F429809

General Info

Members Datasets Scaffolds Average Seq Length
384 238 357 157

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100031993|Ga0070668_1000319934
Length 178
Sequence MALSANDAFAAGGSVSRRRRRYGRGRRGALSEINVTPLVDVMLVLLIIFMISAPLLTVGVPVELPKTEAGAMEDQSTPLTLSIKADGAIFVTAGDKDRQVAFEQLSPLLTAMADNKTDKPIYVRADGRAPYSIVAQVMASLSVSGFTSINLITDTGGPSSGKTETTTPAPPAAEPPAT

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
5 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
6 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
7 2643221584 Caulobacter sp. Root656 Isolate Unclassified
8 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
9 2643221640 Caulobacter sp. Root342 Isolate Unclassified
10 2643221642 Caulobacter sp. Root343 Isolate Unclassified
11 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
12 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
13 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
14 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
15 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
16 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
17 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
18 2818991435 Caulobacter henricii 536 Isolate Unclassified
19 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
20 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
21 2849560528 Caulobacter zeae 410 Isolate Unclassified
22 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
23 2851153111 Caulobacter radicis 736 Isolate Unclassified
24 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
25 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
26 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
27 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
155 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
167 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
177 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
216 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
217 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
218 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
219 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
220 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
221 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
222 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
223 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
224 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
225 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
226 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
227 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
228 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
229 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
232 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
233 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
234 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
235 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
236 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.97
Metatranscriptomes 0
Isolates 7.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.83
Nodule 0
Rhizoplane 3.39
Rhizosphere 64.58
Stem 0
Stem Tuber 0
Unclassified 11.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1029700 3300002741 Bacteria 626
2 JGI25153J46596_10000042 3300003215 Bacteria 161788
3 rootH1_10028737 3300003323 Bacteria 2567
4 Ga0055537_1004257 3300003773 Bacteria 4137
5 Ga0055524_1026078 3300003775 Bacteria 1816
6 Ga0055524_1033155 3300003775 Bacteria 1450
7 Ga0055536_1002281 3300003781 Bacteria 10891
8 Ga0055528_1020185 3300003790 Bacteria 2172
9 Ga0055530_10000090 3300003791 Bacteria 78168
10 Ga0055530_10005036 3300003791 Bacteria 6497
11 Ga0055530_10047287 3300003791 Bacteria 1017
12 Ga0055530_10067537 3300003791 Bacteria 779
13 Ga0055531_10000579 3300003794 Bacteria 31922
14 Ga0055531_10001586 3300003794 Bacteria 16590
15 Ga0055531_10003917 3300003794 Bacteria 9272
16 Ga0055531_10030686 3300003794 Bacteria 1797
17 Ga0065165_1002252 3300005262 Bacteria 17063
18 Ga0065165_1003048 3300005262 Bacteria 12575
19 Ga0065165_1038572 3300005262 Bacteria 1439
20 Ga0070658_10527109 3300005327 Bacteria 1022
21 Ga0070658_11220035 3300005327 Bacteria 654
22 Ga0070676_10708362 3300005328 Bacteria 736
23 Ga0070670_100000007 3300005331 Bacteria 318672
24 Ga0068869_100025241 3300005334 Bacteria 4125
25 Ga0070666_10022658 3300005335 Bacteria 4081
26 Ga0068868_100129792 3300005338 Bacteria 2062
27 Ga0070668_100001128 3300005347 Bacteria 18767
28 Ga0070668_100002441 3300005347 Bacteria 13675
29 Ga0070668_100031993 3300005347 Bacteria 4003
30 Ga0070669_100174684 3300005353 Bacteria 1677
31 Ga0070671_100749590 3300005355 Bacteria 849
32 Ga0070674_100876536 3300005356 Bacteria 780
33 Ga0070673_100453639 3300005364 Bacteria 1154
34 Ga0070667_100002530 3300005367 Bacteria 15933
35 Ga0070663_100427161 3300005455 Bacteria 1088
36 Ga0070678_100821723 3300005456 Bacteria 845
37 Ga0070679_100750195 3300005530 Bacteria 919
38 Ga0070684_101394554 3300005535 Bacteria 660
39 Ga0070672_100824295 3300005543 Bacteria 817
40 Ga0070665_100003703 3300005548 Bacteria 16191
41 Ga0070665_100121142 3300005548 Bacteria 2617
42 Ga0068855_100129579 3300005563 Bacteria 2882
43 Ga0068855_100149425 3300005563 Bacteria 2657
44 Ga0068855_100341983 3300005563 Bacteria 1649
45 Ga0070664_100170995 3300005564 Bacteria 1928
46 Ga0068856_100903965 3300005614 Bacteria 902
