F429723

General Info

Members Datasets Scaffolds Average Seq Length
383 212 766 92

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0088667|Ga0501034_0088667_2683_3021
Length 112
Sequence VLQHTTLPDGVLKHTLQEIEMDNTNVIIKPLVTEKSTHQQTTRNVYTFMVHANANKPQIKQAVEKIYEVKVKDVRTLVRKGKPRRSRFKMATTSDWKRAIVVLDENSRIELF

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
83 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
156 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
180 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.38
Metatranscriptomes 8.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.52
Rhizosphere 98.96
Stem 0
Stem Tuber 0
Unclassified 26.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0088667 3300049571 Bacteria 3091
2 Ga0070658_10811941 3300005327 Bacteria 813
3 Ga0070676_10306986 3300005328 Bacteria 1077
4 Ga0070683_101491859 3300005329 Bacteria 650
5 Ga0070690_100833711 3300005330 Unclassified 717
6 Ga0070670_100623951 3300005331 Bacteria 966
7 Ga0070670_102115732 3300005331 Unclassified 519
8 Ga0070677_10014617 3300005333 Bacteria 2766
9 Ga0070677_10361046 3300005333 Unclassified 755
10 Ga0070666_10657069 3300005335 Unclassified 767
11 Ga0070666_11135686 3300005335 Bacteria 581
12 Ga0070666_11392985 3300005335 Unclassified 524
13 Ga0068868_100949361 3300005338 Unclassified 784
14 Ga0070660_100877763 3300005339 Bacteria 756
15 Ga0070691_10089853 3300005341 Bacteria 1513
16 Ga0070687_100681154 3300005343 Bacteria 716
17 Ga0070661_100553298 3300005344 Bacteria 926
18 Ga0070668_100331830 3300005347 Bacteria 1283
19 Ga0070668_100580296 3300005347 Bacteria 979
20 Ga0070669_100789268 3300005353 Bacteria 807
21 Ga0070675_100014474 3300005354 Bacteria 6222
22 Ga0070675_100045940 3300005354 Bacteria 3575
23 Ga0070675_100482871 3300005354 Bacteria 1115
24 Ga0070675_100754069 3300005354 Bacteria 888
25 Ga0070675_101868563 3300005354 Unclassified 554
26 Ga0070671_100951022 3300005355 Bacteria 752
27 Ga0070674_100045906 3300005356 Bacteria 2986
28 Ga0070674_100755647 3300005356 Unclassified 836
29 Ga0070673_100066769 3300005364 Bacteria 2874
30 Ga0070673_100874322 3300005364 Unclassified 833
31 Ga0070673_101432098 3300005364 Bacteria 651
32 Ga0070688_100203025 3300005365 Bacteria 1388
33 Ga0070688_100852264 3300005365 Bacteria 716
34 Ga0070667_100153564 3300005367 Unclassified 2024
35 Ga0070667_101157317 3300005367 Unclassified 724
36 Ga0070667_101525202 3300005367 Unclassified 628
37 Ga0070714_102477432 3300005435 Unclassified 504
38 Ga0070701_11314807 3300005438 Unclassified 517
39 Ga0070705_100804015 3300005440 Bacteria 748
40 Ga0070700_101076297 3300005441 Unclassified 665
41 Ga0070663_100724357 3300005455 Unclassified 847
42 Ga0070663_101898914 3300005455 Unclassified 535
43 Ga0070678_100486564 3300005456 Bacteria 1087
44 Ga0070678_101903433 3300005456 Bacteria 562
45 Ga0070662_101569362 3300005457 Bacteria 568
46 Ga0070681_11362509 3300005458 Unclassified 633
