025323 3300031456 Bacteria 6878
158 Ga0307413_10934189 3300031824 Bacteria 739
159 Ga0307410_11506222 3300031852 Bacteria 593
160 Ga0373953_0079458 3300035117 Bacteria 1362
161 Ga0373955_0849997 3300035172 Bacteria 561
162 Ga0373947_0015066 3300035725 Bacteria 4438
163 Ga0373947_0130237 3300035725 Bacteria 1606
164 Ga0373937_0535969 3300036401 Bacteria 1112
165 Ga0395898_0183468 3300037466 Bacteria 2000
166 Ga0436364_0160302 3300037853 Bacteria 1547
167 Ga0436364_0391835 3300037853 Bacteria 1018
168 Ga0436364_0462710 3300037853 Bacteria 1602
169 Ga0436364_1164286 3300037853 Bacteria 1708
170 Ga0395901_0083174 3300038443 Bacteria 3346
171 Ga0395901_0819764 3300038443 Bacteria 918
172 Ga0436365_1100848 3300039437 Bacteria 4190
173 Ga0436365_1217675 3300039437 Bacteria 3372
174 Ga0436365_1734830 3300039437 Bacteria 630
175 Ga0436365_1932659 3300039437 Bacteria 798
176 Ga0451793_0062388 3300041452 Bacteria 3701
177 Ga0451795_0710663 3300041456 Bacteria 557
178 Ga0451795_1159164 3300041456 Bacteria 562
179 Ga0451833_0248386 3300041491 Bacteria 2590
180 Ga0451835_0593694 3300041492 Unclassified 534
181 Ga0451837_0142623 3300041494 Bacteria 642
182 Ga0451837_0547857 3300041494 Bacteria 3360
183 Ga0451839_0027519 3300041496 Bacteria 1593
184 Ga0451845_0346553 3300041501 Bacteria 1253
185 Ga0439448_0121935 3300042005 Bacteria 895
186 Ga0439459_0172375 3300042438 Bacteria 577
187 Ga0466969_0069410 3300044656 Bacteria 1697
188 Ga0466969_0082870 3300044656 Bacteria 1528
189 Ga0466965_0273910 3300044683 Bacteria 910
190 Ga0466966_0150176 3300044684 Bacteria 1421
191 Ga0466966_0175819 3300044684 Bacteria 1300
192 Ga0466961_0001587 3300044693 Bacteria 14097
193 Ga0466961_0003551 3300044693 Bacteria 9729
194 Ga0466961_0011497 3300044693 Bacteria 5661
195 Ga0466961_0034858 3300044693 Bacteria 3232
196 Ga0466961_0120706 3300044693 Bacteria 1646
197 Ga0466961_0305377 3300044693 Bacteria 971
198 Ga0466963_0821589 3300044694 Bacteria 655
199 Ga0466964_0255759 3300044706 Bacteria 865
200 Ga0466964_0444663 3300044706 Bacteria 686
201 Ga0466971_0097947 3300044719 Bacteria 1346
202 Ga0466970_0404183 3300044765 Bacteria 779
203 Ga0466970_0665882 3300044765 Bacteria 606
204 Ga0466957_0041300 3300044842 Bacteria 2789
205 Ga0466957_0460273 3300044842 Bacteria 878
206 Ga0466960_0020089 3300044901 Bacteria 2954
207 Ga0466960_0129094 3300044901 Bacteria 1332
208 Ga0466960_0289448 3300044901 Bacteria 920
209 Ga0466959_0053544 3300045049 Bacteria 2950
210 Ga0466959_0182380 3300045049 Bacteria 1468
211 Ga0466959_0529114 3300045049 Bacteria 796
212 Ga0466958_0057761 3300045836 Bacteria 2358
213 Ga0466958_0291727 3300045836 Bacteria 1046
214 Ga0466967_0012238 3300045976 Bacteria 6552
215 Ga0466967_0772693 3300045976 Bacteria 953
216 Ga0466967_0920028 3300045976 Bacteria 870
217 Ga0466967_1060319 3300045976 Bacteria 807
218 Ga0466967_1512542 3300045976 Bacteria 668
219 Ga0466967_1526430 3300045976 Bacteria 665
220 Ga0495641_0111987 3300046461 Bacteria 1218
221 Ga0495641_0121630 3300046461 Bacteria 1165
222 Ga0495653_0571839 3300046463 Bacteria 697
223 Ga0495662_0094798 3300046476 Bacteria 1458
224 Ga0495608_0619838 3300046511 Bacteria 648
225 Ga0495618_0367086 3300046514 Bacteria 885
226 Ga0495630_0205630 3300046517 Bacteria 1503
227 Ga0495654_0303043 3300046530 Bacteria 652
228 Ga0495640_0169568 3300046533 Bacteria 1395
229 Ga0495586_0190511 3300046535 Bacteria 1161
230 Ga0495634_0209534 3300046642 Bacteria 1207
231 Ga0495623_0358345 3300046679 Bacteria 793
232 Ga0495658_0108320 3300046683 Bacteria 1667
233 Ga0495669_0012474 3300046684 Bacteria 3618
234 Ga0495613_0110633 3300046689 Bacteria 1979
235 Ga0495624_0415653 3300046690 Bacteria 807
236 Ga0495674_0109592 3300047319 Bacteria 2342
237 Ga0495680_0153987 3300047322 Bacteria 1674
238 Ga0495680_0520761 3300047322 Bacteria 805
239 Ga0496101_0534161 3300048904 Bacteria 927
240 Ga0496101_0773126 3300048904 Bacteria 758
241 Ga0496102_0569330 3300048905 Bacteria 1056
242 Ga0496103_0916157 3300048906 Bacteria 549
243 Ga0496104_0355063 3300048907 Bacteria 1378
244 Ga0496105_0141414 3300048908 Bacteria 1981
245 Ga0496105_0185637 3300048908 Bacteria 1702
246 Ga0496105_1090942 3300048908 Bacteria 593
247 Ga0496108_0014096 3300048911 Bacteria 6520
248 Ga0496108_0083829 3300048911 Bacteria 2704
249 Ga0496109_0009575 3300048912 Bacteria 8262
250 Ga0496109_0018038 3300048912 Bacteria 6195
251 Ga0496109_0076904 3300048912 Bacteria 3071
252 Ga0496109_0532266 3300048912 Bacteria 1109
253 Ga0496110_0004237 3300048913 Bacteria 11099
254 Ga0496110_0143337 3300048913 Bacteria 2160