47 Ga0068852_101664277 3300005616 Bacteria 661
48 Ga0068859_100103499 3300005617 Bacteria 2905
49 Ga0068864_100000093 3300005618 Bacteria 93540
50 Ga0068864_100000095 3300005618 Bacteria 91554
51 Ga0068864_100014083 3300005618 Bacteria 6635
52 Ga0068864_100034218 3300005618 Bacteria 4321
53 Ga0068864_100714483 3300005618 Bacteria 980
54 Ga0068864_101289809 3300005618 Bacteria 730
55 Ga0068863_100000045 3300005841 Bacteria 147269
56 Ga0068863_100003539 3300005841 Bacteria 15412
57 Ga0068863_100469984 3300005841 Bacteria 1236
58 Ga0068863_100559329 3300005841 Bacteria 1130
59 Ga0068863_100590201 3300005841 Bacteria 1099
60 Ga0068858_100003027 3300005842 Bacteria 16847
61 Ga0068858_100010617 3300005842 Bacteria 8716
62 Ga0068858_101314118 3300005842 Bacteria 712
63 Ga0068860_100000037 3300005843 Bacteria 234524
64 Ga0068860_100000204 3300005843 Bacteria 93995
65 Ga0068862_100001565 3300005844 Bacteria 20879
66 Ga0068862_100043001 3300005844 Bacteria 3851
67 Ga0068862_100921631 3300005844 Bacteria 860
68 Ga0075363_100078131 3300006048 Bacteria 1807
69 Ga0097621_100861857 3300006237 Bacteria 842
70 Ga0068871_100876128 3300006358 Bacteria 831
71 Ga0068865_100018105 3300006881 Bacteria 4541
72 Ga0097620_100103498 3300006931 Bacteria 2905
73 Ga0105250_10075440 3300009092 Bacteria 1364
74 Ga0105240_10685754 3300009093 Bacteria 1120
75 Ga0105240_11783067 3300009093 Bacteria 642
76 Ga0105243_10560783 3300009148 Bacteria 1093
77 Ga0105243_11458694 3300009148 Bacteria 707
78 Ga0105241_10197280 3300009174 Bacteria 1679
79 Ga0105248_10043098 3300009177 Bacteria 5061
80 Ga0105248_10164984 3300009177 Bacteria 2497
81 Ga0105248_10204924 3300009177 Bacteria 2223
82 Ga0105238_10029665 3300009551 Bacteria 5572
83 Ga0105238_10398799 3300009551 Bacteria 1369
84 Ga0105238_11090792 3300009551 Bacteria 821
85 Ga0105249_10017474 3300009553 Bacteria 6368
86 Ga0105249_10213867 3300009553 Bacteria 1893
87 Ga0105239_10261276 3300010375 Bacteria 1946
88 Ga0105239_10320624 3300010375 Bacteria 1747
89 Ga0105239_11534358 3300010375 Bacteria 770
90 Ga0157370_10767006 3300013104 Bacteria 878
91 Ga0157378_11317707 3300013297 Bacteria 764
92 Ga0163162_10128321 3300013306 Bacteria 2644
93 Ga0163162_11961982 3300013306 Bacteria 670
94 Ga0157375_10791929 3300013308 Bacteria 1097
95 Ga0163163_10084595 3300014325 Bacteria 3179
96 Ga0163163_10255976 3300014325 Bacteria 1801
97 Ga0163163_10982152 3300014325 Bacteria 908
98 Ga0163163_11448550 3300014325 Bacteria 748
99 Ga0157380_10738221 3300014326 Bacteria 994
100 Ga0182008_10396423 3300014497 Bacteria 741
101 Ga0157379_10019423 3300014968 Bacteria 6001
102 Ga0157379_10908230 3300014968 Bacteria 836
103 Ga0182007_10145159 3300015262 Bacteria 804
104 Ga0163161_10490277 3300017792 Bacteria 999
105 Ga0213872_10029746 3300021361 Bacteria 2505
106 Ga0213874_10056140 3300021377 Bacteria 1222
107 Ga0209026_1006578 3300025250 Bacteria 2810
108 Ga0209565_1000447 3300025263 Bacteria 32315
109 Ga0209673_1001055 3300025273 Bacteria 31608
110 Ga0209675_1042205 3300025291 Bacteria 990
111 Ga0209676_1000163 3300025292 Bacteria 157845
112 Ga0209676_1000188 3300025292 Bacteria 141232
113 Ga0209564_1035146 3300025295 Bacteria 1456
114 Ga0209758_1000110 3300025297 Bacteria 213110
115 Ga0209758_1001620 3300025297 Bacteria 25637
116 Ga0209758_1002131 3300025297 Bacteria 20893
117 Ga0209758_1007595 3300025297 Bacteria 7321
118 Ga0209050_1000095 3300025298 Bacteria 242722
119 Ga0209050_1000769 3300025298 Bacteria 46027
120 Ga0209050_1001497 3300025298 Bacteria 24764
121 Ga0209050_1013428 3300025298 Bacteria 3636
122 Ga0209256_1004418 3300025299 Bacteria 8843
123 Ga0209256_1010303 3300025299 Bacteria 3939
124 Ga0209256_1047277 3300025299 Bacteria 1060
125 Ga0207426_1072106 3300025302 Bacteria 960
126 Ga0209051_1002156 3300025303 Bacteria 14603
127 Ga0209257_1000074 3300025304 Bacteria 325641
128 Ga0209257_1000106 3300025304 Bacteria 242634
129 Ga0209257_1000242 3300025304 Bacteria 126891
130 Ga0209257_1000370 3300025304 Bacteria 90934
131 Ga0209257_1000407 3300025304 Bacteria 83438
132 Ga0209257_1004350 3300025304 Bacteria 11048
133 Ga0209257_1010609 3300025304 Bacteria 4621
134 Ga0209257_1041670 3300025304 Bacteria 1360
135 Ga0207697_10060281 3300025315 Bacteria 1578
136 Ga0207696_1064013 3300025711 Bacteria 1030
137 Ga0207680_10012995 3300025903 Bacteria 4259
138 Ga0207705_10799662 3300025909 Bacteria 732
139 Ga0207695_10007822 3300025913 Bacteria 13524
140 Ga0207695_11151876 3300025913 Bacteria 655
141 Ga0207660_10028167 3300025917 Bacteria 3841
142 Ga0207681_10524483 3300025923 Bacteria 972
143 Ga0207694_10010258 3300025924 Bacteria 7063
144 Ga0207694_10416632 3300025924 Bacteria 1118
145 Ga0207650_10000030 3300025925 Bacteria 235824
146 Ga0207650_10084740 3300025925 Bacteria 2410
147 Ga0207644_10064193 3300025931 Bacteria 2668
148 Ga0207644_10197720 3300025931 Bacteria 1584
149 Ga0207644_10233070 3300025931 Bacteria 1463
150 Ga0207690_10009813 3300025932 Bacteria 5689
151 Ga0207711_10010478 3300025941 Bacteria 7698
152 Ga0207711_10054127 3300025941 Bacteria 3443
153 Ga0207711_10295613 3300025941 Bacteria 1493
154 Ga0207689_10029816 3300025942 Bacteria 4550
155 Ga0207661_10443419 3300025944 Bacteria 1182
156 Ga0207667_10101500 3300025949 Bacteria 2968
157 Ga0207667_10251853 3300025949 Bacteria 1806
158 Ga0207667_10314274 3300025949 Bacteria 1600
159 Ga0207651_10591026 3300025960 Bacteria 969