47 Ga0068867_101253818 3300005459 Bacteria 683
48 Ga0070706_100290328 3300005467 Unclassified 1526
49 Ga0070679_102126085 3300005530 Bacteria 511
50 Ga0070684_100730268 3300005535 Bacteria 924
51 Ga0070684_102087175 3300005535 Unclassified 535
52 Ga0068853_100439304 3300005539 Bacteria 1226
53 Ga0068853_101642634 3300005539 Bacteria 623
54 Ga0070672_100003420 3300005543 Bacteria 10294
55 Ga0070672_101016308 3300005543 Bacteria 735
56 Ga0070672_101729094 3300005543 Unclassified 562
57 Ga0070665_101135083 3300005548 Bacteria 793
58 Ga0070665_101377072 3300005548 Bacteria 715
59 Ga0068855_100107890 3300005563 Bacteria 3199
60 Ga0068855_100136892 3300005563 Bacteria 2793
61 Ga0068855_101730616 3300005563 Bacteria 637
62 Ga0068855_102332379 3300005563 Bacteria 535
63 Ga0068857_100044719 3300005577 Bacteria 3929
64 Ga0068857_100205784 3300005577 Bacteria 1795
65 Ga0068856_100628397 3300005614 Bacteria 1095
66 Ga0068852_100573939 3300005616 Bacteria 1130
67 Ga0068852_101155682 3300005616 Bacteria 795
68 Ga0068859_101159359 3300005617 Bacteria 851
69 Ga0068864_101510244 3300005618 Bacteria 675
70 Ga0068863_100847619 3300005841 Bacteria 913
71 Ga0068863_101168924 3300005841 Bacteria 775
72 Ga0068863_101226829 3300005841 Bacteria 756
73 Ga0068858_100145575 3300005842 Bacteria 2225
74 Ga0068860_100186521 3300005843 Unclassified 2006
75 Ga0068860_101015073 3300005843 Bacteria 848
76 Ga0068860_102691909 3300005843 Unclassified 516
77 Ga0068862_100076231 3300005844 Unclassified 2902
78 Ga0068862_100636618 3300005844 Bacteria 1027
79 Ga0068862_100825406 3300005844 Bacteria 907
80 Ga0070717_10056982 3300006028 Bacteria 3230
81 Ga0097621_102259932 3300006237 Unclassified 520
82 Ga0075430_100021518 3300006846 Bacteria 5481
83 Ga0075431_101295143 3300006847 Bacteria 690
84 Ga0075434_101193494 3300006871 Bacteria 773
85 Ga0075429_100169194 3300006880 Bacteria 1914
86 Ga0097620_101159444 3300006931 Bacteria 851
87 Ga0105240_10010542 3300009093 Bacteria 12980
88 Ga0105240_11553231 3300009093 Unclassified 693
89 Ga0105240_12329124 3300009093 Unclassified 555
90 Ga0111539_10708783 3300009094 Bacteria 1171
91 Ga0111539_10877943 3300009094 Bacteria 1043
92 Ga0111539_12387630 3300009094 Unclassified 613
93 Ga0111539_13391950 3300009094 Bacteria 512
94 Ga0105245_10034862 3300009098 Bacteria 4465
95 Ga0114129_12234992 3300009147 Bacteria 658
96 Ga0105241_10293896 3300009174 Bacteria 1392
97 Ga0105241_11462368 3300009174 Bacteria 656
98 Ga0105241_11688424 3300009174 Bacteria 615
99 Ga0105241_11736155 3300009174 Bacteria 607
100 Ga0105248_10341732 3300009177 Bacteria 1685
101 Ga0105248_10953046 3300009177 Bacteria 969
102 Ga0105248_11141292 3300009177 Bacteria 881
103 Ga0105248_11233232 3300009177 Bacteria 846
104 Ga0105248_12123885 3300009177 Bacteria 639
105 Ga0105248_12860281 3300009177 Bacteria 550
106 Ga0105248_12887268 3300009177 Bacteria 548