255 Ga0496110_1110268 3300048913 Bacteria 699
256 Ga0496111_0201797 3300048914 Bacteria 1478
257 Ga0496111_0366089 3300048914 Bacteria 1067
258 Ga0496112_0060217 3300048915 Bacteria 3741
259 Ga0496112_0157067 3300048915 Bacteria 2241
260 Ga0496112_0229232 3300048915 Bacteria 1812
261 Ga0496112_0514533 3300048915 Bacteria 1132
262 Ga0496113_0017492 3300048916 Bacteria 4977
263 Ga0496113_0149480 3300048916 Bacteria 1842
264 Ga0496113_0196594 3300048916 Bacteria 1602
265 Ga0496115_0076542 3300048918 Bacteria 2720
266 Ga0496115_0240599 3300048918 Bacteria 1491
267 Ga0496126_0000039 3300048929 Bacteria 347353
268 Ga0501031_0017861 3300049568 Bacteria 4613
269 Ga0501031_0044667 3300049568 Bacteria 2892
270 Ga0501032_0013879 3300049569 Bacteria 5715
271 Ga0501032_0033440 3300049569 Bacteria 3523
272 Ga0501033_0806435 3300049570 Bacteria 634
273 Ga0501033_0924333 3300049570 Bacteria 585
274 Ga0501034_0008521 3300049571 Bacteria 10822
275 Ga0501034_0111524 3300049571 Bacteria 2726
276 Ga0501034_0560404 3300049571 Bacteria 1051
277 Ga0501036_0149759 3300049572 Bacteria 1968
278 Ga0501036_0302536 3300049572 Bacteria 1337
279 Ga0501036_0979355 3300049572 Bacteria 693
280 Ga0501037_0004581 3300049573 Bacteria 10045
281 Ga0501037_0536866 3300049573 Bacteria 790
282 Ga0501038_0106709 3300049574 Bacteria 2324
283 Ga0501039_0011408 3300049575 Bacteria 6765
284 Ga0501039_0062306 3300049575 Bacteria 2889
285 Ga0501040_0008355 3300049576 Bacteria 6730
286 Ga0501041_0008407 3300049577 Bacteria 6069
287 Ga0501042_0002391 3300049578 Bacteria 11504
288 Ga0501042_0040447 3300049578 Bacteria 3314
289 Ga0501042_0495965 3300049578 Bacteria 887
290 Ga0501043_0049507 3300049579 Bacteria 3303
291 Ga0501043_0203813 3300049579 Bacteria 1534
292 Ga0501046_0012529 3300049580 Bacteria 7212
293 Ga0501046_0031901 3300049580 Bacteria 4269
294 Ga0501047_0042800 3300049581 Bacteria 4375
295 Ga0501048_0011553 3300049582 Bacteria 6584
296 Ga0501048_0171075 3300049582 Bacteria 1539
297 Ga0501067_0470147 3300049583 Bacteria 703
298 Ga0501068_0275041 3300049584 Bacteria 1075
299 Ga0501068_0447238 3300049584 Bacteria 836
300 Ga0501068_0694144 3300049584 Bacteria 665
301 Ga0501069_0002130 3300049585 Bacteria 9967
302 Ga0501069_0045845 3300049585 Bacteria 2423
303 Ga0501069_0215071 3300049585 Bacteria 1116
304 Ga0501069_0684356 3300049585 Bacteria 618
305 Ga0501070_0015784 3300049586 Bacteria 6351
306 Ga0501070_0296736 3300049586 Bacteria 1317
307 Ga0501071_0009760 3300049587 Bacteria 6404
308 Ga0501071_0651809 3300049587 Bacteria 810
309 Ga0501071_0756543 3300049587 Bacteria 749
310 Ga0501071_0760661 3300049587 Bacteria 746
311 Ga0501072_0034965 3300049588 Bacteria 3938
312 Ga0501072_0166019 3300049588 Bacteria 1761
313 Ga0501072_0376592 3300049588 Bacteria 1126
314 Ga0501072_1205718 3300049588 Bacteria 588
315 Ga0501073_0016117 3300049589 Bacteria 5417
316 Ga0501074_0013149 3300049590 Bacteria 6019
317 Ga0501074_0149451 3300049590 Bacteria 1670
318 Ga0501075_0055777 3300049591 Bacteria 2973
319 Ga0501075_0169256 3300049591 Unclassified 1667
320 Ga0501075_0633926 3300049591 Bacteria 815
321 Ga0501076_0002923 3300049592 Bacteria 11845
322 Ga0501076_1253438 3300049592 Bacteria 610
323 Ga0501077_0027616 3300049593 Bacteria 3603
324 Ga0501077_0334629 3300049593 Bacteria 965
325 Ga0501079_0015056 3300049741 Bacteria 5896
326 Ga0501079_0074417 3300049741 Bacteria 2625
327 Ga0501080_0598104 3300049742 Bacteria 979
328 Ga0501080_0885388 3300049742 Unclassified 779
329 Ga0501080_1301353 3300049742 Bacteria 622
330 Ga0501081_0005035 3300049743 Bacteria 8504
331 Ga0501081_0096721 3300049743 Unclassified 2083
332 Ga0501081_0288916 3300049743 Bacteria 1201
333 Ga0501083_0206029 3300049744 Bacteria 1282
334 Ga0501035_0013890 3300049822 Bacteria 7430
335 Ga0501035_0178209 3300049822 Bacteria 1832
336 Ga0501044_1175610 3300049823 Bacteria 635
337 Ga0501044_1206328 3300049823 Bacteria 624
338 Ga0501045_0004045 3300049824 Bacteria 10113
339 Ga0501045_0493286 3300049824 Bacteria 909
340 nmdc:mga03683_16677_c1 3300050489 Bacteria 2764
341 nmdc:mga03683_611455_c1 3300050489 Bacteria 534
342 nmdc:mga03n38_125904_c1 3300050490 Bacteria 1264
343 nmdc:mga03n38_88723_c1 3300050490 Bacteria 1468
344 nmdc:mga00v17_27615_c1 3300050491 Bacteria 3316
345 nmdc:mga00v17_287026_c1 3300050491 Bacteria 1068
346 nmdc:mga00v17_62436_c2 3300050491 Bacteria 1889
347 nmdc:mga00v17_740599_c1 3300050491 Bacteria 629
348 nmdc:mga00v17_759197_c1 3300050491 Bacteria 619
349 nmdc:mga0yw44_137265_c1 3300050492 Bacteria 1587