160 Ga0207712_10078146 3300025961 Bacteria 2400
161 Ga0207668_10000152 3300025972 Bacteria 47686
162 Ga0207668_10075226 3300025972 Bacteria 2427
163 Ga0207668_10087906 3300025972 Bacteria 2274
164 Ga0207658_10000211 3300025986 Bacteria 60993
165 Ga0207677_10326764 3300026023 Bacteria 1277
166 Ga0207703_10000557 3300026035 Bacteria 38274
167 Ga0207703_10003412 3300026035 Bacteria 13335
168 Ga0207639_10024025 3300026041 Bacteria 4406
169 Ga0207678_11095562 3300026067 Bacteria 705
170 Ga0207702_10131013 3300026078 Bacteria 2257
171 Ga0207702_10366817 3300026078 Bacteria 1381
172 Ga0207641_10000011 3300026088 Bacteria 384362
173 Ga0207641_10003236 3300026088 Bacteria 14535
174 Ga0207676_10000095 3300026095 Bacteria 80405
175 Ga0207676_10001230 3300026095 Bacteria 19079
176 Ga0207676_10009994 3300026095 Bacteria 6752
177 Ga0207676_10023837 3300026095 Bacteria 4522
178 Ga0207676_10161072 3300026095 Bacteria 1944
179 Ga0207676_10343617 3300026095 Bacteria 1378
180 Ga0207683_10852012 3300026121 Bacteria 846
181 Ga0207698_11740200 3300026142 Bacteria 639
182 Ga0209999_1002016 3300027543 Bacteria 3543
183 Ga0268266_10003774 3300028379 Bacteria 14841
184 Ga0268266_10110844 3300028379 Bacteria 2431
185 Ga0268266_10115678 3300028379 Bacteria 2381
186 Ga0268265_10009659 3300028380 Bacteria 6513
187 Ga0268265_10144746 3300028380 Bacteria 1995
188 Ga0268265_10240143 3300028380 Bacteria 1598
189 Ga0268265_10252253 3300028380 Bacteria 1563
190 Ga0268265_11347750 3300028380 Bacteria 714
191 Ga0268264_10000002 3300028381 Bacteria 1153045
192 Ga0268264_10000125 3300028381 Bacteria 186416
193 Ga0307517_10009209 3300028786 Bacteria 14036
194 Ga0307517_10026333 3300028786 Bacteria 7055
195 Ga0307517_10085293 3300028786 Bacteria 2647
196 Ga0307515_10037385 3300028794 Bacteria 7810
197 Ga0265338_10135777 3300028800 Bacteria 1934
198 Ga0265327_10050478 3300031251 Bacteria 2176
199 Ga0265316_10655771 3300031344 Bacteria 742
200 Ga0307513_10000203 3300031456 Bacteria 85712
201 Ga0307513_10002433 3300031456 Bacteria 25816
202 Ga0307513_10005843 3300031456 Bacteria 16169
203 Ga0265314_10093782 3300031711 Bacteria 1948
204 Ga0307406_11038392 3300031901 Bacteria 705
205 Ga0307414_10649751 3300032004 Bacteria 951
206 Ga0307414_10903818 3300032004 Bacteria 809
207 Ga0307510_10064185 3300033180 Bacteria 3731
208 Ga0307510_10177209 3300033180 Bacteria 1701
209 Ga0373937_0062232 3300036401 Bacteria 3431
210 Ga0395899_0000223 3300037312 Bacteria 77606
211 Ga0395899_0486534 3300037312 Bacteria 802
212 Ga0395899_0519176 3300037312 Bacteria 770
213 Ga0395900_0000008 3300037418 Bacteria 480459
214 Ga0395898_0204033 3300037466 Bacteria 1886
215 Ga0395898_0683564 3300037466 Bacteria 968
216 Ga0395905_0003857 3300037471 Bacteria 15812
217 Ga0395905_0031910 3300037471 Bacteria 4956
218 Ga0395905_0469683 3300037471 Bacteria 1157
219 Ga0395905_0479091 3300037471 Bacteria 1144
220 Ga0395905_0573018 3300037471 Bacteria 1030
221 Ga0395901_0000008 3300038443 Bacteria 495962
222 Ga0395901_0057954 3300038443 Bacteria 4029
223 Ga0436365_0278030 3300039437 Bacteria 756
224 Ga0436365_1124610 3300039437 Bacteria 961
225 Ga0436361_0628798 3300039447 Bacteria 18139
226 Ga0436361_0871666 3300039447 Bacteria 657
227 Ga0436363_0864594 3300039450 Bacteria 1735
228 Ga0451853_0954181 3300041512 Bacteria 1402
229 Ga0439435_0194169 3300042436 Bacteria 667
230 Ga0450916_007842 3300042530 Bacteria 1289
231 Ga0466965_0238824 3300044683 Bacteria 972
232 Ga0453684_0853393 3300044712 Bacteria 978
233 Ga0495638_0065647 3300046460 Bacteria 2233
234 Ga0495638_0291830 3300046460 Bacteria 882
235 Ga0495638_0295741 3300046460 Bacteria 874
236 Ga0495585_0341264 3300046492 Bacteria 729
237 Ga0495583_0000013 3300046506 Bacteria 323372
238 Ga0495606_0053199 3300046507 Bacteria 2628
239 Ga0495606_0066675 3300046507 Bacteria 2282
240 Ga0495606_0423588 3300046507 Bacteria 688
241 Ga0495610_0001211 3300046512 Bacteria 23221
242 Ga0495620_0123013 3300046515 Bacteria 1021
243 Ga0495632_0071029 3300046519 Bacteria 1673
244 Ga0495643_0047845 3300046522 Bacteria 2314
245 Ga0495643_0276949 3300046522 Bacteria 773
246 Ga0495609_0121985 3300046538 Bacteria 1120
247 Ga0495597_0022380 3300046542 Bacteria 2932
248 Ga0495597_0117569 3300046542 Bacteria 1110
249 Ga0495668_0000317 3300046616 Bacteria 66025
250 Ga0495668_0037091 3300046616 Bacteria 2729
251 Ga0495668_0132656 3300046616 Bacteria 1363
252 Ga0495668_0156214 3300046616 Bacteria 1249
253 Ga0495668_0356586 3300046616 Bacteria 803
254 Ga0495611_0180596 3300046648 Bacteria 986
255 Ga0495625_0023118 3300046660 Bacteria 4752
256 Ga0495625_0059438 3300046660 Bacteria 2712
257 Ga0495625_0081588 3300046660 Bacteria 2250
258 Ga0495625_0126433 3300046660 Bacteria 1735
259 Ga0495669_0000009 3300046684 Bacteria 165516
260 Ga0495669_0020446 3300046684 Bacteria 2866
261 Ga0495669_0043815 3300046684 Bacteria 1993
262 Ga0495613_0000563 3300046689 Bacteria 30509
263 Ga0495589_0041576 3300046794 Bacteria 2293
264 Ga0495600_0270873 3300046809 Bacteria 1077
265 Ga0495672_0032898 3300047320 Bacteria 3218
266 Ga0495683_0137608 3300047323 Bacteria 1147
267 Ga0495673_0000025 3300047469 Bacteria 512352
268 Ga0495686_0007046 3300047472 Bacteria 8481
269 Ga0495593_0019875 3300047673 Bacteria 3763
270 Ga0495615_0033538 3300048090 Bacteria 1244
271 Ga0496100_1003461 3300048903 Bacteria 657
272 Ga0496101_0661522 3300048904 Bacteria 825
273 Ga0496102_0032886 3300048905 Bacteria 4661