107 Ga0105237_12111972 3300009545 Bacteria 572
108 Ga0105238_11234540 3300009551 Unclassified 772
109 Ga0105238_11946548 3300009551 Bacteria 621
110 Ga0105238_13051297 3300009551 Unclassified 503
111 Ga0105239_10021847 3300010375 Bacteria 7054
112 Ga0105239_11483590 3300010375 Bacteria 783
113 Ga0105246_11252625 3300011119 Unclassified 685
114 Ga0105246_11307445 3300011119 Bacteria 672
115 Ga0105246_12494654 3300011119 Unclassified 509
116 Ga0157373_10488212 3300013100 Bacteria 889
117 Ga0157373_10662057 3300013100 Unclassified 763
118 Ga0157373_11473932 3300013100 Bacteria 519
119 Ga0157371_10150732 3300013102 Bacteria 1658
120 Ga0157371_10400185 3300013102 Bacteria 1005
121 Ga0157371_11547702 3300013102 Unclassified 518
122 Ga0157370_10164701 3300013104 Bacteria 2062
123 Ga0157370_11012795 3300013104 Viruses 752
124 Ga0157370_11017781 3300013104 Unclassified 750
125 Ga0157370_11591049 3300013104 Bacteria 587
126 Ga0157370_11655694 3300013104 Bacteria 575
127 Ga0157369_10065330 3300013105 Bacteria 3915
128 Ga0157369_10323946 3300013105 Unclassified 1602
129 Ga0157369_11162447 3300013105 Bacteria 788
130 Ga0157369_12078217 3300013105 Bacteria 576
131 Ga0157374_10266340 3300013296 Bacteria 1689
132 Ga0157374_10648989 3300013296 Unclassified 1067
133 Ga0157374_11090429 3300013296 Bacteria 819
134 Ga0157374_11380003 3300013296 Unclassified 727
135 Ga0157374_12307926 3300013296 Unclassified 565
136 Ga0157378_10385447 3300013297 Bacteria 1377
137 Ga0157378_11208048 3300013297 Unclassified 796
138 Ga0157378_12021024 3300013297 Bacteria 626
139 Ga0163162_10366212 3300013306 Bacteria 1574
140 Ga0163162_11397614 3300013306 Unclassified 796
141 Ga0163162_11684685 3300013306 Bacteria 724
142 Ga0163162_12344043 3300013306 Bacteria 613
143 Ga0163162_12592219 3300013306 Unclassified 583
144 Ga0163162_12754731 3300013306 Bacteria 566
145 Ga0163162_12814301 3300013306 Bacteria 560
146 Ga0163162_12824312 3300013306 Unclassified 559
147 Ga0157372_10024618 3300013307 Bacteria 6543
148 Ga0157372_10958132 3300013307 Bacteria 992
149 Ga0157372_10988740 3300013307 Bacteria 975
150 Ga0157372_11050792 3300013307 Bacteria 943
151 Ga0157372_11257712 3300013307 Bacteria 854
152 Ga0157372_11573055 3300013307 Bacteria 757
153 Ga0157372_12934707 3300013307 Unclassified 546
154 Ga0157375_10202402 3300013308 Bacteria 2142
155 Ga0157375_10963340 3300013308 Bacteria 994
156 Ga0157375_11408586 3300013308 Bacteria 821
157 Ga0157375_12550887 3300013308 Unclassified 611
158 Ga0157375_13073581 3300013308 Unclassified 557
159 Ga0163163_10630254 3300014325 Bacteria 1136
160 Ga0163163_11604476 3300014325 Bacteria 712
161 Ga0163163_12130173 3300014325 Unclassified 620
162 Ga0163163_12293888 3300014325 Unclassified 599
163 Ga0157380_11405189 3300014326 Bacteria 748
164 Ga0157380_11856925 3300014326 Bacteria 662
165 Ga0157380_12272294 3300014326 Bacteria 607
166 Ga0182008_10724579 3300014497 Bacteria 570
167 Ga0157379_11693219 3300014968 Bacteria 619