350 nmdc:mga0yw44_13998_c1 3300050492 Bacteria 4243
351 nmdc:mga0k408_652836_c1 3300050493 Unclassified 618
352 nmdc:mga06z11_123500_c1 3300050494 Bacteria 1447
353 nmdc:mga06z11_464010_c1 3300050494 Bacteria 766
354 nmdc:mga06z11_51211_c1 3300050494 Bacteria 2113
355 nmdc:mga06z11_648001_c1 3300050494 Bacteria 643
356 nmdc:mga06z11_72925_c1 3300050494 Bacteria 1821
357 nmdc:mga04h51_49932_c1 3300050495 Bacteria 1400
358 nmdc:mga04h51_90838_c1 3300050495 Bacteria 1098
359 nmdc:mga07m45_335813_c1 3300050496 Unclassified 878
360 nmdc:mga05p37_38278_c1 3300050507 Bacteria 5883
361 nmdc:mga05p37_54118_c1 3300050507 Bacteria 4938
362 nmdc:mga09592_176555_c1 3300050508 Bacteria 1847
363 nmdc:mga09592_237326_c1 3300050508 Bacteria 1580
364 nmdc:mga09592_30133_c1 3300050508 Bacteria 4515
365 nmdc:mga0qj67_143282_c1 3300050509 Bacteria 1938
366 nmdc:mga06r32_195144_c1 3300050510 Bacteria 2012
367 nmdc:mga06r32_475879_c1 3300050510 Bacteria 1227
368 nmdc:mga06r32_976437_c1 3300050510 Bacteria 801
369 nmdc:mga08y16_3013_c1 3300050511 Bacteria 17384
370 nmdc:mga0n895_20953_c1 3300050512 Bacteria 6106
371 nmdc:mga0a205_507477_c1 3300050515 Bacteria 1063
372 nmdc:mga0a205_80737_c1 3300050515 Bacteria 3142
373 Ga0495612_0090653 3300053078 Bacteria 1294
374 Ga0495619_0161068 3300053085 Bacteria 1550
375 Ga0500573_0007739 3300053140 Bacteria 5880
376 Ga0501084_0087507 3300054114 Bacteria 2615
377 Ga0501084_0823433 3300054114 Bacteria 781
378 Ga0501082_0041621 3300060353 Bacteria 3961
379 Ga0501082_0154391 3300060353 Bacteria 1995
380 Ga0501082_0418029 3300060353 Bacteria 1171
381 Ga0501082_0609272 3300060353 Bacteria 955
382 Ga0466962_0042373 3300061719 Bacteria 2179
383 Ga0530510_0080550 3300061734 Bacteria 2370
384 Ga0530510_0457275 3300061734 Bacteria 965

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10025323 Ga0307513_100253233 106
2 3300035117 Ga0373953_0079458 Ga0373953_0079458_884_1204 106
3 3300046511 Ga0495608_0619838 Ga0495608_0619838_281_607 106
4 3300046679 Ga0495623_0358345 Ga0495623_0358345_222_542 106
5 3300046684 Ga0495669_0012474 Ga0495669_0012474_2138_2461 106
6 3300048908 Ga0496105_0185637 Ga0496105_0185637_921_1253 106
7 3300048912 Ga0496109_0532266 Ga0496109_0532266_567_899 106
8 3300005329 Ga0070683_100066613 Ga0070683_1000666132 107
9 3300005330 Ga0070690_101327021 Ga0070690_1013270211 107
10 3300005331 Ga0070670_101335233 Ga0070670_1013352332 107
11 3300005336 Ga0070680_100878721 Ga0070680_1008787212 107
12 3300005336 Ga0070680_100965008 Ga0070680_1009650081 107
13 3300005338 Ga0068868_100152439 Ga0068868_1001524393 107
14 3300005339 Ga0070660_100239398 Ga0070660_1002393981 107
15 3300005340 Ga0070689_101618404 Ga0070689_1016184042 107
16 3300005343 Ga0070687_101430146 Ga0070687_1014301461 107
17 3300005355 Ga0070671_100000926 Ga0070671_10000092615 107
18 3300005406 Ga0070703_10074026 Ga0070703_100740262 107
19 3300005436 Ga0070713_101314049 Ga0070713_1013140492 107
20 3300005441 Ga0070700_100187986 Ga0070700_1001879862 107
21 3300005444 Ga0070694_100069345 Ga0070694_1000693452 107
22 3300005456 Ga0070678_101972506 Ga0070678_1019725062 107
23 3300005458 Ga0070681_10089655 Ga0070681_100896552 107
24 3300005458 Ga0070681_10175838 Ga0070681_101758383 107
25 3300005518 Ga0070699_100856917 Ga0070699_1008569172 107
26 3300005530 Ga0070679_100079559 Ga0070679_1000795593 107
27 3300005535 Ga0070684_100113814 Ga0070684_1001138146 107
28 3300005535 Ga0070684_100549000 Ga0070684_1005490002 107
29 3300005545 Ga0070695_100012543 Ga0070695_1000125433 107
30 3300005546 Ga0070696_100056068 Ga0070696_1000560683 107
31 3300005548 Ga0070665_100190954 Ga0070665_1001909542 107
32 3300005549 Ga0070704_100115230 Ga0070704_1001152302 107
33 3300005549 Ga0070704_101114791 Ga0070704_1011147911 107
34 3300005614 Ga0068856_100198638 Ga0068856_1001986383 107
35 3300005615 Ga0070702_100524643 Ga0070702_1005246431 107
36 3300005617 Ga0068859_100065147 Ga0068859_1000651474 107
37 3300005840 Ga0068870_10031184 Ga0068870_100311846 107
38 3300005842 Ga0068858_100259628 Ga0068858_1002596282 107
39 3300005843 Ga0068860_100296148 Ga0068860_1002961483 107
40 3300005843 Ga0068860_100514722 Ga0068860_1005147222 107
41 3300005937 Ga0081455_10000760 Ga0081455_1000076021 107
42 3300006038 Ga0075365_10193285 Ga0075365_101932853 107
43 3300006042 Ga0075368_10023483 Ga0075368_100234833 107
44 3300006048 Ga0075363_100017167 Ga0075363_1000171671 107
45 3300006048 Ga0075363_100190942 Ga0075363_1001909422 107
46 3300006048 Ga0075363_100841909 Ga0075363_1008419091 107
47 3300006051 Ga0075364_10001154 Ga0075364_1000115411 107
