F429959

General Info

Members Datasets Scaffolds Average Seq Length
384 239 768 80

Family's Representative Sequence

Representative Sequence 3300041509|Ga0451843_1505231|Ga0451843_1505231_460_726
Length 88
Sequence MKARVTVTLKNGVLDPQGQAIQGSLKSLGFDTVAGVRQGKLFDINLADGDPAEAEAALRQMCDKLLANTVIENYAIEIIGAPAAKAAE

Samples

Sample ID Description Type Environment
1 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
102 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
103 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
104 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
105 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
106 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
107 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
108 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
109 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
110 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
111 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
112 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
113 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
114 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
115 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
118 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
151 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
219 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
220 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
234 2643221580 Devosia sp. Root635 Isolate Unclassified
235 2643221629 Devosia sp. Root105 Isolate Unclassified
236 2643221662 Devosia sp. Root413D1 Isolate Unclassified
237 2643221674 Devosia sp. Root436 Isolate Unclassified
238 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
239 2932401849 Devosia sp. 2618 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 1.04
Isolates 1.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.65
Nodule 0
Rhizoplane 4.43
Rhizosphere 86.98
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451843_1505231 3300041509 Bacteria 738
2 LJNas_1000284 3300000546 Bacteria 8811
3 rootH2_10276450 3300003320 Bacteria 1823
4 Ga0070676_11490160 3300005328 Bacteria 521
5 Ga0068869_101078975 3300005334 Bacteria 702
6 Ga0070666_10156823 3300005335 Bacteria 1590
7 Ga0070682_100212318 3300005337 Bacteria 1372
8 Ga0070689_100401801 3300005340 Bacteria 1158
9 Ga0070692_10438694 3300005345 Bacteria 833
10 Ga0070668_100088954 3300005347 Bacteria 2432
11 Ga0070675_100121988 3300005354 Bacteria 2214
12 Ga0070675_100734875 3300005354 Bacteria 900
13 Ga0070671_100358674 3300005355 Bacteria 1244
14 Ga0070709_10501216 3300005434 Bacteria 922
15 Ga0070709_10873147 3300005434 Bacteria 710
16 Ga0070714_102076141 3300005435 Unclassified 554
17 Ga0070710_11378541 3300005437 Unclassified 526
18 Ga0070701_10062043 3300005438 Bacteria 1973
19 Ga0070700_100367289 3300005441 Bacteria 1072
20 Ga0070700_100407397 3300005441 Bacteria 1024
21 Ga0070708_100647120 3300005445 Bacteria 996
22 Ga0070663_100826989 3300005455 Bacteria 796
23 Ga0070678_100317230 3300005456 Bacteria 1330
24 Ga0070685_10483924 3300005466 Bacteria 873
25 Ga0070707_100845923 3300005468 Bacteria 879
26 Ga0070698_100013791 3300005471 Bacteria 8551
27 Ga0070698_101855145 3300005471 Bacteria 556
28 Ga0070699_100012234 3300005518 Bacteria 7405
29 Ga0070684_101473542 3300005535 Bacteria 641
30 Ga0070697_100155351 3300005536 Bacteria 1931
31 Ga0070696_101362202 3300005546 Bacteria 604
32 Ga0070665_100145056 3300005548 Bacteria 2377
33 Ga0070665_100781497 3300005548 Bacteria 968
34 Ga0070704_101293600 3300005549 Bacteria 667
35 Ga0070664_102402121 3300005564 Unclassified 500
36 Ga0068856_101238269 3300005614 Bacteria 762
37 Ga0068864_102533676 3300005618 Bacteria 519
38 Ga0068863_102621011 3300005841 Unclassified 513