168 Ga0157379_12089907 3300014968 Bacteria 561
169 Ga0157376_10550745 3300014969 Bacteria 1141
170 Ga0163161_10624370 3300017792 Bacteria 891
171 Ga0163161_11958117 3300017792 Bacteria 521
172 Ga0197907_10616790 3300020069 Unclassified 518
173 Ga0206356_11384593 3300020070 Bacteria 866
174 Ga0206356_11692285 3300020070 Bacteria 687
175 Ga0206349_1209078 3300020075 Bacteria 2609
176 Ga0206355_1609993 3300020076 Bacteria 1768
177 Ga0206352_10155047 3300020078 Bacteria 3531
178 Ga0206350_10167319 3300020080 Bacteria 937
179 Ga0206354_11125662 3300020081 Bacteria 918
180 Ga0154015_1310134 3300020610 Bacteria 2182
181 Ga0224712_10002936 3300022467 Bacteria 4316
182 Ga0207682_10017434 3300025893 Bacteria 2805
183 Ga0207682_10190252 3300025893 Bacteria 940
184 Ga0207688_10743908 3300025901 Bacteria 621
185 Ga0207680_10761557 3300025903 Bacteria 694
186 Ga0207680_10896601 3300025903 Unclassified 636
187 Ga0207645_10155516 3300025907 Bacteria 1494
188 Ga0207705_10726055 3300025909 Unclassified 772
189 Ga0207684_10183717 3300025910 Unclassified 1803
190 Ga0207654_10025454 3300025911 Bacteria 3192
191 Ga0207654_10590008 3300025911 Bacteria 792
192 Ga0207695_10000534 3300025913 Bacteria 79293
193 Ga0207695_10969376 3300025913 Unclassified 730
194 Ga0207662_10848710 3300025918 Unclassified 645
195 Ga0207657_10276088 3300025919 Bacteria 1335
196 Ga0207657_10552181 3300025919 Bacteria 901
197 Ga0207652_11458125 3300025921 Unclassified 588
198 Ga0207681_10457458 3300025923 Bacteria 1039
199 Ga0207650_10305731 3300025925 Bacteria 1300
200 Ga0207650_10408055 3300025925 Bacteria 1125
201 Ga0207650_10533170 3300025925 Unclassified 983
202 Ga0207659_10031407 3300025926 Bacteria 3635
203 Ga0207659_10222876 3300025926 Bacteria 1517
204 Ga0207659_10728891 3300025926 Bacteria 850
205 Ga0207659_11186086 3300025926 Bacteria 656
206 Ga0207659_11503248 3300025926 Bacteria 576
207 Ga0207687_10004724 3300025927 Bacteria 9061
208 Ga0207664_11539584 3300025929 Unclassified 587
209 Ga0207644_10610040 3300025931 Bacteria 907
210 Ga0207644_11772979 3300025931 Bacteria 517
211 Ga0207644_11831384 3300025931 Unclassified 508
212 Ga0207690_10222641 3300025932 Bacteria 1444
213 Ga0207690_10848754 3300025932 Bacteria 756
214 Ga0207706_10420163 3300025933 Bacteria 1158
215 Ga0207706_10687514 3300025933 Bacteria 875
216 Ga0207686_11413027 3300025934 Bacteria 573
217 Ga0207669_10463130 3300025937 Bacteria 1007
218 Ga0207669_10499326 3300025937 Bacteria 973
219 Ga0207669_10621222 3300025937 Bacteria 880
220 Ga0207691_10007825 3300025940 Bacteria 10293
221 Ga0207691_10389695 3300025940 Bacteria 1189
222 Ga0207691_11223088 3300025940 Unclassified 622
223 Ga0207691_11234767 3300025940 Bacteria 619
224 Ga0207711_10140972 3300025941 Bacteria 2169
225 Ga0207711_11167199 3300025941 Bacteria 711
226 Ga0207661_10205344 3300025944 Bacteria 1734
227 Ga0207661_10470687 3300025944 Bacteria 1146