274 Ga0496103_0033621 3300048906 Bacteria 3133
275 Ga0496106_0093551 3300048909 Bacteria 2323
276 Ga0496107_0007453 3300048910 Bacteria 7543
277 Ga0496108_0201525 3300048911 Bacteria 1727
278 Ga0496109_0038600 3300048912 Bacteria 4318
279 Ga0496111_0108974 3300048914 Bacteria 2039
280 Ga0496112_1012865 3300048915 Bacteria 750
281 Ga0496113_0063089 3300048916 Bacteria 2800
282 Ga0496115_0009131 3300048918 Bacteria 7359
283 Ga0496115_0566746 3300048918 Bacteria 906
284 Ga0496116_0101231 3300048919 Bacteria 1721
285 Ga0496117_0005164 3300048920 Bacteria 13931
286 Ga0496118_0009368 3300048921 Bacteria 9914
287 Ga0496121_0000442 3300048924 Bacteria 81890
288 Ga0496124_0050661 3300048927 Bacteria 3537
289 Ga0496126_0009077 3300048929 Bacteria 10628
290 Ga0501033_0082834 3300049570 Bacteria 2352
291 Ga0501034_0243025 3300049571 Bacteria 1746
292 Ga0501034_0798238 3300049571 Bacteria 837
293 Ga0501034_1043411 3300049571 Bacteria 700
294 Ga0501036_1038729 3300049572 Bacteria 670
295 Ga0501037_0021582 3300049573 Bacteria 4761
296 Ga0501037_0092293 3300049573 Bacteria 2190
297 Ga0501037_0650529 3300049573 Bacteria 704
298 Ga0501043_0307489 3300049579 Bacteria 1210
299 Ga0501046_0101029 3300049580 Bacteria 2213
300 Ga0501047_0004775 3300049581 Bacteria 12748
301 Ga0501047_0034026 3300049581 Bacteria 4920
302 Ga0501047_0042468 3300049581 Bacteria 4394
303 Ga0501047_0283019 3300049581 Bacteria 1502
304 Ga0501047_0360673 3300049581 Bacteria 1289
305 Ga0501047_0418979 3300049581 Bacteria 1171
306 Ga0501073_0041339 3300049589 Bacteria 3257
307 Ga0501073_0115525 3300049589 Bacteria 1860
308 Ga0501257_019081 3300049686 Bacteria 1602
309 Ga0501079_0799031 3300049741 Bacteria 743
310 Ga0501079_1358718 3300049741 Bacteria 559
311 Ga0501080_0040555 3300049742 Bacteria 4342
312 Ga0501083_0091334 3300049744 Bacteria 2010
313 Ga0501035_0127016 3300049822 Bacteria 2226
314 Ga0501044_0001062 3300049823 Bacteria 33045
315 Ga0501044_0002744 3300049823 Bacteria 20036
316 Ga0501044_0106875 3300049823 Bacteria 2810
317 Ga0501044_0626164 3300049823 Bacteria 967
318 Ga0501044_0654045 3300049823 Bacteria 940
319 Ga0501044_0762018 3300049823 Bacteria 849
320 nmdc:mga03683_39899_c1 3300050489 Bacteria 1923
321 nmdc:mga07m45_201948_c1 3300050496 Bacteria 1156
322 Ga0500646_0009045 3300053090 Bacteria 2551
323 Ga0500651_0284061 3300053093 Bacteria 953
324 Ga0500651_0564075 3300053093 Bacteria 621
325 Ga0500566_0025167 3300053094 Bacteria 3490
326 Ga0500641_0125448 3300053096 Bacteria 1107
327 Ga0500650_0269852 3300053098 Bacteria 759
328 Ga0500555_002139 3300053103 Bacteria 5780
329 Ga0500555_002477 3300053103 Bacteria 5337
330 Ga0500562_002176 3300053108 Bacteria 4898
331 Ga0500562_025976 3300053108 Bacteria 1534
332 Ga0500594_0073029 3300053118 Bacteria 1012
333 Ga0500595_000412 3300053119 Bacteria 27258
334 Ga0500608_096890 3300053122 Bacteria 1371
335 Ga0500614_001345 3300053123 Bacteria 5918
336 Ga0500642_0005867 3300053130 Bacteria 4000
337 Ga0500652_267003 3300053131 Bacteria 672
338 Ga0500658_0021973 3300053134 Bacteria 2420
339 Ga0500658_0295765 3300053134 Bacteria 744
340 Ga0500559_0000060 3300053136 Bacteria 87673
341 Ga0500559_0012138 3300053136 Bacteria 3668
342 Ga0500559_0016458 3300053136 Bacteria 3122
343 Ga0500559_0075506 3300053136 Bacteria 1524
344 Ga0500568_0257886 3300053139 Bacteria 634
345 Ga0500577_0022872 3300053142 Bacteria 2080
346 Ga0500577_0078321 3300053142 Bacteria 1312
347 Ga0500577_0097671 3300053142 Bacteria 1196
348 Ga0500588_0000362 3300053146 Bacteria 6969
349 Ga0500588_0185589 3300053146 Bacteria 766
350 Ga0500590_009973 3300053148 Bacteria 4787
351 Ga0500604_0003157 3300053151 Bacteria 4431
352 Ga0500604_0087583 3300053151 Bacteria 1013
353 Ga0500622_0133672 3300053156 Bacteria 1190
354 Ga0500611_030173 3300053727 Bacteria 1116
355 Ga0501084_0693025 3300054114 Bacteria 859
356 Ga0501082_0338369 3300060353 Bacteria 1311
357 Ga0501082_1613906 3300060353 Bacteria 566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0021582 Ga0501037_0021582_2023_2505 117
2 3300049581 Ga0501047_0418979 Ga0501047_0418979_604_1086 117
3 3300049823 Ga0501044_0002744 Ga0501044_0002744_8294_8776 117
4 3300006358 Ga0068871_100876128 Ga0068871_1008761282 123
5 3300014325 Ga0163163_11448550 Ga0163163_114485501 123
6 3300028794 Ga0307515_10037385 Ga0307515_100373856 123
7 3300046506 Ga0495583_0000013 Ga0495583_0000013_75179_75703 123
8 3300046512 Ga0495610_0001211 Ga0495610_0001211_1389_1919 123
9 3300046522 Ga0495643_0276949 Ga0495643_0276949_34_561 123
10 3300046794 Ga0495589_0041576 Ga0495589_0041576_394_918 123
11 3300047469 Ga0495673_0000025 Ga0495673_0000025_459876_460400 123
12 3300053134 Ga0500658_0021973 Ga0500658_0021973_331_861 123
13 3300053136 Ga0500559_0000060 Ga0500559_0000060_49254_49778 123
14 3300053136 Ga0500559_0016458 Ga0500559_0016458_2333_2854 123
15 3300005327 Ga0070658_11220035 Ga0070658_112200351 124
16 3300009177 Ga0105248_10164984 Ga0105248_101649842 124
17 3300014325 Ga0163163_10982152 Ga0163163_109821522 124
18 3300025909 Ga0207705_10799662 Ga0207705_107996622 124
19 3300028800 Ga0265338_10135777 Ga0265338_101357772 124
20 3300031344 Ga0265316_10655771 Ga0265316_106557711 124
21 3300037312 Ga0395899_0000223 Ga0395899_0000223_27400_27930 124
22 3300037418 Ga0395900_0000008 Ga0395900_0000008_197874_198404 124
23 3300037466 Ga0395898_0204033 Ga0395898_0204033_694_1224 124