39 Ga0068860_101796960 3300005843 Unclassified 635
40 Ga0075363_100508586 3300006048 Bacteria 716
41 Ga0075364_11259458 3300006051 Bacteria 501
42 Ga0075432_10064748 3300006058 Bacteria 1306
43 Ga0070712_100291340 3300006175 Bacteria 1318
44 Ga0075367_10231637 3300006178 Bacteria 1157
45 Ga0075366_10768880 3300006195 Bacteria 599
46 Ga0097621_101854351 3300006237 Bacteria 575
47 Ga0068871_100895953 3300006358 Bacteria 822
48 Ga0075428_100024139 3300006844 Bacteria 6726
49 Ga0075428_102465259 3300006844 Bacteria 533
50 Ga0075430_100068327 3300006846 Bacteria 2981
51 Ga0075431_100018294 3300006847 Bacteria 7130
52 Ga0075429_100017581 3300006880 Bacteria 6182
53 Ga0111539_10186850 3300009094 Bacteria 2420
54 Ga0111539_10328247 3300009094 Bacteria 1781
55 Ga0111539_10755805 3300009094 Bacteria 1131
56 Ga0105245_10339443 3300009098 Bacteria 1485
57 Ga0114129_10163338 3300009147 Bacteria 3040
58 Ga0114129_11944917 3300009147 Bacteria 712
59 Ga0105243_11701271 3300009148 Bacteria 660
60 Ga0105242_12455093 3300009176 Bacteria 569
61 Ga0105237_10285779 3300009545 Bacteria 1652
62 Ga0105238_10215173 3300009551 Bacteria 1898
63 Ga0105238_12074152 3300009551 Bacteria 603
64 Ga0157369_10059862 3300013105 Bacteria 4107
65 Ga0157374_10368962 3300013296 Bacteria 1428
66 Ga0157374_10607753 3300013296 Bacteria 1104
67 Ga0163162_10089086 3300013306 Bacteria 3166
68 Ga0157372_10324954 3300013307 Bacteria 1791
69 Ga0163163_10109430 3300014325 Bacteria 2790
70 Ga0157380_10176663 3300014326 Bacteria 1872
71 Ga0157377_10110597 3300014745 Bacteria 1651
72 Ga0157377_10179306 3300014745 Bacteria 1331
73 Ga0157379_11309585 3300014968 Bacteria 700
74 Ga0157376_10051199 3300014969 Bacteria 3430
75 Ga0207682_10392628 3300025893 Bacteria 655
76 Ga0207647_10009450 3300025904 Bacteria 6928
77 Ga0207699_10570689 3300025906 Bacteria 822
78 Ga0207643_10126541 3300025908 Bacteria 1517
79 Ga0207693_10266365 3300025915 Bacteria 1343
80 Ga0207646_10408707 3300025922 Bacteria 1226
81 Ga0207659_10092582 3300025926 Bacteria 2260
82 Ga0207687_10498742 3300025927 Bacteria 1016
83 Ga0207664_10389249 3300025929 Bacteria 1238
84 Ga0207664_11395409 3300025929 Unclassified 621
85 Ga0207644_10059360 3300025931 Bacteria 2767
86 Ga0207709_10565736 3300025935 Bacteria 896
87 Ga0207704_11432415 3300025938 Bacteria 592
88 Ga0207689_11335021 3300025942 Bacteria 602
89 Ga0207679_11922547 3300025945 Bacteria 539
90 Ga0207668_10009689 3300025972 Bacteria 5786
91 Ga0207668_11190059 3300025972 Bacteria 685
92 Ga0207678_10814888 3300026067 Unclassified 824
93 Ga0207708_10878663 3300026075 Bacteria 775
94 Ga0207702_10654511 3300026078 Bacteria 1033
95 Ga0207683_10242142 3300026121 Bacteria 1645
96 Ga0209967_1050767 3300027364 Bacteria 637
97 Ga0207428_10005597 3300027907 Bacteria 11680
98 Ga0207428_10767851 3300027907 Bacteria 686
99 Ga0268266_10089662 3300028379 Bacteria 2693
100 Ga0268266_10199628 3300028379 Bacteria 1830
101 Ga0307408_100792925 3300031548 Bacteria 859
102 Ga0307408_102074372 3300031548 Bacteria 548
103 Ga0307516_10174163 3300031730 Bacteria 1890
104 Ga0307405_11506394 3300031731 Bacteria 591
105 Ga0307413_10889635 3300031824 Bacteria 755
106 Ga0307413_11396602 3300031824 Bacteria 616
107 Ga0307413_11788261 3300031824 Bacteria 550
108 Ga0307410_10168732 3300031852 Bacteria 1647
109 Ga0307410_11314534 3300031852 Bacteria 633
110 Ga0307406_11554562 3300031901 Bacteria 583
111 Ga0307407_10597483 3300031903 Bacteria 821
112 Ga0307407_10701484 3300031903 Bacteria 762
113 Ga0307407_10909276 3300031903 Bacteria 676
114 Ga0307407_11202851 3300031903 Bacteria 592
115 Ga0307412_10458356 3300031911 Bacteria 1052
116 Ga0307412_10516734 3300031911 Bacteria 997
117 Ga0307409_100072284 3300031995 Bacteria 2746
118 Ga0307409_100425630 3300031995 Bacteria 1275