228 Ga0207661_11003601 3300025944 Unclassified 769
229 Ga0207661_11247301 3300025944 Bacteria 684
230 Ga0207661_11295067 3300025944 Unclassified 670
231 Ga0207679_11409165 3300025945 Bacteria 639
232 Ga0207667_10400722 3300025949 Bacteria 1397
233 Ga0207667_11518163 3300025949 Unclassified 640
234 Ga0207651_10003118 3300025960 Bacteria 8064
235 Ga0207651_10560044 3300025960 Bacteria 995
236 Ga0207651_10768370 3300025960 Unclassified 853
237 Ga0207651_12008241 3300025960 Unclassified 520
238 Ga0207651_12153371 3300025960 Unclassified 501
239 Ga0207668_10146289 3300025972 Bacteria 1824
240 Ga0207668_10192913 3300025972 Bacteria 1616
241 Ga0207668_10221462 3300025972 Bacteria 1520
242 Ga0207640_11298572 3300025981 Bacteria 650
243 Ga0207658_10108431 3300025986 Unclassified 2190
244 Ga0207677_10948845 3300026023 Unclassified 778
245 Ga0207677_11234588 3300026023 Bacteria 685
246 Ga0207677_11857120 3300026023 Unclassified 559
247 Ga0207703_10263360 3300026035 Unclassified 1559
248 Ga0207703_11696120 3300026035 Unclassified 608
249 Ga0207703_11962654 3300026035 Unclassified 561
250 Ga0207639_10831741 3300026041 Bacteria 861
251 Ga0207678_10299298 3300026067 Unclassified 1382
252 Ga0207678_10698837 3300026067 Bacteria 892
253 Ga0207678_11250148 3300026067 Unclassified 657
254 Ga0207702_10725290 3300026078 Bacteria 980
255 Ga0207702_12160924 3300026078 Bacteria 546
256 Ga0207641_10582509 3300026088 Bacteria 1094
257 Ga0207648_10249811 3300026089 Bacteria 1581
258 Ga0207648_11132365 3300026089 Bacteria 734
259 Ga0207648_11399014 3300026089 Bacteria 657
260 Ga0207674_10004220 3300026116 Bacteria 17343
261 Ga0207674_10056029 3300026116 Bacteria 4004
262 Ga0207674_11412285 3300026116 Bacteria 665
263 Ga0207675_101099150 3300026118 Bacteria 815
264 Ga0207675_102096429 3300026118 Bacteria 582
265 Ga0207683_10193244 3300026121 Bacteria 1848
266 Ga0207683_10583066 3300026121 Bacteria 1034
267 Ga0207698_10073614 3300026142 Bacteria 2721
268 Ga0207698_11308926 3300026142 Unclassified 739
269 Ga0207428_10602236 3300027907 Bacteria 792
270 Ga0268266_11334969 3300028379 Unclassified 693
271 Ga0268266_11487938 3300028379 Bacteria 653
272 Ga0268265_10058653 3300028380 Unclassified 2940
273 Ga0268265_12260535 3300028380 Unclassified 551
274 Ga0268265_12499398 3300028380 Bacteria 523
275 Ga0268264_10187555 3300028381 Unclassified 1883
276 Ga0268264_11446187 3300028381 Unclassified 698
277 Ga0268264_12131373 3300028381 Unclassified 569
278 Ga0307408_100118939 3300031548 Bacteria 2044
279 Ga0307413_10747377 3300031824 Unclassified 817
280 Ga0307413_11505255 3300031824 Bacteria 595
281 Ga0307410_10205050 3300031852 Bacteria 1508
282 Ga0307410_10221551 3300031852 Bacteria 1456
283 Ga0307410_10430550 3300031852 Bacteria 1072
284 Ga0307410_11150240 3300031852 Bacteria 674
285 Ga0307410_11579229 3300031852 Unclassified 579
286 Ga0307406_10257290 3300031901 Bacteria 1319
287 Ga0307406_10464287 3300031901 Bacteria 1019