48 3300006051 Ga0075364_10002443 Ga0075364_100024436 107
49 3300006051 Ga0075364_10009529 Ga0075364_100095293 107
50 3300006051 Ga0075364_10233182 Ga0075364_102331822 107
51 3300006051 Ga0075364_10601845 Ga0075364_106018453 107
52 3300006051 Ga0075364_11255898 Ga0075364_112558981 107
53 3300006177 Ga0075362_10058800 Ga0075362_100588002 107
54 3300006178 Ga0075367_10120107 Ga0075367_101201072 107
55 3300006178 Ga0075367_10194697 Ga0075367_101946972 107
56 3300006178 Ga0075367_10245808 Ga0075367_102458082 107
57 3300006178 Ga0075367_10327201 Ga0075367_103272012 107
58 3300006178 Ga0075367_10667145 Ga0075367_106671452 107
59 3300006186 Ga0075369_10157245 Ga0075369_101572451 107
60 3300006194 Ga0075427_10002290 Ga0075427_100022905 107
61 3300006195 Ga0075366_10452422 Ga0075366_104524222 107
62 3300006353 Ga0075370_10208728 Ga0075370_102087282 107
63 3300006358 Ga0068871_100312845 Ga0068871_1003128452 107
64 3300006358 Ga0068871_100925301 Ga0068871_1009253012 107
65 3300006844 Ga0075428_100241768 Ga0075428_1002417684 107
66 3300006844 Ga0075428_101846670 Ga0075428_1018466702 107
67 3300006846 Ga0075430_100033121 Ga0075430_1000331212 107
68 3300006847 Ga0075431_100062975 Ga0075431_1000629757 107
69 3300006847 Ga0075431_100215062 Ga0075431_1002150622 107
70 3300006852 Ga0075433_10084784 Ga0075433_100847847 107
71 3300006871 Ga0075434_100378603 Ga0075434_1003786031 107
72 3300006880 Ga0075429_100039247 Ga0075429_1000392477 107
73 3300006880 Ga0075429_100049412 Ga0075429_1000494121 107
74 3300006880 Ga0075429_100770676 Ga0075429_1007706761 107
75 3300006881 Ga0068865_100116255 Ga0068865_1001162553 107
76 3300006881 Ga0068865_100589952 Ga0068865_1005899523 107
77 3300006931 Ga0097620_100065146 Ga0097620_1000651464 107
78 3300009093 Ga0105240_10551097 Ga0105240_105510972 107
79 3300009094 Ga0111539_10093311 Ga0111539_100933112 107
80 3300009094 Ga0111539_13407571 Ga0111539_134075711 107
81 3300009098 Ga0105245_10269341 Ga0105245_102693412 107
82 3300009098 Ga0105245_10568004 Ga0105245_105680042 107
83 3300009098 Ga0105245_11197180 Ga0105245_111971802 107
84 3300009098 Ga0105245_11559949 Ga0105245_115599492 107
85 3300009098 Ga0105245_12730510 Ga0105245_127305101 107
86 3300009147 Ga0114129_10071562 Ga0114129_100715622 107
87 3300009147 Ga0114129_10667219 Ga0114129_106672192 107
88 3300009147 Ga0114129_11013554 Ga0114129_110135542 107
89 3300009176 Ga0105242_10011248 Ga0105242_100112487 107
90 3300009177 Ga0105248_10778851 Ga0105248_107788512 107
91 3300013296 Ga0157374_10243695 Ga0157374_102436952 107
92 3300013296 Ga0157374_12432536 Ga0157374_124325362 107
93 3300013297 Ga0157378_10499808 Ga0157378_104998082 107
94 3300013306 Ga0163162_11323166 Ga0163162_113231662 107
95 3300013308 Ga0157375_10051107 Ga0157375_100511076 107
96 3300013308 Ga0157375_10595015 Ga0157375_105950152 107
97 3300013308 Ga0157375_10979402 Ga0157375_109794022 107
98 3300014325 Ga0163163_10200381 Ga0163163_102003812 107
99 3300014325 Ga0163163_11506145 Ga0163163_115061451 107
100 3300014326 Ga0157380_10893047 Ga0157380_108930472 107
101 3300014497 Ga0182008_10037720 Ga0182008_100377203 107
102 3300014968 Ga0157379_10028164 Ga0157379_100281645 107
103 3300014968 Ga0157379_10169165 Ga0157379_101691651 107
104 3300014968 Ga0157379_11167844 Ga0157379_111678441 107
105 3300014969 Ga0157376_10747331 Ga0157376_107473312 107
106 3300014969 Ga0157376_11879929 Ga0157376_118799291 107
107 3300020069 Ga0197907_10161822 Ga0197907_101618222 107
108 3300020069 Ga0197907_10565082 Ga0197907_105650821 107
109 3300020070 Ga0206356_10492103 Ga0206356_104921031 107
110 3300020075 Ga0206349_1803813 Ga0206349_18038132 107
111 3300020075 Ga0206349_1927451 Ga0206349_19274512 107
112 3300020077 Ga0206351_10105139 Ga0206351_101051392 107
113 3300020080 Ga0206350_11232733 Ga0206350_112327331 107
114 3300020080 Ga0206350_11594340 Ga0206350_115943402 107
115 3300020081 Ga0206354_10324666 Ga0206354_103246662 107
116 3300021384 Ga0213876_10076543 Ga0213876_100765432 107
117 3300021384 Ga0213876_10166615 Ga0213876_101666152 107
118 3300021388 Ga0213875_10077592 Ga0213875_100775922 107
119 3300021388 Ga0213875_10278496 Ga0213875_102784961 107
120 3300022467 Ga0224712_10013437 Ga0224712_100134373 107
121 3300022467 Ga0224712_10112030 Ga0224712_101120302 107
122 3300022467 Ga0224712_10457563 Ga0224712_104575632 107
123 3300022467 Ga0224712_10557628 Ga0224712_105576282 107
124 3300022467 Ga0224712_10582339 Ga0224712_105823392 107
125 3300025908 Ga0207643_10134079 Ga0207643_101340793 107
126 3300025908 Ga0207643_10748337 Ga0207643_107483372 107