119 Ga0307409_100700415 3300031995 Bacteria 1012
120 Ga0307409_101183693 3300031995 Bacteria 787
121 Ga0307416_100154160 3300032002 Bacteria 2112
122 Ga0307416_102464071 3300032002 Bacteria 619
123 Ga0307416_102568284 3300032002 Bacteria 607
124 Ga0307416_102713785 3300032002 Bacteria 592
125 Ga0307414_10071036 3300032004 Bacteria 2509
126 Ga0307414_10132713 3300032004 Bacteria 1936
127 Ga0307414_10186399 3300032004 Bacteria 1674
128 Ga0307414_10220021 3300032004 Bacteria 1558
129 Ga0307414_10915245 3300032004 Bacteria 804
130 Ga0307414_11055276 3300032004 Bacteria 749
131 Ga0307414_11840722 3300032004 Bacteria 565
132 Ga0307414_11867954 3300032004 Bacteria 560
133 Ga0307414_12119410 3300032004 Bacteria 525
134 Ga0307411_10757501 3300032005 Bacteria 851
135 Ga0307415_100306802 3300032126 Bacteria 1317
136 Ga0307415_102107990 3300032126 Bacteria 551
137 Ga0373955_0157478 3300035172 Bacteria 1339
138 Ga0373924_0077364 3300035410 Bacteria 1411
139 Ga0373925_0004790 3300037068 Bacteria 10189
140 Ga0439461_0015311 3300041410 Bacteria 1468
141 Ga0439466_0058243 3300041411 Bacteria 1250
142 Ga0439465_0082204 3300041413 Bacteria 1094
143 Ga0451789_1108812 3300041443 Bacteria 643
144 Ga0451802_1309235 3300041460 Bacteria 751
145 Ga0451807_2631658 3300041486 Bacteria 504
146 Ga0451833_0884200 3300041491 Bacteria 554
147 Ga0451843_0986260 3300041509 Bacteria 531
148 Ga0439437_011288 3300042000 Bacteria 1023
149 Ga0439442_057102 3300042002 Bacteria 826
150 Ga0439452_038254 3300042010 Bacteria 1140
151 Ga0450913_006067 3300042117 Bacteria 878
152 Ga0450920_049533 3300042122 Bacteria 842
153 Ga0450905_062854 3300042142 Bacteria 623
154 Ga0450907_029149 3300042146 Bacteria 937
155 Ga0450910_078707 3300042147 Bacteria 574
156 Ga0439446_0059319 3300042156 Bacteria 1154
157 Ga0439434_0118822 3300042435 Bacteria 861
158 Ga0439434_0197425 3300042435 Bacteria 678
159 Ga0439434_0263091 3300042435 Bacteria 591
160 Ga0466965_0062172 3300044683 Bacteria 1868
161 Ga0466966_0174633 3300044684 Bacteria 1305
162 Ga0466963_0073944 3300044694 Bacteria 2298
163 Ga0466963_0133141 3300044694 Bacteria 1719
164 Ga0466963_0146075 3300044694 Bacteria 1641
165 Ga0466971_0262046 3300044719 Bacteria 825
166 Ga0466957_0347881 3300044842 Bacteria 1005
167 Ga0466957_0594747 3300044842 Bacteria 774
168 Ga0466959_0151205 3300045049 Bacteria 1636
169 Ga0466958_0098293 3300045836 Bacteria 1817
170 Ga0466967_0302110 3300045976 Bacteria 1540
171 Ga0495617_288972 3300046452 Bacteria 501
172 Ga0495584_0264113 3300046491 Bacteria 875
173 Ga0495596_0064576 3300046500 Bacteria 1424
174 Ga0495596_0378408 3300046500 Bacteria 552
175 Ga0495607_0101012 3300046501 Bacteria 1545
176 Ga0495616_0268548 3300046513 Bacteria 728
177 Ga0495620_0074831 3300046515 Bacteria 1379
178 Ga0495631_0522210 3300046518 Bacteria 506
179 Ga0495632_0444035 3300046519 Unclassified 563
180 Ga0495644_0082581 3300046523 Bacteria 1211
181 Ga0495644_0239660 3300046523 Bacteria 703
182 Ga0495663_0316845 3300046525 Bacteria 564
183 Ga0495642_0177687 3300046528 Bacteria 926
184 Ga0495640_0842264 3300046533 Bacteria 545
185 Ga0495598_0070996 3300046537 Bacteria 1097
186 Ga0495609_0265347 3300046538 Bacteria 705
187 Ga0495645_0111074 3300046543 Bacteria 1939
188 Ga0495633_0372214 3300046558 Bacteria 647
189 Ga0495656_0039051 3300046615 Bacteria 1970
190 Ga0495656_0064905 3300046615 Bacteria 1604
191 Ga0495656_0118434 3300046615 Bacteria 1247
192 Ga0495668_0375197 3300046616 Bacteria 781
193 Ga0495611_0237131 3300046648 Bacteria 847
194 Ga0495625_0202559 3300046660 Bacteria 1309
195 Ga0495625_0918248 3300046660 Unclassified 501
196 Ga0495661_0567729 3300046665 Unclassified 536
197 Ga0495670_0682969 3300046691 Bacteria 560
198 Ga0495670_0706744 3300046691 Bacteria 550
199 Ga0495589_0101558 3300046794 Bacteria 1392