288 Ga0307406_11603017 3300031901 Bacteria 575
289 Ga0307407_10594686 3300031903 Bacteria 823
290 Ga0307407_10666664 3300031903 Bacteria 781
291 Ga0307412_11008022 3300031911 Bacteria 736
292 Ga0307412_11600445 3300031911 Unclassified 595
293 Ga0307409_100591660 3300031995 Bacteria 1095
294 Ga0307409_102506033 3300031995 Unclassified 544
295 Ga0307409_102839644 3300031995 Bacteria 512
296 Ga0307416_100720439 3300032002 Bacteria 1088
297 Ga0307416_101832282 3300032002 Unclassified 710
298 Ga0307414_10507942 3300032004 Unclassified 1068
299 Ga0307414_10935945 3300032004 Bacteria 796
300 Ga0307414_11326710 3300032004 Bacteria 668
301 Ga0307411_10954757 3300032005 Bacteria 765
302 Ga0307411_11623801 3300032005 Unclassified 597
303 Ga0307411_12015715 3300032005 Bacteria 539
304 Ga0307415_101879396 3300032126 Unclassified 581
305 Ga0307415_102318837 3300032126 Bacteria 527
306 Ga0316593_10104473 3300032168 Bacteria 1008
307 Ga0316588_1132181 3300033528 Bacteria 635
308 Ga0373955_0439802 3300035172 Bacteria 794
309 Ga0373933_0599254 3300035724 Unclassified 723
310 Ga0373947_0573846 3300035725 Bacteria 768
311 Ga0373937_0647169 3300036401 Bacteria 1002
312 Ga0395899_0118547 3300037312 Bacteria 1898
313 Ga0395900_0273353 3300037418 Bacteria 1684
314 Ga0395900_0959658 3300037418 Bacteria 776
315 Ga0395905_0395621 3300037471 Bacteria 1276
316 Ga0395905_0468574 3300037471 Unclassified 1158
317 Ga0395901_0486264 3300038443 Bacteria 1258
318 Ga0436365_0894641 3300039437 Bacteria 612
319 Ga0451845_0125303 3300041501 Unclassified 612
320 Ga0439464_0309486 3300042439 Bacteria 517
321 Ga0466970_0360896 3300044765 Bacteria 825
322 Ga0451576_0017215 3300045051 Bacteria 7950
323 Ga0495582_0517789 3300046473 Bacteria 690
324 Ga0495662_0139169 3300046476 Bacteria 1195
325 Ga0495664_0081584 3300046477 Bacteria 1939
326 Ga0495628_0599490 3300046516 Bacteria 787
327 Ga0495665_0244581 3300046531 Bacteria 924
328 Ga0495667_0558743 3300046559 Unclassified 715
329 Ga0495634_0335814 3300046642 Bacteria 907
330 Ga0495599_0178145 3300046678 Bacteria 1311
331 Ga0495613_0310413 3300046689 Unclassified 1090
332 Ga0495624_0004418 3300046690 Bacteria 10287
333 Ga0495600_0962543 3300046809 Unclassified 501
334 Ga0495581_0086951 3300047315 Bacteria 1812
335 Ga0495674_1372628 3300047319 Unclassified 528
336 Ga0495676_0252535 3300047321 Bacteria 1202
337 Ga0495684_0001118 3300047471 Bacteria 21619
338 Ga0495684_0124372 3300047471 Bacteria 1941
339 Ga0495593_0569021 3300047673 Bacteria 569
340 Ga0495614_0100678 3300048089 Bacteria 1263
341 Ga0496112_1735333 3300048915 Bacteria 537
342 Ga0496115_0477595 3300048918 Bacteria 1004
343 Ga0501307_023329 3300049162 Bacteria 819
344 Ga0501291_101832 3300049514 Bacteria 600
345 Ga0501311_032706 3300049527 Bacteria 760
346 Ga0501312_062894 3300049528 Unclassified 646
347 Ga0501032_0467865 3300049569 Bacteria 807
348 Ga0501034_0006303 3300049571 Bacteria 12769