24 3300037471 Ga0395905_0003857 Ga0395905_0003857_7147_7677 124
25 3300038443 Ga0395901_0000008 Ga0395901_0000008_282062_282592 124
26 3300046689 Ga0495613_0000563 Ga0495613_0000563_1302_1808 127
27 3300046809 Ga0495600_0270873 Ga0495600_0270873_102_608 127
28 3300039447 Ga0436361_0871666 Ga0436361_0871666_89_592 128
29 iso_pu_bacteria 2643221699 2644551266 128
30 3300046616 Ga0495668_0000317 Ga0495668_0000317_12063_12602 130
31 3300048918 Ga0496115_0566746 Ga0496115_0566746_330_851 130
32 iso_pu_bacteria 2643221663 2644353254 130
33 3300003323 rootH1_10028737 rootH1_100287372 131
34 3300005841 Ga0068863_100559329 Ga0068863_1005593292 131
35 3300009093 Ga0105240_10685754 Ga0105240_106857542 133
36 3300026078 Ga0207702_10366817 Ga0207702_103668172 133
37 3300053093 Ga0500651_0284061 Ga0500651_0284061_11_445 133
38 iso_pu_bacteria 2643221574 2643883993 133
39 iso_pu_bacteria 2643221699 2644549964 133
40 3300053139 Ga0500568_0257886 Ga0500568_0257886_140_577 134
41 3300053142 Ga0500577_0022872 Ga0500577_0022872_1594_2031 134
42 3300006881 Ga0068865_100018105 Ga0068865_1000181053 135
43 3300013306 Ga0163162_11961982 Ga0163162_119619821 135
44 3300026095 Ga0207676_10161072 Ga0207676_101610722 135
45 3300046684 Ga0495669_0043815 Ga0495669_0043815_1344_1898 135
46 3300049741 Ga0501079_1358718 Ga0501079_1358718_113_544 135
47 iso_pu_bacteria 2510917020 2511120249 136
48 3300009148 Ga0105243_11458694 Ga0105243_114586941 137
49 3300048929 Ga0496126_0009077 Ga0496126_0009077_6173_6709 137
50 iso_pu_bacteria 2643221661 2644343971 137
51 iso_pu_bacteria 2643221666 2644368550 137
52 iso_pu_bacteria 2739367756 2739790446 137
53 3300048905 Ga0496102_0032886 Ga0496102_0032886_2141_2689 138
54 3300048919 Ga0496116_0101231 Ga0496116_0101231_1080_1628 138
55 3300048927 Ga0496124_0050661 Ga0496124_0050661_1795_2331 138
56 iso_pu_bacteria 2643221598 2644001450 138
57 3300003794 Ga0055531_10003917 Ga0055531_100039172 139
58 3300005455 Ga0070663_100427161 Ga0070663_1004271611 139
59 3300009093 Ga0105240_11783067 Ga0105240_117830672 139
60 3300014326 Ga0157380_10738221 Ga0157380_107382212 139
61 3300021377 Ga0213874_10056140 Ga0213874_100561402 139
62 3300025297 Ga0209758_1001620 Ga0209758_10016208 139
63 3300025304 Ga0209257_1000074 Ga0209257_100007498 139
64 3300025304 Ga0209257_1000242 Ga0209257_100024298 139
65 3300025949 Ga0207667_10101500 Ga0207667_101015002 139
66 3300026067 Ga0207678_11095562 Ga0207678_110955622 139
67 3300039450 Ga0436363_0864594 Ga0436363_0864594_412_882 139
68 3300003791 Ga0055530_10067537 Ga0055530_100675371 140
69 3300003794 Ga0055531_10030686 Ga0055531_100306862 140
70 3300005327 Ga0070658_10527109 Ga0070658_105271092 140
71 3300006048 Ga0075363_100078131 Ga0075363_1000781312 140
72 3300025298 Ga0209050_1013428 Ga0209050_10134282 140
73 3300025304 Ga0209257_1000407 Ga0209257_100040777 140
74 3300025913 Ga0207695_11151876 Ga0207695_111518762 140
75 3300037471 Ga0395905_0031910 Ga0395905_0031910_1555_2067 140
76 3300038443 Ga0395901_0057954 Ga0395901_0057954_3305_3817 140
77 3300048906 Ga0496103_0033621 Ga0496103_0033621_1241_1774 140
78 3300048920 Ga0496117_0005164 Ga0496117_0005164_5945_6478 140
79 3300048921 Ga0496118_0009368 Ga0496118_0009368_4231_4764 140
80 3300048924 Ga0496121_0000442 Ga0496121_0000442_1415_1948 140
81 3300049571 Ga0501034_0798238 Ga0501034_0798238_286_786 140
82 3300050489 nmdc:mga03683_39899_c1 nmdc:mga03683_39899_c1_961_1458 140
83 iso_pu_bacteria 2884960567 2884965735 140
84 3300005334 Ga0068869_100025241 Ga0068869_1000252414 141
85 3300009174 Ga0105241_10197280 Ga0105241_101972802 141
86 3300025942 Ga0207689_10029816 Ga0207689_100298162 141
87 3300037312 Ga0395899_0519176 Ga0395899_0519176_139_651 141
88 3300037466 Ga0395898_0683564 Ga0395898_0683564_272_784 141
89 3300049822 Ga0501035_0127016 Ga0501035_0127016_295_795 141
90 3300053136 Ga0500559_0012138 Ga0500559_0012138_1120_1641 141
91 3300003781 Ga0055536_1002281 Ga0055536_100228114 142
92 3300003791 Ga0055530_10005036 Ga0055530_100050362 142
93 3300003791 Ga0055530_10047287 Ga0055530_100472872 142
94 3300003794 Ga0055531_10001586 Ga0055531_1000158617 142
95 3300005616 Ga0068852_101664277 Ga0068852_1016642771 142
96 3300009551 Ga0105238_10029665 Ga0105238_100296654 142
97 3300010375 Ga0105239_10261276 Ga0105239_102612763 142
98 3300021361 Ga0213872_10029746 Ga0213872_100297462 142
99 3300025292 Ga0209676_1000163 Ga0209676_1000163133 142
100 3300025292 Ga0209676_1000188 Ga0209676_100018828 142
101 3300025298 Ga0209050_1000769 Ga0209050_100076928 142
102 3300025298 Ga0209050_1001497 Ga0209050_100149717 142
103 3300025303 Ga0209051_1002156 Ga0209051_100215615 142
104 3300025304 Ga0209257_1000370 Ga0209257_100037062 142
105 3300025304 Ga0209257_1004350 Ga0209257_10043504 142
106 3300025924 Ga0207694_10010258 Ga0207694_100102586 142
107 3300026142 Ga0207698_11740200 Ga0207698_117402001 142
108 3300031901 Ga0307406_11038392 Ga0307406_110383922 142
109 3300032004 Ga0307414_10903818 Ga0307414_109038181 142
110 3300033180 Ga0307510_10064185 Ga0307510_100641853 142
111 3300037471 Ga0395905_0573018 Ga0395905_0573018_255_749 142
112 3300039447 Ga0436361_0628798 Ga0436361_0628798_5185_5694 142
113 3300046460 Ga0495638_0065647 Ga0495638_0065647_1167_1688 142
114 3300046507 Ga0495606_0066675 Ga0495606_0066675_404_925 142
115 3300046542 Ga0495597_0117569 Ga0495597_0117569_33_554 142
116 3300046616 Ga0495668_0037091 Ga0495668_0037091_1513_2034 142