200 Ga0495674_0141685 3300047319 Bacteria 2021
201 Ga0495677_0079863 3300047445 Bacteria 1225
202 Ga0495677_0326098 3300047445 Bacteria 605
203 Ga0495685_251330 3300047447 Bacteria 561
204 Ga0496101_0400796 3300048904 Bacteria 1080
205 Ga0496102_0101256 3300048905 Bacteria 2676
206 Ga0496103_0583135 3300048906 Bacteria 713
207 Ga0496104_0044764 3300048907 Bacteria 4159
208 Ga0496105_0046259 3300048908 Bacteria 3592
209 Ga0496106_0857841 3300048909 Bacteria 718
210 Ga0496107_0854964 3300048910 Bacteria 664
211 Ga0496108_0043469 3300048911 Bacteria 3753
212 Ga0496109_0305119 3300048912 Bacteria 1501
213 Ga0496110_1183209 3300048913 Unclassified 673
214 Ga0496111_0274192 3300048914 Bacteria 1251
215 Ga0496112_0043796 3300048915 Bacteria 4382
216 Ga0496114_0654319 3300048917 Bacteria 924
217 Ga0496115_0100101 3300048918 Bacteria 2376
218 Ga0496117_0409923 3300048920 Bacteria 681
219 Ga0496118_0136011 3300048921 Bacteria 1568
220 Ga0496118_0605376 3300048921 Bacteria 523
221 Ga0496119_0060828 3300048922 Bacteria 2259
222 Ga0496120_0255538 3300048923 Bacteria 820
223 Ga0496121_0204037 3300048924 Bacteria 1406
224 Ga0496125_0047769 3300048928 Bacteria 3575
225 Ga0496125_0397807 3300048928 Bacteria 806
226 Ga0496126_0017438 3300048929 Bacteria 7154
227 Ga0496126_0039005 3300048929 Bacteria 4414
228 Ga0501031_0004650 3300049568 Bacteria 8915
229 Ga0501031_0016276 3300049568 Bacteria 4830
230 Ga0501032_0172927 3300049569 Bacteria 1416
231 Ga0501032_0529008 3300049569 Bacteria 752
232 Ga0501033_0569472 3300049570 Bacteria 779
233 Ga0501033_0638717 3300049570 Bacteria 728
234 Ga0501033_0779626 3300049570 Bacteria 647
235 Ga0501034_0000681 3300049571 Bacteria 51656
236 Ga0501034_0397298 3300049571 Bacteria 1302
237 Ga0501034_0495010 3300049571 Bacteria 1136
238 Ga0501034_0541166 3300049571 Bacteria 1074
239 Ga0501034_0680302 3300049571 Bacteria 929
240 Ga0501034_0757214 3300049571 Bacteria 866
241 Ga0501036_0011359 3300049572 Bacteria 7371
242 Ga0501036_0045889 3300049572 Bacteria 3700
243 Ga0501036_0434032 3300049572 Bacteria 1095
244 Ga0501036_0437798 3300049572 Bacteria 1090
245 Ga0501036_1093786 3300049572 Bacteria 651
246 Ga0501037_0122368 3300049573 Bacteria 1870
247 Ga0501037_0615015 3300049573 Bacteria 729
248 Ga0501038_0011236 3300049574 Bacteria 8174
249 Ga0501038_0077028 3300049574 Bacteria 2816
250 Ga0501038_0297135 3300049574 Bacteria 1268
251 Ga0501039_0053411 3300049575 Bacteria 3127
252 Ga0501039_0149277 3300049575 Bacteria 1837
253 Ga0501040_0011448 3300049576 Bacteria 5808
254 Ga0501040_0241786 3300049576 Bacteria 1287
255 Ga0501040_0290064 3300049576 Bacteria 1169
256 Ga0501040_0376369 3300049576 Bacteria 1018
257 Ga0501040_0980790 3300049576 Bacteria 613
258 Ga0501041_0018232 3300049577 Bacteria 4180
259 Ga0501041_0062583 3300049577 Bacteria 2278
260 Ga0501041_0146363 3300049577 Bacteria 1474
261 Ga0501042_0019515 3300049578 Bacteria 4709
262 Ga0501042_0065692 3300049578 Bacteria 2592
263 Ga0501042_0084027 3300049578 Bacteria 2282
264 Ga0501042_0337122 3300049578 Bacteria 1090
265 Ga0501042_0540562 3300049578 Bacteria 847
266 Ga0501042_1255185 3300049578 Bacteria 540
267 Ga0501043_0770824 3300049579 Bacteria 698
268 Ga0501046_0015775 3300049580 Bacteria 6340
269 Ga0501046_0064383 3300049580 Bacteria 2862
270 Ga0501046_0506927 3300049580 Bacteria 864
271 Ga0501048_0043296 3300049582 Bacteria 3223
272 Ga0501048_0084338 3300049582 Bacteria 2240
273 Ga0501048_0186920 3300049582 Bacteria 1468
274 Ga0501048_0244306 3300049582 Bacteria 1274
275 Ga0501048_0610843 3300049582 Bacteria 783
276 Ga0501068_0204740 3300049584 Bacteria 1252
277 Ga0501068_0337385 3300049584 Bacteria 968
278 Ga0501068_0674390 3300049584 Bacteria 675
279 Ga0501069_0326109 3300049585 Bacteria 903
280 Ga0501070_0644032 3300049586 Bacteria 842