349 Ga0501037_0002193 3300049573 Bacteria 14112
350 Ga0501047_0157777 3300049581 Bacteria 2142
351 Ga0501047_0163216 3300049581 Bacteria 2099
352 Ga0501070_0058287 3300049586 Bacteria 3201
353 Ga0501071_0626394 3300049587 Bacteria 827
354 Ga0501080_0026397 3300049742 Bacteria 5397
355 Ga0501083_0142505 3300049744 Bacteria 1569
356 Ga0501283_046935 3300049779 Bacteria 758
357 Ga0501044_0002343 3300049823 Bacteria 21608
358 Ga0501044_0004670 3300049823 Bacteria 15326
359 Ga0501044_1471858 3300049823 Unclassified 546
360 nmdc:mga09592_900997_c1 3300050508 Bacteria 743
361 nmdc:mga06r32_298974_c1 3300050510 Bacteria 1596
362 nmdc:mga06r32_91093_c1 3300050510 Bacteria 2979
363 nmdc:mga08y16_1151583_c1 3300050511 Unclassified 748
364 nmdc:mga0n895_1397799_c1 3300050512 Bacteria 668
365 Ga0495601_0630763 3300053077 Bacteria 686
366 Ga0587070_072216 3300059491 Unclassified 739
367 Ga0587073_0091334 3300059492 Bacteria 775
368 Ga0587077_185640 3300059493 Unclassified 566
369 Ga0587080_080772 3300059503 Bacteria 667
370 Ga0587082_078240 3300059504 Bacteria 684
371 Ga0587083_0062927 3300059505 Unclassified 841
372 Ga0587088_015719 3300059508 Bacteria 1196
373 Ga0587090_099089 3300059510 Unclassified 608
374 Ga0587095_025284 3300059514 Bacteria 591
375 Ga0587106_120393 3300059605 Bacteria 556
376 Ga0587125_065094 3300059607 Bacteria 540
377 Ga0587101_012925 3300059623 Bacteria 1092
378 Ga0587109_085900 3300059624 Bacteria 703
379 Ga0587117_044625 3300059627 Bacteria 717
380 Ga0587117_061829 3300059627 Unclassified 645
381 Ga0587072_192186 3300059643 Bacteria 515
382 Ga0587107_087248 3300059652 Bacteria 597
383 Ga0587114_001608 3300059655 Bacteria 1939
384 Ga0501034_0088667
385 Ga0070658_10811941
386 Ga0070676_10306986
387 Ga0070683_101491859
388 Ga0070690_100833711
389 Ga0070670_100623951
390 Ga0070670_102115732
391 Ga0070677_10014617
392 Ga0070677_10361046
393 Ga0070666_10657069
394 Ga0070666_11135686
395 Ga0070666_11392985
396 Ga0068868_100949361
397 Ga0070660_100877763
398 Ga0070691_10089853
399 Ga0070687_100681154
400 Ga0070661_100553298
401 Ga0070668_100331830
402 Ga0070668_100580296
403 Ga0070669_100789268
404 Ga0070675_100014474
405 Ga0070675_100045940
406 Ga0070675_100482871
407 Ga0070675_100754069
408 Ga0070675_101868563
409 Ga0070671_100951022
410 Ga0070674_100045906
411 Ga0070674_100755647
412 Ga0070673_100066769
413 Ga0070673_100874322
414 Ga0070673_101432098
415 Ga0070688_100203025
416 Ga0070688_100852264
417 Ga0070667_100153564
418 Ga0070667_101157317
419 Ga0070667_101525202
420 Ga0070714_102477432
421 Ga0070701_11314807
422 Ga0070705_100804015
423 Ga0070700_101076297
424 Ga0070663_100724357
425 Ga0070663_101898914
426 Ga0070678_100486564
427 Ga0070678_101903433
428 Ga0070662_101569362
429 Ga0070681_11362509
430 Ga0068867_101253818
431 Ga0070706_100290328
432 Ga0070679_102126085
433 Ga0070684_100730268
434 Ga0070684_102087175
435 Ga0068853_100439304