127 3300025910 Ga0207684_11131273 Ga0207684_111312731 107
128 3300025912 Ga0207707_10157660 Ga0207707_101576602 107
129 3300025912 Ga0207707_10440146 Ga0207707_104401462 107
130 3300025913 Ga0207695_10591417 Ga0207695_105914172 107
131 3300025917 Ga0207660_10284187 Ga0207660_102841872 107
132 3300025917 Ga0207660_11269889 Ga0207660_112698891 107
133 3300025919 Ga0207657_10065925 Ga0207657_100659251 107
134 3300025921 Ga0207652_10092462 Ga0207652_100924621 107
135 3300025921 Ga0207652_10785503 Ga0207652_107855032 107
136 3300025924 Ga0207694_11827265 Ga0207694_118272651 107
137 3300025927 Ga0207687_10225395 Ga0207687_102253953 107
138 3300025927 Ga0207687_10409117 Ga0207687_104091172 107
139 3300025927 Ga0207687_10903175 Ga0207687_109031752 107
140 3300025927 Ga0207687_11514270 Ga0207687_115142702 107
141 3300025927 Ga0207687_11621890 Ga0207687_116218901 107
142 3300025928 Ga0207700_11376224 Ga0207700_113762241 107
143 3300025931 Ga0207644_10010575 Ga0207644_1001057511 107
144 3300025934 Ga0207686_10139702 Ga0207686_101397023 107
145 3300025938 Ga0207704_10065118 Ga0207704_100651181 107
146 3300025938 Ga0207704_10663571 Ga0207704_106635712 107
147 3300025944 Ga0207661_10176665 Ga0207661_101766652 107
148 3300025949 Ga0207667_11172130 Ga0207667_111721301 107
149 3300025972 Ga0207668_10472609 Ga0207668_104726092 107
150 3300025986 Ga0207658_10010916 Ga0207658_100109162 107
151 3300026023 Ga0207677_10611203 Ga0207677_106112032 107
152 3300026041 Ga0207639_11343937 Ga0207639_113439372 107
153 3300026075 Ga0207708_11416571 Ga0207708_114165711 107
154 3300026078 Ga0207702_10159777 Ga0207702_101597773 107
155 3300026095 Ga0207676_12024040 Ga0207676_120240402 107
156 3300026121 Ga0207683_10528730 Ga0207683_105287302 107
157 3300027111 Ga0209281_1010057 Ga0209281_10100575 107
158 3300027866 Ga0209813_10016400 Ga0209813_100164003 107
159 3300027907 Ga0207428_10007869 Ga0207428_1000786910 107
160 3300028379 Ga0268266_10151604 Ga0268266_101516043 107
161 3300028381 Ga0268264_10719674 Ga0268264_107196743 107
162 3300028381 Ga0268264_11247266 Ga0268264_112472662 107
163 3300028800 Ga0265338_10362289 Ga0265338_103622892 107
164 3300031824 Ga0307413_10934189 Ga0307413_109341892 107
165 3300031852 Ga0307410_11506222 Ga0307410_115062222 107
166 3300035172 Ga0373955_0849997 Ga0373955_0849997_17_343 107
167 3300035725 Ga0373947_0015066 Ga0373947_0015066_2857_3183 107
168 3300035725 Ga0373947_0130237 Ga0373947_0130237_759_1088 107
169 3300036401 Ga0373937_0535969 Ga0373937_0535969_754_1080 107
170 3300037466 Ga0395898_0183468 Ga0395898_0183468_356_682 107
171 3300037853 Ga0436364_0160302 Ga0436364_0160302_783_1112 107
172 3300037853 Ga0436364_0391835 Ga0436364_0391835_140_466 107
173 3300037853 Ga0436364_0462710 Ga0436364_0462710_481_807 107
174 3300037853 Ga0436364_1164286 Ga0436364_1164286_1200_1544 107
175 3300038443 Ga0395901_0083174 Ga0395901_0083174_2573_2899 107
176 3300038443 Ga0395901_0819764 Ga0395901_0819764_306_644 107
177 3300039437 Ga0436365_1100848 Ga0436365_1100848_3707_4036 107
178 3300039437 Ga0436365_1217675 Ga0436365_1217675_549_875 107
179 3300039437 Ga0436365_1734830 Ga0436365_1734830_231_557 107
180 3300039437 Ga0436365_1932659 Ga0436365_1932659_218_544 107
181 3300041452 Ga0451793_0062388 Ga0451793_0062388_1378_1704 107
182 3300041456 Ga0451795_0710663 Ga0451795_0710663_159_485 107
183 3300041456 Ga0451795_1159164 Ga0451795_1159164_122_445 107
184 3300041491 Ga0451833_0248386 Ga0451833_0248386_2090_2416 107
185 3300041492 Ga0451835_0593694 Ga0451835_0593694_89_421 107
186 3300041494 Ga0451837_0142623 Ga0451837_0142623_183_509 107
187 3300041494 Ga0451837_0547857 Ga0451837_0547857_796_1122 107
188 3300041496 Ga0451839_0027519 Ga0451839_0027519_141_467 107
189 3300041501 Ga0451845_0346553 Ga0451845_0346553_746_1072 107
190 3300042005 Ga0439448_0121935 Ga0439448_0121935_116_439 107
191 3300042438 Ga0439459_0172375 Ga0439459_0172375_42_368 107
192 3300044656 Ga0466969_0069410 Ga0466969_0069410_202_528 107
193 3300044656 Ga0466969_0082870 Ga0466969_0082870_520_843 107
194 3300044683 Ga0466965_0273910 Ga0466965_0273910_297_626 107
195 3300044684 Ga0466966_0150176 Ga0466966_0150176_615_950 107
196 3300044684 Ga0466966_0175819 Ga0466966_0175819_929_1285 107
197 3300044693 Ga0466961_0001587 Ga0466961_0001587_6941_7264 107
198 3300044693 Ga0466961_0003551 Ga0466961_0003551_4795_5121 107
199 3300044693 Ga0466961_0011497 Ga0466961_0011497_73_429 107
200 3300044693 Ga0466961_0034858 Ga0466961_0034858_2817_3143 107
201 3300044693 Ga0466961_0120706 Ga0466961_0120706_97_426 107