281 Ga0501070_0914480 3300049586 Bacteria 684
282 Ga0501070_1380863 3300049586 Bacteria 536
283 Ga0501071_0009477 3300049587 Bacteria 6487
284 Ga0501071_0009951 3300049587 Bacteria 6354
285 Ga0501071_0368973 3300049587 Bacteria 1094
286 Ga0501071_0612165 3300049587 Bacteria 837
287 Ga0501071_0882919 3300049587 Bacteria 690
288 Ga0501072_0000324 3300049588 Bacteria 34000
289 Ga0501072_0006386 3300049588 Bacteria 8979
290 Ga0501072_0338591 3300049588 Bacteria 1195
291 Ga0501073_0066101 3300049589 Bacteria 2521
292 Ga0501073_0259276 3300049589 Bacteria 1200
293 Ga0501073_0368472 3300049589 Bacteria 992
294 Ga0501073_1226740 3300049589 Bacteria 515
295 Ga0501074_0010192 3300049590 Bacteria 6821
296 Ga0501074_0355012 3300049590 Bacteria 1040
297 Ga0501074_1278913 3300049590 Bacteria 514
298 Ga0501075_0032375 3300049591 Bacteria 3883
299 Ga0501075_0197217 3300049591 Bacteria 1535
300 Ga0501075_0315802 3300049591 Bacteria 1191
301 Ga0501075_1084650 3300049591 Bacteria 608
302 Ga0501076_0039348 3300049592 Bacteria 3712
303 Ga0501076_0514586 3300049592 Bacteria 987
304 Ga0501076_1058204 3300049592 Bacteria 668
305 Ga0501077_0054837 3300049593 Bacteria 2531
306 Ga0501077_0146185 3300049593 Bacteria 1500
307 Ga0501077_0303322 3300049593 Bacteria 1017
308 Ga0501077_0528140 3300049593 Bacteria 757
309 Ga0501077_1078102 3300049593 Bacteria 517
310 Ga0501261_074141 3300049690 Bacteria 603
311 Ga0501079_0093023 3300049741 Bacteria 2336
312 Ga0501079_0201695 3300049741 Bacteria 1554
313 Ga0501080_0035825 3300049742 Bacteria 4632
314 Ga0501080_0128708 3300049742 Bacteria 2344
315 Ga0501081_0071244 3300049743 Bacteria 2423
316 Ga0501081_0384528 3300049743 Bacteria 1037
317 Ga0501081_0576773 3300049743 Bacteria 841
318 Ga0501081_0719617 3300049743 Bacteria 750
319 Ga0501081_1073340 3300049743 Bacteria 609
320 Ga0501081_1182461 3300049743 Bacteria 579
321 Ga0501081_1495702 3300049743 Bacteria 513
322 Ga0501083_0232737 3300049744 Bacteria 1200
323 Ga0501083_0892340 3300049744 Bacteria 578
324 Ga0501266_046747 3300049763 Bacteria 659
325 Ga0501035_0066573 3300049822 Bacteria 3197
326 Ga0501035_0147178 3300049822 Bacteria 2045
327 Ga0501035_1094831 3300049822 Bacteria 622
328 Ga0501044_0291234 3300049823 Bacteria 1564
329 Ga0501045_0042938 3300049824 Bacteria 3291
330 Ga0501045_0137560 3300049824 Bacteria 1816
331 Ga0501045_0841739 3300049824 Bacteria 675
332 nmdc:mga00v17_443094_c1 3300050491 Bacteria 843
333 nmdc:mga0yw44_1048490_c1 3300050492 Bacteria 551
334 nmdc:mga06z11_168777_c1 3300050494 Bacteria 1255
335 nmdc:mga07m45_355915_c1 3300050496 Bacteria 850
336 nmdc:mga07m45_96616_c1 3300050496 Bacteria 1695
337 nmdc:mga05p37_224837_c1 3300050507 Bacteria 2264
338 nmdc:mga05p37_634364_c1 3300050507 Bacteria 1200
339 nmdc:mga09592_18946_c1 3300050508 Bacteria 5647
340 nmdc:mga0qj67_43477_c1 3300050509 Bacteria 3538
341 nmdc:mga06r32_65744_c1 3300050510 Bacteria 3499
342 nmdc:mga08y16_132646_c1 3300050511 Bacteria 2590
343 nmdc:mga08y16_307559_c1 3300050511 Bacteria 1633
344 nmdc:mga08y16_735350_c1 3300050511 Bacteria 984
345 Ga0495601_0070731 3300053077 Bacteria 2228
346 Ga0495601_0138135 3300053077 Bacteria 1589
347 Ga0495601_0600727 3300053077 Bacteria 706
348 Ga0495612_0138448 3300053078 Bacteria 1055
349 Ga0495619_0580453 3300053085 Bacteria 768
350 Ga0500562_071667 3300053108 Bacteria 935
351 Ga0500652_344259 3300053131 Bacteria 565
352 Ga0500568_0180178 3300053139 Bacteria 777
353 Ga0500616_0060291 3300053153 Bacteria 1967
354 Ga0500634_0000025 3300053161 Bacteria 81954
355 Ga0501084_0006366 3300054114 Bacteria 9695
356 Ga0501084_0137472 3300054114 Bacteria 2057
357 Ga0501084_0790816 3300054114 Bacteria 799
358 Ga0590071_028094 3300059421 Bacteria 1336
359 Ga0590075_018632 3300059424 Bacteria 1718