117 3300046660 Ga0495625_0081588 Ga0495625_0081588_535_1056 142
118 3300049571 Ga0501034_1043411 Ga0501034_1043411_166_669 142
119 3300050496 nmdc:mga07m45_201948_c1 nmdc:mga07m45_201948_c1_153_674 142
120 3300053098 Ga0500650_0269852 Ga0500650_0269852_195_716 142
121 iso_pu_bacteria 2582581280 2585151503 142
122 iso_pu_bacteria 2582581293 2585195623 142
123 iso_pu_bacteria 2643221545 2643749329 142
124 iso_pu_bacteria 2643221552 2643783195 142
125 iso_pu_bacteria 2643221584 2643930861 142
126 iso_pu_bacteria 2643221640 2644224081 142
127 iso_pu_bacteria 2643221642 2644233067 142
128 iso_pu_bacteria 2643221691 2644508897 142
129 iso_pu_bacteria 2791355048 2792459941 142
130 iso_pu_bacteria 2818991435 2819535615 142
131 iso_pu_bacteria 2818991454 2819644890 142
132 iso_pu_bacteria 2843744320 2843744467 142
133 iso_pu_bacteria 2849560528 2849565050 142
134 iso_pu_bacteria 2849573788 2849575963 142
135 iso_pu_bacteria 2851153111 2851155940 142
136 iso_pu_bacteria 2857504554 2857507883 142
137 iso_pu_bacteria 2898329390 2898331606 142
138 3300005356 Ga0070674_100876536 Ga0070674_1008765361 143
139 3300005543 Ga0070672_100824295 Ga0070672_1008242952 143
140 3300009551 Ga0105238_10398799 Ga0105238_103987992 143
141 3300010375 Ga0105239_11534358 Ga0105239_115343582 143
142 3300025315 Ga0207697_10060281 Ga0207697_100602812 143
143 3300025924 Ga0207694_10416632 Ga0207694_104166322 143
144 3300025944 Ga0207661_10443419 Ga0207661_104434192 143
145 3300005618 Ga0068864_100714483 Ga0068864_1007144832 144
146 3300005844 Ga0068862_100921631 Ga0068862_1009216312 144
147 3300009553 Ga0105249_10213867 Ga0105249_102138671 144
148 3300014325 Ga0163163_10255976 Ga0163163_102559763 144
149 3300014968 Ga0157379_10908230 Ga0157379_109082302 144
150 3300026095 Ga0207676_10343617 Ga0207676_103436172 144
151 3300028380 Ga0268265_10240143 Ga0268265_102401432 144
152 3300032004 Ga0307414_10649751 Ga0307414_106497512 144
153 3300036401 Ga0373937_0062232 Ga0373937_0062232_1173_1670 144
154 3300048090 Ga0495615_0033538 Ga0495615_0033538_558_1031 144
155 3300049571 Ga0501034_0243025 Ga0501034_0243025_887_1369 144
156 3300049573 Ga0501037_0092293 Ga0501037_0092293_1005_1487 144
157 3300049581 Ga0501047_0034026 Ga0501047_0034026_4140_4622 144
158 3300049581 Ga0501047_0042468 Ga0501047_0042468_1842_2324 144
159 3300049823 Ga0501044_0001062 Ga0501044_0001062_32054_32536 144
160 3300053094 Ga0500566_0025167 Ga0500566_0025167_1490_1990 144
161 3300053103 Ga0500555_002477 Ga0500555_002477_4189_4689 144
162 3300053119 Ga0500595_000412 Ga0500595_000412_10647_11147 144
163 3300053142 Ga0500577_0078321 Ga0500577_0078321_99_599 144
164 3300053146 Ga0500588_0000362 Ga0500588_0000362_1701_2189 144
165 3300053146 Ga0500588_0185589 Ga0500588_0185589_233_733 144
166 3300053156 Ga0500622_0133672 Ga0500622_0133672_582_1082 144
167 3300003215 JGI25153J46596_10000042 JGI25153J46596_100000424 145
168 3300005328 Ga0070676_10708362 Ga0070676_107083621 145
169 3300005338 Ga0068868_100129792 Ga0068868_1001297922 145
170 3300005355 Ga0070671_100749590 Ga0070671_1007495902 145
171 3300005364 Ga0070673_100453639 Ga0070673_1004536392 145
172 3300005456 Ga0070678_100821723 Ga0070678_1008217232 145
173 3300005535 Ga0070684_101394554 Ga0070684_1013945541 145
174 3300005548 Ga0070665_100121142 Ga0070665_1001211422 145
175 3300005564 Ga0070664_100170995 Ga0070664_1001709953 145
176 3300005618 Ga0068864_100034218 Ga0068864_1000342182 145
177 3300005841 Ga0068863_100469984 Ga0068863_1004699842 145
178 3300005841 Ga0068863_100590201 Ga0068863_1005902012 145
179 3300005842 Ga0068858_101314118 Ga0068858_1013141182 145
180 3300006237 Ga0097621_100861857 Ga0097621_1008618572 145
181 3300009177 Ga0105248_10204924 Ga0105248_102049243 145
182 3300010375 Ga0105239_10320624 Ga0105239_103206243 145
183 3300014325 Ga0163163_10084595 Ga0163163_100845952 145
184 3300015262 Ga0182007_10145159 Ga0182007_101451591 145
185 3300025297 Ga0209758_1000110 Ga0209758_1000110200 145
186 3300025299 Ga0209256_1047277 Ga0209256_10472772 145
187 3300025931 Ga0207644_10064193 Ga0207644_100641934 145
188 3300025931 Ga0207644_10197720 Ga0207644_101977202 145
189 3300025931 Ga0207644_10233070 Ga0207644_102330702 145
190 3300025941 Ga0207711_10010478 Ga0207711_100104785 145
191 3300025941 Ga0207711_10295613 Ga0207711_102956132 145
192 3300025960 Ga0207651_10591026 Ga0207651_105910262 145
193 3300026023 Ga0207677_10326764 Ga0207677_103267642 145
194 3300026095 Ga0207676_10023837 Ga0207676_100238375 145
195 3300026121 Ga0207683_10852012 Ga0207683_108520122 145
196 3300027543 Ga0209999_1002016 Ga0209999_10020164 145
197 3300028379 Ga0268266_10115678 Ga0268266_101156782 145
198 3300028786 Ga0307517_10085293 Ga0307517_100852932 145
199 3300031251 Ga0265327_10050478 Ga0265327_100504783 145
200 3300031456 Ga0307513_10000203 Ga0307513_1000020341 145
201 3300031456 Ga0307513_10005843 Ga0307513_1000584310 145
202 3300031711 Ga0265314_10093782 Ga0265314_100937822 145
203 3300033180 Ga0307510_10177209 Ga0307510_101772093 145
204 3300041512 Ga0451853_0954181 Ga0451853_0954181_151_648 145
205 3300046460 Ga0495638_0291830 Ga0495638_0291830_196_699 145
206 3300046460 Ga0495638_0295741 Ga0495638_0295741_246_746 145
207 3300046507 Ga0495606_0053199 Ga0495606_0053199_617_1147 145
208 3300046507 Ga0495606_0423588 Ga0495606_0423588_11_514 145
209 3300046515 Ga0495620_0123013 Ga0495620_0123013_195_725 145