202 3300044693 Ga0466961_0305377 Ga0466961_0305377_10_399 107
203 3300044694 Ga0466963_0821589 Ga0466963_0821589_190_519 107
204 3300044706 Ga0466964_0255759 Ga0466964_0255759_480_806 107
205 3300044706 Ga0466964_0444663 Ga0466964_0444663_237_566 107
206 3300044719 Ga0466971_0097947 Ga0466971_0097947_389_742 107
207 3300044765 Ga0466970_0404183 Ga0466970_0404183_325_660 107
208 3300044765 Ga0466970_0665882 Ga0466970_0665882_182_571 107
209 3300044842 Ga0466957_0041300 Ga0466957_0041300_243_569 107
210 3300044842 Ga0466957_0460273 Ga0466957_0460273_490_819 107
211 3300044901 Ga0466960_0020089 Ga0466960_0020089_983_1309 107
212 3300044901 Ga0466960_0129094 Ga0466960_0129094_813_1142 107
213 3300044901 Ga0466960_0289448 Ga0466960_0289448_35_364 107
214 3300045049 Ga0466959_0053544 Ga0466959_0053544_869_1204 107
215 3300045049 Ga0466959_0182380 Ga0466959_0182380_499_825 107
216 3300045049 Ga0466959_0529114 Ga0466959_0529114_216_542 107
217 3300045836 Ga0466958_0057761 Ga0466958_0057761_1866_2222 107
218 3300045836 Ga0466958_0291727 Ga0466958_0291727_118_444 107
219 3300045976 Ga0466967_0012238 Ga0466967_0012238_1915_2241 107
220 3300045976 Ga0466967_0772693 Ga0466967_0772693_21_347 107
221 3300045976 Ga0466967_0920028 Ga0466967_0920028_366_692 107
222 3300045976 Ga0466967_1060319 Ga0466967_1060319_71_400 107
223 3300045976 Ga0466967_1512542 Ga0466967_1512542_306_635 107
224 3300045976 Ga0466967_1526430 Ga0466967_1526430_312_638 107
225 3300046461 Ga0495641_0111987 Ga0495641_0111987_824_1150 107
226 3300046461 Ga0495641_0121630 Ga0495641_0121630_176_505 107
227 3300046463 Ga0495653_0571839 Ga0495653_0571839_348_674 107
228 3300046476 Ga0495662_0094798 Ga0495662_0094798_736_1059 107
229 3300046514 Ga0495618_0367086 Ga0495618_0367086_88_411 107
230 3300046517 Ga0495630_0205630 Ga0495630_0205630_809_1135 107
231 3300046530 Ga0495654_0303043 Ga0495654_0303043_289_615 107
232 3300046533 Ga0495640_0169568 Ga0495640_0169568_277_600 107
233 3300046535 Ga0495586_0190511 Ga0495586_0190511_102_425 107
234 3300046642 Ga0495634_0209534 Ga0495634_0209534_585_908 107
235 3300046683 Ga0495658_0108320 Ga0495658_0108320_873_1202 107
236 3300046689 Ga0495613_0110633 Ga0495613_0110633_1035_1358 107
237 3300046690 Ga0495624_0415653 Ga0495624_0415653_136_462 107
238 3300047319 Ga0495674_0109592 Ga0495674_0109592_1031_1357 107
239 3300047322 Ga0495680_0153987 Ga0495680_0153987_1037_1360 107
240 3300047322 Ga0495680_0520761 Ga0495680_0520761_454_780 107
241 3300048904 Ga0496101_0534161 Ga0496101_0534161_493_822 107
242 3300048904 Ga0496101_0773126 Ga0496101_0773126_324_650 107
243 3300048905 Ga0496102_0569330 Ga0496102_0569330_80_406 107
244 3300048906 Ga0496103_0916157 Ga0496103_0916157_141_467 107
245 3300048907 Ga0496104_0355063 Ga0496104_0355063_658_984 107
246 3300048908 Ga0496105_0141414 Ga0496105_0141414_296_622 107
247 3300048908 Ga0496105_1090942 Ga0496105_1090942_82_411 107
248 3300048911 Ga0496108_0014096 Ga0496108_0014096_4365_4691 107
249 3300048911 Ga0496108_0083829 Ga0496108_0083829_629_958 107
250 3300048912 Ga0496109_0009575 Ga0496109_0009575_5434_5763 107
251 3300048912 Ga0496109_0018038 Ga0496109_0018038_866_1192 107
252 3300048912 Ga0496109_0076904 Ga0496109_0076904_109_435 107
253 3300048913 Ga0496110_0004237 Ga0496110_0004237_2190_2519 107
254 3300048913 Ga0496110_0143337 Ga0496110_0143337_230_556 107
255 3300048913 Ga0496110_1110268 Ga0496110_1110268_312_638 107
256 3300048914 Ga0496111_0201797 Ga0496111_0201797_23_349 107
257 3300048914 Ga0496111_0366089 Ga0496111_0366089_134_460 107
258 3300048915 Ga0496112_0060217 Ga0496112_0060217_238_564 107
259 3300048915 Ga0496112_0157067 Ga0496112_0157067_1609_1938 107
260 3300048915 Ga0496112_0229232 Ga0496112_0229232_1388_1717 107
261 3300048915 Ga0496112_0514533 Ga0496112_0514533_131_457 107
262 3300048916 Ga0496113_0017492 Ga0496113_0017492_857_1183 107
263 3300048916 Ga0496113_0149480 Ga0496113_0149480_1229_1558 107
264 3300048916 Ga0496113_0196594 Ga0496113_0196594_915_1241 107
265 3300048918 Ga0496115_0076542 Ga0496115_0076542_612_935 107
266 3300048918 Ga0496115_0240599 Ga0496115_0240599_372_701 107
267 3300048929 Ga0496126_0000039 Ga0496126_0000039_31584_31910 107
268 3300049568 Ga0501031_0017861 Ga0501031_0017861_3910_4257 107
269 3300049568 Ga0501031_0044667 Ga0501031_0044667_529_855 107
270 3300049569 Ga0501032_0013879 Ga0501032_0013879_1861_2208 107
271 3300049569 Ga0501032_0033440 Ga0501032_0033440_2990_3337 107
272 3300049570 Ga0501033_0806435 Ga0501033_0806435_253_600 107