360 Ga0590075_057668 3300059424 Bacteria 999
361 Ga0590075_085970 3300059424 Bacteria 816
362 Ga0590077_075670 3300059426 Bacteria 772
363 Ga0587077_025956 3300059493 Bacteria 1078
364 Ga0587082_101793 3300059504 Bacteria 627
365 Ga0587091_050023 3300059511 Bacteria 855
366 Ga0587101_016295 3300059623 Bacteria 1017
367 Ga0501082_0019528 3300060353 Bacteria 5843
368 Ga0501082_0156276 3300060353 Bacteria 1981
369 Ga0501082_0162443 3300060353 Bacteria 1941
370 Ga0501082_0789654 3300060353 Bacteria 831
371 Ga0501082_1536085 3300060353 Bacteria 581
372 Ga0466962_0333217 3300061719 Bacteria 754
373 Ga0530510_0020350 3300061734 Bacteria 4718
374 Ga0530510_0020417 3300061734 Bacteria 4710
375 Ga0530510_0132336 3300061734 Bacteria 1835
376 Ga0530510_0215818 3300061734 Bacteria 1425
377 Ga0530510_0854770 3300061734 Bacteria 695
378 Ga0530510_1092262 3300061734 Bacteria 611
379 2643911430 2643221580 Bacteria 3816678
380 2644167735 2643221629 Bacteria 5850260
381 2644349195 2643221662 Bacteria 5851492
382 2644413981 2643221674 Bacteria 3919126
383 2917557489 2917554339 Bacteria 4987857
384 2932402913 2932401849 Bacteria 4262978
385 Ga0451843_1505231
386 LJNas_1000284
387 rootH2_10276450
388 Ga0070676_11490160
389 Ga0068869_101078975
390 Ga0070666_10156823
391 Ga0070682_100212318
392 Ga0070689_100401801
393 Ga0070692_10438694
394 Ga0070668_100088954
395 Ga0070675_100121988
396 Ga0070675_100734875
397 Ga0070671_100358674
398 Ga0070709_10501216
399 Ga0070709_10873147
400 Ga0070714_102076141
401 Ga0070710_11378541
402 Ga0070701_10062043
403 Ga0070700_100367289
404 Ga0070700_100407397
405 Ga0070708_100647120
406 Ga0070663_100826989
407 Ga0070678_100317230
408 Ga0070685_10483924
409 Ga0070707_100845923
410 Ga0070698_100013791
411 Ga0070698_101855145
412 Ga0070699_100012234
413 Ga0070684_101473542
414 Ga0070697_100155351
415 Ga0070696_101362202
416 Ga0070665_100145056
417 Ga0070665_100781497
418 Ga0070704_101293600
419 Ga0070664_102402121
420 Ga0068856_101238269
421 Ga0068864_102533676
422 Ga0068863_102621011
423 Ga0068860_101796960
424 Ga0075363_100508586
425 Ga0075364_11259458
426 Ga0075432_10064748
427 Ga0070712_100291340
428 Ga0075367_10231637
429 Ga0075366_10768880
430 Ga0097621_101854351
431 Ga0068871_100895953
432 Ga0075428_100024139
433 Ga0075428_102465259
434 Ga0075430_100068327
435 Ga0075431_100018294
436 Ga0075429_100017581
437 Ga0111539_10186850
438 Ga0111539_10328247
439 Ga0111539_10755805
440 Ga0105245_10339443
441 Ga0114129_10163338
442 Ga0114129_11944917
443 Ga0105243_11701271
444 Ga0105242_12455093
445 Ga0105237_10285779
446 Ga0105238_10215173
447 Ga0105238_12074152
448 Ga0157369_10059862
449 Ga0157374_10368962
450 Ga0157374_10607753
451 Ga0163162_10089086
452 Ga0157372_10324954
453 Ga0163163_10109430
454 Ga0157380_10176663
455 Ga0157377_10110597
456 Ga0157377_10179306
457 Ga0157379_11309585
458 Ga0157376_10051199
459 Ga0207682_10392628
460 Ga0207647_10009450
461 Ga0207699_10570689
462 Ga0207643_10126541
463 Ga0207693_10266365
464 Ga0207646_10408707
465 Ga0207659_10092582
466 Ga0207687_10498742
467 Ga0207664_10389249
468 Ga0207664_11395409
469 Ga0207644_10059360
470 Ga0207709_10565736
471 Ga0207704_11432415
472 Ga0207689_11335021
473 Ga0207679_11922547
474 Ga0207668_10009689
475 Ga0207668_11190059
476 Ga0207678_10814888
477 Ga0207708_10878663
478 Ga0207702_10654511
479 Ga0207683_10242142
480 Ga0209967_1050767
481 Ga0207428_10005597
482 Ga0207428_10767851
483 Ga0268266_10089662
484 Ga0268266_10199628
485 Ga0307408_100792925
486 Ga0307408_102074372
487 Ga0307516_10174163
488 Ga0307405_11506394
489 Ga0307413_10889635
490 Ga0307413_11396602
491 Ga0307413_11788261
492 Ga0307410_10168732
493 Ga0307410_11314534
494 Ga0307406_11554562
495 Ga0307407_10597483
496 Ga0307407_10701484
497 Ga0307407_10909276
498 Ga0307407_11202851