210 3300046522 Ga0495643_0047845 Ga0495643_0047845_1678_2208 145
211 3300046538 Ga0495609_0121985 Ga0495609_0121985_558_1088 145
212 3300046542 Ga0495597_0022380 Ga0495597_0022380_2215_2745 145
213 3300046616 Ga0495668_0132656 Ga0495668_0132656_89_592 145
214 3300046616 Ga0495668_0356586 Ga0495668_0356586_250_753 145
215 3300046648 Ga0495611_0180596 Ga0495611_0180596_384_887 145
216 3300046660 Ga0495625_0023118 Ga0495625_0023118_433_936 145
217 3300046660 Ga0495625_0126433 Ga0495625_0126433_659_1162 145
218 3300046684 Ga0495669_0020446 Ga0495669_0020446_816_1319 145
219 3300047323 Ga0495683_0137608 Ga0495683_0137608_351_854 145
220 3300047673 Ga0495593_0019875 Ga0495593_0019875_1782_2312 145
221 3300048909 Ga0496106_0093551 Ga0496106_0093551_287_790 145
222 3300048910 Ga0496107_0007453 Ga0496107_0007453_6849_7352 145
223 3300048911 Ga0496108_0201525 Ga0496108_0201525_115_618 145
224 3300048912 Ga0496109_0038600 Ga0496109_0038600_1815_2318 145
225 3300048914 Ga0496111_0108974 Ga0496111_0108974_1328_1831 145
226 3300048915 Ga0496112_1012865 Ga0496112_1012865_53_556 145
227 3300048916 Ga0496113_0063089 Ga0496113_0063089_487_990 145
228 3300049570 Ga0501033_0082834 Ga0501033_0082834_157_657 145
229 3300049573 Ga0501037_0650529 Ga0501037_0650529_139_633 145
230 3300049580 Ga0501046_0101029 Ga0501046_0101029_192_692 145
231 3300049581 Ga0501047_0283019 Ga0501047_0283019_451_951 145
232 3300049589 Ga0501073_0041339 Ga0501073_0041339_336_836 145
233 3300049589 Ga0501073_0115525 Ga0501073_0115525_328_822 145
234 3300049742 Ga0501080_0040555 Ga0501080_0040555_1354_1854 145
235 3300049744 Ga0501083_0091334 Ga0501083_0091334_353_853 145
236 3300049823 Ga0501044_0106875 Ga0501044_0106875_1792_2292 145
237 3300049823 Ga0501044_0626164 Ga0501044_0626164_348_848 145
238 3300049823 Ga0501044_0762018 Ga0501044_0762018_175_669 145
239 3300053090 Ga0500646_0009045 Ga0500646_0009045_1560_2060 145
240 3300053093 Ga0500651_0564075 Ga0500651_0564075_12_542 145
241 3300053118 Ga0500594_0073029 Ga0500594_0073029_59_553 145
242 3300053122 Ga0500608_096890 Ga0500608_096890_456_941 145
243 3300053123 Ga0500614_001345 Ga0500614_001345_1457_1987 145
244 3300053130 Ga0500642_0005867 Ga0500642_0005867_3327_3827 145
245 3300053131 Ga0500652_267003 Ga0500652_267003_59_559 145
246 3300053134 Ga0500658_0295765 Ga0500658_0295765_188_718 145
247 3300053136 Ga0500559_0075506 Ga0500559_0075506_281_811 145
248 3300053142 Ga0500577_0097671 Ga0500577_0097671_664_1152 145
249 3300053148 Ga0500590_009973 Ga0500590_009973_560_1090 145
250 3300053151 Ga0500604_0003157 Ga0500604_0003157_2050_2568 145
251 3300053151 Ga0500604_0087583 Ga0500604_0087583_59_559 145
252 3300053727 Ga0500611_030173 Ga0500611_030173_315_815 145
253 3300054114 Ga0501084_0693025 Ga0501084_0693025_22_522 145
254 3300060353 Ga0501082_0338369 Ga0501082_0338369_717_1217 145
255 3300060353 Ga0501082_1613906 Ga0501082_1613906_17_511 145
256 3300002741 JGI25157J39369_1029700 JGI25157J39369_10297002 146
257 3300003773 Ga0055537_1004257 Ga0055537_10042574 146
258 3300003775 Ga0055524_1026078 Ga0055524_10260781 146
259 3300003775 Ga0055524_1033155 Ga0055524_10331552 146
260 3300003790 Ga0055528_1020185 Ga0055528_10201853 146
261 3300003791 Ga0055530_10000090 Ga0055530_1000009029 146
262 3300003794 Ga0055531_10000579 Ga0055531_1000057914 146
263 3300005262 Ga0065165_1002252 Ga0065165_10022525 146
264 3300005262 Ga0065165_1003048 Ga0065165_100304814 146
265 3300005262 Ga0065165_1038572 Ga0065165_10385722 146
266 3300005331 Ga0070670_100000007 Ga0070670_100000007283 146
267 3300005335 Ga0070666_10022658 Ga0070666_100226583 146
268 3300005347 Ga0070668_100001128 Ga0070668_10000112819 146
269 3300005347 Ga0070668_100002441 Ga0070668_1000024419 146
270 3300005347 Ga0070668_100031993 Ga0070668_1000319934 146
271 3300005353 Ga0070669_100174684 Ga0070669_1001746842 146
272 3300005367 Ga0070667_100002530 Ga0070667_10000253012 146
273 3300005530 Ga0070679_100750195 Ga0070679_1007501952 146
274 3300005548 Ga0070665_100003703 Ga0070665_1000037039 146
275 3300005563 Ga0068855_100129579 Ga0068855_1001295793 146
276 3300005563 Ga0068855_100149425 Ga0068855_1001494254 146
277 3300005563 Ga0068855_100341983 Ga0068855_1003419831 146
278 3300005614 Ga0068856_100903965 Ga0068856_1009039652 146
279 3300005617 Ga0068859_100103499 Ga0068859_1001034992 146
280 3300005618 Ga0068864_100000093 Ga0068864_10000009336 146
281 3300005618 Ga0068864_100000095 Ga0068864_10000009569 146
282 3300005618 Ga0068864_100014083 Ga0068864_1000140838 146
283 3300005618 Ga0068864_101289809 Ga0068864_1012898091 146
284 3300005841 Ga0068863_100000045 Ga0068863_10000004545 146
285 3300005841 Ga0068863_100003539 Ga0068863_10000353912 146
286 3300005842 Ga0068858_100003027 Ga0068858_1000030273 146
287 3300005842 Ga0068858_100010617 Ga0068858_10001061710 146
288 3300005843 Ga0068860_100000037 Ga0068860_100000037122 146
289 3300005843 Ga0068860_100000204 Ga0068860_10000020440 146
290 3300005844 Ga0068862_100001565 Ga0068862_1000015659 146
291 3300005844 Ga0068862_100043001 Ga0068862_1000430014 146
292 3300006931 Ga0097620_100103498 Ga0097620_1001034982 146
293 3300009092 Ga0105250_10075440 Ga0105250_100754402 146
294 3300009148 Ga0105243_10560783 Ga0105243_105607832 146
295 3300009177 Ga0105248_10043098 Ga0105248_100430984 146
296 3300009551 Ga0105238_11090792 Ga0105238_110907921 146