273 3300049570 Ga0501033_0924333 Ga0501033_0924333_74_421 107
274 3300049571 Ga0501034_0008521 Ga0501034_0008521_4184_4531 107
275 3300049571 Ga0501034_0111524 Ga0501034_0111524_1722_2045 107
276 3300049571 Ga0501034_0560404 Ga0501034_0560404_244_567 107
277 3300049572 Ga0501036_0149759 Ga0501036_0149759_783_1130 107
278 3300049572 Ga0501036_0302536 Ga0501036_0302536_498_845 107
279 3300049572 Ga0501036_0979355 Ga0501036_0979355_54_380 107
280 3300049573 Ga0501037_0004581 Ga0501037_0004581_9157_9504 107
281 3300049573 Ga0501037_0536866 Ga0501037_0536866_231_578 107
282 3300049574 Ga0501038_0106709 Ga0501038_0106709_1636_1983 107
283 3300049575 Ga0501039_0011408 Ga0501039_0011408_4078_4425 107
284 3300049575 Ga0501039_0062306 Ga0501039_0062306_167_514 107
285 3300049576 Ga0501040_0008355 Ga0501040_0008355_5178_5525 107
286 3300049577 Ga0501041_0008407 Ga0501041_0008407_3813_4160 107
287 3300049578 Ga0501042_0002391 Ga0501042_0002391_827_1174 107
288 3300049578 Ga0501042_0040447 Ga0501042_0040447_229_576 107
289 3300049578 Ga0501042_0495965 Ga0501042_0495965_455_781 107
290 3300049579 Ga0501043_0049507 Ga0501043_0049507_841_1188 107
291 3300049579 Ga0501043_0203813 Ga0501043_0203813_459_806 107
292 3300049580 Ga0501046_0012529 Ga0501046_0012529_4449_4796 107
293 3300049580 Ga0501046_0031901 Ga0501046_0031901_2111_2458 107
294 3300049581 Ga0501047_0042800 Ga0501047_0042800_90_437 107
295 3300049582 Ga0501048_0011553 Ga0501048_0011553_2186_2533 107
296 3300049582 Ga0501048_0171075 Ga0501048_0171075_1087_1413 107
297 3300049583 Ga0501067_0470147 Ga0501067_0470147_243_575 107
298 3300049584 Ga0501068_0275041 Ga0501068_0275041_498_845 107
299 3300049584 Ga0501068_0447238 Ga0501068_0447238_98_424 107
300 3300049584 Ga0501068_0694144 Ga0501068_0694144_262_600 107
301 3300049585 Ga0501069_0002130 Ga0501069_0002130_9429_9776 107
302 3300049585 Ga0501069_0045845 Ga0501069_0045845_287_634 107
303 3300049585 Ga0501069_0215071 Ga0501069_0215071_15_341 107
304 3300049585 Ga0501069_0684356 Ga0501069_0684356_80_406 107
305 3300049586 Ga0501070_0015784 Ga0501070_0015784_63_410 107
306 3300049586 Ga0501070_0296736 Ga0501070_0296736_599_946 107
307 3300049587 Ga0501071_0009760 Ga0501071_0009760_1206_1553 107
308 3300049587 Ga0501071_0651809 Ga0501071_0651809_135_461 107
309 3300049587 Ga0501071_0756543 Ga0501071_0756543_28_354 107
310 3300049587 Ga0501071_0760661 Ga0501071_0760661_370_717 107
311 3300049588 Ga0501072_0034965 Ga0501072_0034965_1198_1545 107
312 3300049588 Ga0501072_0166019 Ga0501072_0166019_724_1050 107
313 3300049588 Ga0501072_0376592 Ga0501072_0376592_26_352 107
314 3300049588 Ga0501072_1205718 Ga0501072_1205718_47_376 107
315 3300049589 Ga0501073_0016117 Ga0501073_0016117_2503_2850 107
316 3300049590 Ga0501074_0013149 Ga0501074_0013149_48_395 107
317 3300049590 Ga0501074_0149451 Ga0501074_0149451_436_783 107
318 3300049591 Ga0501075_0055777 Ga0501075_0055777_2533_2880 107
319 3300049591 Ga0501075_0169256 Ga0501075_0169256_941_1270 107
320 3300049591 Ga0501075_0633926 Ga0501075_0633926_457_783 107
321 3300049592 Ga0501076_0002923 Ga0501076_0002923_2610_2957 107
322 3300049592 Ga0501076_1253438 Ga0501076_1253438_229_558 107
323 3300049593 Ga0501077_0027616 Ga0501077_0027616_2079_2426 107
324 3300049593 Ga0501077_0334629 Ga0501077_0334629_351_698 107
325 3300049741 Ga0501079_0015056 Ga0501079_0015056_4322_4669 107
326 3300049741 Ga0501079_0074417 Ga0501079_0074417_671_1018 107
327 3300049742 Ga0501080_0598104 Ga0501080_0598104_609_935 107
328 3300049742 Ga0501080_0885388 Ga0501080_0885388_211_576 107
329 3300049742 Ga0501080_1301353 Ga0501080_1301353_74_421 107
330 3300049743 Ga0501081_0005035 Ga0501081_0005035_2582_2929 107
331 3300049743 Ga0501081_0096721 Ga0501081_0096721_1713_2042 107
332 3300049743 Ga0501081_0288916 Ga0501081_0288916_498_845 107
333 3300049744 Ga0501083_0206029 Ga0501083_0206029_493_840 107
334 3300049822 Ga0501035_0013890 Ga0501035_0013890_268_615 107
335 3300049822 Ga0501035_0178209 Ga0501035_0178209_370_717 107
336 3300049823 Ga0501044_1175610 Ga0501044_1175610_213_560 107
337 3300049823 Ga0501044_1206328 Ga0501044_1206328_74_421 107
338 3300049824 Ga0501045_0004045 Ga0501045_0004045_616_963 107
339 3300049824 Ga0501045_0493286 Ga0501045_0493286_489_836 107
340 3300050489 nmdc:mga03683_16677_c1 nmdc:mga03683_16677_c1_2361_2687 107
341 3300050489 nmdc:mga03683_611455_c1 nmdc:mga03683_611455_c1_176_502 107
342 3300050490 nmdc:mga03n38_125904_c1 nmdc:mga03n38_125904_c1_877_1203 107
343 3300050490 nmdc:mga03n38_88723_c1 nmdc:mga03n38_88723_c1_911_1237 107