499 Ga0307412_10458356
500 Ga0307412_10516734
501 Ga0307409_100072284
502 Ga0307409_100425630
503 Ga0307409_100700415
504 Ga0307409_101183693
505 Ga0307416_100154160
506 Ga0307416_102464071
507 Ga0307416_102568284
508 Ga0307416_102713785
509 Ga0307414_10071036
510 Ga0307414_10132713
511 Ga0307414_10186399
512 Ga0307414_10220021
513 Ga0307414_10915245
514 Ga0307414_11055276
515 Ga0307414_11840722
516 Ga0307414_11867954
517 Ga0307414_12119410
518 Ga0307411_10757501
519 Ga0307415_100306802
520 Ga0307415_102107990
521 Ga0373955_0157478
522 Ga0373924_0077364
523 Ga0373925_0004790
524 Ga0439461_0015311
525 Ga0439466_0058243
526 Ga0439465_0082204
527 Ga0451789_1108812
528 Ga0451802_1309235
529 Ga0451807_2631658
530 Ga0451833_0884200
531 Ga0451843_0986260
532 Ga0439437_011288
533 Ga0439442_057102
534 Ga0439452_038254
535 Ga0450913_006067
536 Ga0450920_049533
537 Ga0450905_062854
538 Ga0450907_029149
539 Ga0450910_078707
540 Ga0439446_0059319
541 Ga0439434_0118822
542 Ga0439434_0197425
543 Ga0439434_0263091
544 Ga0466965_0062172
545 Ga0466966_0174633
546 Ga0466963_0073944
547 Ga0466963_0133141
548 Ga0466963_0146075
549 Ga0466971_0262046
550 Ga0466957_0347881
551 Ga0466957_0594747
552 Ga0466959_0151205
553 Ga0466958_0098293
554 Ga0466967_0302110
555 Ga0495617_288972
556 Ga0495584_0264113
557 Ga0495596_0064576
558 Ga0495596_0378408
559 Ga0495607_0101012
560 Ga0495616_0268548
561 Ga0495620_0074831
562 Ga0495631_0522210
563 Ga0495632_0444035
564 Ga0495644_0082581
565 Ga0495644_0239660
566 Ga0495663_0316845
567 Ga0495642_0177687
568 Ga0495640_0842264
569 Ga0495598_0070996
570 Ga0495609_0265347
571 Ga0495645_0111074
572 Ga0495633_0372214
573 Ga0495656_0039051
574 Ga0495656_0064905
575 Ga0495656_0118434
576 Ga0495668_0375197
577 Ga0495611_0237131
578 Ga0495625_0202559
579 Ga0495625_0918248
580 Ga0495661_0567729
581 Ga0495670_0682969
582 Ga0495670_0706744
583 Ga0495589_0101558
584 Ga0495674_0141685
585 Ga0495677_0079863
586 Ga0495677_0326098
587 Ga0495685_251330
588 Ga0496101_0400796
589 Ga0496102_0101256
590 Ga0496103_0583135
591 Ga0496104_0044764
592 Ga0496105_0046259
593 Ga0496106_0857841
594 Ga0496107_0854964
595 Ga0496108_0043469
596 Ga0496109_0305119
597 Ga0496110_1183209
598 Ga0496111_0274192
599 Ga0496112_0043796
600 Ga0496114_0654319
601 Ga0496115_0100101
602 Ga0496117_0409923
603 Ga0496118_0136011
604 Ga0496118_0605376
605 Ga0496119_0060828
606 Ga0496120_0255538
607 Ga0496121_0204037
608 Ga0496125_0047769
609 Ga0496125_0397807
610 Ga0496126_0017438
611 Ga0496126_0039005
612 Ga0501031_0004650
613 Ga0501031_0016276
614 Ga0501032_0172927
615 Ga0501032_0529008
616 Ga0501033_0569472
617 Ga0501033_0638717
618 Ga0501033_0779626
619 Ga0501034_0000681
620 Ga0501034_0397298
621 Ga0501034_0495010
622 Ga0501034_0541166
623 Ga0501034_0680302
624 Ga0501034_0757214
625 Ga0501036_0011359
626 Ga0501036_0045889
627 Ga0501036_0434032
628 Ga0501036_0437798
629 Ga0501036_1093786
630 Ga0501037_0122368
631 Ga0501037_0615015
632 Ga0501038_0011236
633 Ga0501038_0077028
634 Ga0501038_0297135
635 Ga0501039_0053411
636 Ga0501039_0149277
637 Ga0501040_0011448
638 Ga0501040_0241786
639 Ga0501040_0290064
640 Ga0501040_0376369
641 Ga0501040_0980790
642 Ga0501041_0018232
643 Ga0501041_0062583
644 Ga0501041_0146363
645 Ga0501042_0019515
646 Ga0501042_0065692
647 Ga0501042_0084027
648 Ga0501042_0337122
649 Ga0501042_0540562
650 Ga0501042_1255185
651 Ga0501043_0770824
652 Ga0501046_0015775
653 Ga0501046_0064383
654 Ga0501046_0506927
655 Ga0501048_0043296
656 Ga0501048_0084338
657 Ga0501048_0186920
658 Ga0501048_0244306
659 Ga0501048_0610843
660 Ga0501068_0204740
661 Ga0501068_0337385
662 Ga0501068_0674390
663 Ga0501069_0326109
664 Ga0501070_0644032
665 Ga0501070_0914480
666 Ga0501070_1380863
667 Ga0501071_0009477
668 Ga0501071_0009951
669 Ga0501071_0368973