297 3300009553 Ga0105249_10017474 Ga0105249_100174744 146
298 3300013104 Ga0157370_10767006 Ga0157370_107670062 146
299 3300013297 Ga0157378_11317707 Ga0157378_113177071 146
300 3300013306 Ga0163162_10128321 Ga0163162_101283211 146
301 3300013308 Ga0157375_10791929 Ga0157375_107919292 146
302 3300014497 Ga0182008_10396423 Ga0182008_103964232 146
303 3300014968 Ga0157379_10019423 Ga0157379_100194236 146
304 3300017792 Ga0163161_10490277 Ga0163161_104902772 146
305 3300025250 Ga0209026_1006578 Ga0209026_10065784 146
306 3300025263 Ga0209565_1000447 Ga0209565_100044731 146
307 3300025273 Ga0209673_1001055 Ga0209673_100105513 146
308 3300025291 Ga0209675_1042205 Ga0209675_10422052 146
309 3300025295 Ga0209564_1035146 Ga0209564_10351462 146
310 3300025297 Ga0209758_1002131 Ga0209758_100213124 146
311 3300025297 Ga0209758_1007595 Ga0209758_10075954 146
312 3300025298 Ga0209050_1000095 Ga0209050_100009581 146
313 3300025299 Ga0209256_1004418 Ga0209256_10044187 146
314 3300025299 Ga0209256_1010303 Ga0209256_10103033 146
315 3300025302 Ga0207426_1072106 Ga0207426_10721062 146
316 3300025304 Ga0209257_1000106 Ga0209257_1000106173 146
317 3300025304 Ga0209257_1010609 Ga0209257_10106095 146
318 3300025304 Ga0209257_1041670 Ga0209257_10416702 146
319 3300025711 Ga0207696_1064013 Ga0207696_10640132 146
320 3300025903 Ga0207680_10012995 Ga0207680_100129953 146
321 3300025913 Ga0207695_10007822 Ga0207695_100078224 146
322 3300025917 Ga0207660_10028167 Ga0207660_100281674 146
323 3300025923 Ga0207681_10524483 Ga0207681_105244832 146
324 3300025925 Ga0207650_10000030 Ga0207650_1000003069 146
325 3300025925 Ga0207650_10084740 Ga0207650_100847402 146
326 3300025932 Ga0207690_10009813 Ga0207690_100098134 146
327 3300025941 Ga0207711_10054127 Ga0207711_100541274 146
328 3300025949 Ga0207667_10251853 Ga0207667_102518533 146
329 3300025949 Ga0207667_10314274 Ga0207667_103142742 146
330 3300025961 Ga0207712_10078146 Ga0207712_100781462 146
331 3300025972 Ga0207668_10000152 Ga0207668_1000015227 146
332 3300025972 Ga0207668_10075226 Ga0207668_100752264 146
333 3300025972 Ga0207668_10087906 Ga0207668_100879063 146
334 3300025986 Ga0207658_10000211 Ga0207658_1000021112 146
335 3300026035 Ga0207703_10000557 Ga0207703_1000055719 146
336 3300026035 Ga0207703_10003412 Ga0207703_100034127 146
337 3300026041 Ga0207639_10024025 Ga0207639_100240255 146
338 3300026078 Ga0207702_10131013 Ga0207702_101310132 146
339 3300026088 Ga0207641_10000011 Ga0207641_10000011115 146
340 3300026088 Ga0207641_10003236 Ga0207641_100032366 146
341 3300026095 Ga0207676_10000095 Ga0207676_1000009569 146
342 3300026095 Ga0207676_10001230 Ga0207676_1000123020 146
343 3300026095 Ga0207676_10009994 Ga0207676_100099943 146
344 3300028379 Ga0268266_10003774 Ga0268266_100037748 146
345 3300028379 Ga0268266_10110844 Ga0268266_101108442 146
346 3300028380 Ga0268265_10009659 Ga0268265_100096597 146
347 3300028380 Ga0268265_10144746 Ga0268265_101447462 146
348 3300028380 Ga0268265_10252253 Ga0268265_102522531 146
349 3300028380 Ga0268265_11347750 Ga0268265_113477501 146
350 3300028381 Ga0268264_10000002 Ga0268264_10000002200 146
351 3300028381 Ga0268264_10000125 Ga0268264_10000125132 146
352 3300028786 Ga0307517_10009209 Ga0307517_100092099 146
353 3300028786 Ga0307517_10026333 Ga0307517_100263334 146
354 3300031456 Ga0307513_10002433 Ga0307513_100024339 146
355 3300037312 Ga0395899_0486534 Ga0395899_0486534_169_678 146
356 3300037471 Ga0395905_0469683 Ga0395905_0469683_257_769 146
357 3300037471 Ga0395905_0479091 Ga0395905_0479091_298_807 146
358 3300039437 Ga0436365_0278030 Ga0436365_0278030_34_543 146
359 3300039437 Ga0436365_1124610 Ga0436365_1124610_43_627 146
360 3300042436 Ga0439435_0194169 Ga0439435_0194169_135_656 146
361 3300042530 Ga0450916_007842 Ga0450916_007842_545_1066 146
362 3300044683 Ga0466965_0238824 Ga0466965_0238824_161_676 146
363 3300044712 Ga0453684_0853393 Ga0453684_0853393_150_641 146
364 3300046492 Ga0495585_0341264 Ga0495585_0341264_187_705 146
365 3300046519 Ga0495632_0071029 Ga0495632_0071029_467_988 146
366 3300046616 Ga0495668_0156214 Ga0495668_0156214_401_889 146
367 3300046660 Ga0495625_0059438 Ga0495625_0059438_1845_2366 146
368 3300046684 Ga0495669_0000009 Ga0495669_0000009_124567_125079 146
369 3300047320 Ga0495672_0032898 Ga0495672_0032898_1337_1855 146
370 3300047472 Ga0495686_0007046 Ga0495686_0007046_6213_6746 146
371 3300048903 Ga0496100_1003461 Ga0496100_1003461_55_564 146
372 3300048904 Ga0496101_0661522 Ga0496101_0661522_262_771 146
373 3300048918 Ga0496115_0009131 Ga0496115_0009131_6099_6611 146
374 3300049572 Ga0501036_1038729 Ga0501036_1038729_25_516 146
375 3300049579 Ga0501043_0307489 Ga0501043_0307489_229_720 146
376 3300049581 Ga0501047_0004775 Ga0501047_0004775_4339_4839 146
377 3300049581 Ga0501047_0360673 Ga0501047_0360673_673_1188 146
378 3300049686 Ga0501257_019081 Ga0501257_019081_14_550 146
379 3300049741 Ga0501079_0799031 Ga0501079_0799031_174_677 146
380 3300049823 Ga0501044_0654045 Ga0501044_0654045_152_658 146
381 3300053096 Ga0500641_0125448 Ga0500641_0125448_502_996 146
382 3300053103 Ga0500555_002139 Ga0500555_002139_2192_2698 146
383 3300053108 Ga0500562_002176 Ga0500562_002176_723_1220 146
384 3300053108 Ga0500562_025976 Ga0500562_025976_664_1158 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

26

156

0.93

Feature Viewer

pLDDT pTM Quality
72.32 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map