344 3300050491 nmdc:mga00v17_27615_c1 nmdc:mga00v17_27615_c1_2964_3290 107
345 3300050491 nmdc:mga00v17_287026_c1 nmdc:mga00v17_287026_c1_656_982 107
346 3300050491 nmdc:mga00v17_62436_c2 nmdc:mga00v17_62436_c2_1206_1532 107
347 3300050491 nmdc:mga00v17_740599_c1 nmdc:mga00v17_740599_c1_145_471 107
348 3300050491 nmdc:mga00v17_759197_c1 nmdc:mga00v17_759197_c1_224_547 107
349 3300050492 nmdc:mga0yw44_137265_c1 nmdc:mga0yw44_137265_c1_1118_1462 107
350 3300050492 nmdc:mga0yw44_13998_c1 nmdc:mga0yw44_13998_c1_1012_1338 107
351 3300050493 nmdc:mga0k408_652836_c1 nmdc:mga0k408_652836_c1_197_523 107
352 3300050494 nmdc:mga06z11_123500_c1 nmdc:mga06z11_123500_c1_803_1129 107
353 3300050494 nmdc:mga06z11_464010_c1 nmdc:mga06z11_464010_c1_338_664 107
354 3300050494 nmdc:mga06z11_51211_c1 nmdc:mga06z11_51211_c1_188_514 107
355 3300050494 nmdc:mga06z11_648001_c1 nmdc:mga06z11_648001_c1_186_530 107
356 3300050494 nmdc:mga06z11_72925_c1 nmdc:mga06z11_72925_c1_998_1324 107
357 3300050495 nmdc:mga04h51_49932_c1 nmdc:mga04h51_49932_c1_269_595 107
358 3300050495 nmdc:mga04h51_90838_c1 nmdc:mga04h51_90838_c1_641_967 107
359 3300050496 nmdc:mga07m45_335813_c1 nmdc:mga07m45_335813_c1_211_537 107
360 3300050507 nmdc:mga05p37_38278_c1 nmdc:mga05p37_38278_c1_2093_2419 107
361 3300050507 nmdc:mga05p37_54118_c1 nmdc:mga05p37_54118_c1_4005_4331 107
362 3300050508 nmdc:mga09592_176555_c1 nmdc:mga09592_176555_c1_1206_1532 107
363 3300050508 nmdc:mga09592_237326_c1 nmdc:mga09592_237326_c1_1022_1348 107
364 3300050508 nmdc:mga09592_30133_c1 nmdc:mga09592_30133_c1_52_378 107
365 3300050509 nmdc:mga0qj67_143282_c1 nmdc:mga0qj67_143282_c1_935_1261 107
366 3300050510 nmdc:mga06r32_195144_c1 nmdc:mga06r32_195144_c1_1316_1642 107
367 3300050510 nmdc:mga06r32_475879_c1 nmdc:mga06r32_475879_c1_581_907 107
368 3300050510 nmdc:mga06r32_976437_c1 nmdc:mga06r32_976437_c1_407_733 107
369 3300050511 nmdc:mga08y16_3013_c1 nmdc:mga08y16_3013_c1_7063_7389 107
370 3300050512 nmdc:mga0n895_20953_c1 nmdc:mga0n895_20953_c1_5551_5877 107
371 3300050515 nmdc:mga0a205_507477_c1 nmdc:mga0a205_507477_c1_564_890 107
372 3300050515 nmdc:mga0a205_80737_c1 nmdc:mga0a205_80737_c1_760_1086 107
373 3300053078 Ga0495612_0090653 Ga0495612_0090653_948_1274 107
374 3300053085 Ga0495619_0161068 Ga0495619_0161068_936_1262 107
375 3300053140 Ga0500573_0007739 Ga0500573_0007739_2709_3035 107
376 3300054114 Ga0501084_0087507 Ga0501084_0087507_2243_2590 107
377 3300054114 Ga0501084_0823433 Ga0501084_0823433_74_421 107
378 3300060353 Ga0501082_0041621 Ga0501082_0041621_549_896 107
379 3300060353 Ga0501082_0154391 Ga0501082_0154391_960_1289 107
380 3300060353 Ga0501082_0418029 Ga0501082_0418029_386_715 107
381 3300060353 Ga0501082_0609272 Ga0501082_0609272_252_599 107
382 3300061719 Ga0466962_0042373 Ga0466962_0042373_743_1069 107
383 3300061734 Ga0530510_0080550 Ga0530510_0080550_902_1228 107
384 3300061734 Ga0530510_0457275 Ga0530510_0457275_247_594 107

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iby-assembly3.cif.gz_C structure of cytosolic domain of l. pneumophila feob 0.9493 4 37
3iby-assembly2.cif.gz_B structure of cytosolic domain of l. pneumophila feob 0.9193 4 38
1xrh-assembly3.cif.gz_E crystal structure of ureidoglycolate dehydrogenase from escherichia coli 0.8801 9 45
4pc3-assembly1.cif.gz_C elongation factor tu:ts complex with partially bound gdp 0.8441 4 43
3gt0-assembly1.cif.gz_A crystal structure of pyrroline 5-carboxylate reductase from bacillus cereus. northeast structural genomics consortium target bcr38b 0.8191 8 50
ID Description Score Start End Superfamily
af_C0H498_14_269_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.9892 9 38 1.50.40.10
af_Q67U56_1_243_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.9001 6 46 1.50.40.10
2c5qF00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8535 8 38 3.50.30.40
1xrhB01 Mainly Alpha;Orthogonal Bundle;Hypothetical Oxidoreductase Yiak; Chain: A, domain 1;Malate/L-lactate/L-sulpholactate dehydrogenase, four-helix barrel 0.8287 9 47 1.10.1530.10
2e9fC03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 0.8167 11 38 1.10.40.30
ID Description Score Start End GO Terms
AF-A0A2V2AQG5-F1-model_v4 Uncharacterized protein 0.97 1 56
AF-A0A0F4IY37-F1-model_v4 deleted 0.9696 1 60
AF-A0A7C6HAE7-F1-model_v4 Plasmid stabilization protein 0.9618 3 51
AF-A0A538M918-F1-model_v4 Plasmid stabilization protein 0.9469 1 48
AF-A0A1T5AKY4-F1-model_v4 Uncharacterized protein 0.946 3 39

Feature Viewer

pLDDT pTM Quality
82.14 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map