670 Ga0501071_0612165
671 Ga0501071_0882919
672 Ga0501072_0000324
673 Ga0501072_0006386
674 Ga0501072_0338591
675 Ga0501073_0066101
676 Ga0501073_0259276
677 Ga0501073_0368472
678 Ga0501073_1226740
679 Ga0501074_0010192
680 Ga0501074_0355012
681 Ga0501074_1278913
682 Ga0501075_0032375
683 Ga0501075_0197217
684 Ga0501075_0315802
685 Ga0501075_1084650
686 Ga0501076_0039348
687 Ga0501076_0514586
688 Ga0501076_1058204
689 Ga0501077_0054837
690 Ga0501077_0146185
691 Ga0501077_0303322
692 Ga0501077_0528140
693 Ga0501077_1078102
694 Ga0501261_074141
695 Ga0501079_0093023
696 Ga0501079_0201695
697 Ga0501080_0035825
698 Ga0501080_0128708
699 Ga0501081_0071244
700 Ga0501081_0384528
701 Ga0501081_0576773
702 Ga0501081_0719617
703 Ga0501081_1073340
704 Ga0501081_1182461
705 Ga0501081_1495702
706 Ga0501083_0232737
707 Ga0501083_0892340
708 Ga0501266_046747
709 Ga0501035_0066573
710 Ga0501035_0147178
711 Ga0501035_1094831
712 Ga0501044_0291234
713 Ga0501045_0042938
714 Ga0501045_0137560
715 Ga0501045_0841739
716 nmdc:mga00v17_443094_c1
717 nmdc:mga0yw44_1048490_c1
718 nmdc:mga06z11_168777_c1
719 nmdc:mga07m45_355915_c1
720 nmdc:mga07m45_96616_c1
721 nmdc:mga05p37_224837_c1
722 nmdc:mga05p37_634364_c1
723 nmdc:mga09592_18946_c1
724 nmdc:mga0qj67_43477_c1
725 nmdc:mga06r32_65744_c1
726 nmdc:mga08y16_132646_c1
727 nmdc:mga08y16_307559_c1
728 nmdc:mga08y16_735350_c1
729 Ga0495601_0070731
730 Ga0495601_0138135
731 Ga0495601_0600727
732 Ga0495612_0138448
733 Ga0495619_0580453
734 Ga0500562_071667
735 Ga0500652_344259
736 Ga0500568_0180178
737 Ga0500616_0060291
738 Ga0500634_0000025
739 Ga0501084_0006366
740 Ga0501084_0137472
741 Ga0501084_0790816
742 Ga0590071_028094
743 Ga0590075_018632
744 Ga0590075_057668
745 Ga0590075_085970
746 Ga0590077_075670
747 Ga0587077_025956
748 Ga0587082_101793
749 Ga0587091_050023
750 Ga0587101_016295
751 Ga0501082_0019528
752 Ga0501082_0156276
753 Ga0501082_0162443
754 Ga0501082_0789654
755 Ga0501082_1536085
756 Ga0466962_0333217
757 Ga0530510_0020350
758 Ga0530510_0020417
759 Ga0530510_0132336
760 Ga0530510_0215818
761 Ga0530510_0854770
762 Ga0530510_1092262
763 2643911430
764 2644167735
765 2644349195
766 2644413981
767 2917557489
768 2932402913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02700

PurS

Phosphoribosylformylglycinamidine (FGAM) synthase

2

78

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gp6-assembly1.cif.gz_A mamm ctd - copper form 0.7395 17 70
4b08-assembly1.cif.gz_A yeast dna polymerase alpha, selenomethionine protein 0.7187 16 78
3w8p-assembly1.cif.gz_B mamm-ctd d249a&h28a mutant 0.7126 19 70
4fvm-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha 0.6862 16 78
7opl-assembly1.cif.gz_A cryoem structure of dna polymerase alpha - primase bound to sars cov nsp1 0.6785 16 78
ID Description Score Start End Superfamily
af_Q20864_353_434_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.7086 14 74 3.30.70.1350
af_C0H578_105_189_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.7022 43 70 3.30.300.130
1y10D02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.6705 2 77 3.30.70.1230
af_K7M9R3_64_144_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6639 1 80 3.30.70.100
3ezuA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.6634 2 77 3.30.70.270
ID Description Score Start End GO Terms
AF-A0A7C2B7Q3-F1-model_v4 Efflux RND transporter permease subunit 0.7785 2 81 GO:0005886
GO:0042910
AF-A0A7C2B7Q3-F1-model_v4 Efflux RND transporter permease subunit 0.7624 2 81 GO:0005886
GO:0042910
AF-A0A7C3J656-F1-model_v4 Efflux RND transporter permease subunit 0.7585 2 78 GO:0005886
GO:0042910
AF-A0A521KD15-F1-model_v4 Efflux RND transporter permease subunit 0.743 2 81 GO:0005886
GO:0042910
AF-A0A3R9MCZ2-F1-model_v4 DUF469 family protein 0.7415 2 79

Map