436 Ga0068853_101642634
437 Ga0070672_100003420
438 Ga0070672_101016308
439 Ga0070672_101729094
440 Ga0070665_101135083
441 Ga0070665_101377072
442 Ga0068855_100107890
443 Ga0068855_100136892
444 Ga0068855_101730616
445 Ga0068855_102332379
446 Ga0068857_100044719
447 Ga0068857_100205784
448 Ga0068856_100628397
449 Ga0068852_100573939
450 Ga0068852_101155682
451 Ga0068859_101159359
452 Ga0068864_101510244
453 Ga0068863_100847619
454 Ga0068863_101168924
455 Ga0068863_101226829
456 Ga0068858_100145575
457 Ga0068860_100186521
458 Ga0068860_101015073
459 Ga0068860_102691909
460 Ga0068862_100076231
461 Ga0068862_100636618
462 Ga0068862_100825406
463 Ga0070717_10056982
464 Ga0097621_102259932
465 Ga0075430_100021518
466 Ga0075431_101295143
467 Ga0075434_101193494
468 Ga0075429_100169194
469 Ga0097620_101159444
470 Ga0105240_10010542
471 Ga0105240_11553231
472 Ga0105240_12329124
473 Ga0111539_10708783
474 Ga0111539_10877943
475 Ga0111539_12387630
476 Ga0111539_13391950
477 Ga0105245_10034862
478 Ga0114129_12234992
479 Ga0105241_10293896
480 Ga0105241_11462368
481 Ga0105241_11688424
482 Ga0105241_11736155
483 Ga0105248_10341732
484 Ga0105248_10953046
485 Ga0105248_11141292
486 Ga0105248_11233232
487 Ga0105248_12123885
488 Ga0105248_12860281
489 Ga0105248_12887268
490 Ga0105237_12111972
491 Ga0105238_11234540
492 Ga0105238_11946548
493 Ga0105238_13051297
494 Ga0105239_10021847
495 Ga0105239_11483590
496 Ga0105246_11252625
497 Ga0105246_11307445
498 Ga0105246_12494654
499 Ga0157373_10488212
500 Ga0157373_10662057
501 Ga0157373_11473932
502 Ga0157371_10150732
503 Ga0157371_10400185
504 Ga0157371_11547702
505 Ga0157370_10164701
506 Ga0157370_11012795
507 Ga0157370_11017781
508 Ga0157370_11591049
509 Ga0157370_11655694
510 Ga0157369_10065330
511 Ga0157369_10323946
512 Ga0157369_11162447
513 Ga0157369_12078217
514 Ga0157374_10266340
515 Ga0157374_10648989
516 Ga0157374_11090429
517 Ga0157374_11380003
518 Ga0157374_12307926
519 Ga0157378_10385447
520 Ga0157378_11208048
521 Ga0157378_12021024
522 Ga0163162_10366212
523 Ga0163162_11397614
524 Ga0163162_11684685
525 Ga0163162_12344043
526 Ga0163162_12592219
527 Ga0163162_12754731
528 Ga0163162_12814301
529 Ga0163162_12824312
530 Ga0157372_10024618
531 Ga0157372_10958132
532 Ga0157372_10988740
533 Ga0157372_11050792
534 Ga0157372_11257712
535 Ga0157372_11573055
536 Ga0157372_12934707
537 Ga0157375_10202402
538 Ga0157375_10963340
539 Ga0157375_11408586
540 Ga0157375_12550887
541 Ga0157375_13073581
542 Ga0163163_10630254
543 Ga0163163_11604476
544 Ga0163163_12130173
545 Ga0163163_12293888
546 Ga0157380_11405189
547 Ga0157380_11856925
548 Ga0157380_12272294
549 Ga0182008_10724579
550 Ga0157379_11693219
551 Ga0157379_12089907
552 Ga0157376_10550745
553 Ga0163161_10624370
554 Ga0163161_11958117
555 Ga0197907_10616790
556 Ga0206356_11384593
557 Ga0206356_11692285
558 Ga0206349_1209078
559 Ga0206355_1609993
560 Ga0206352_10155047
561 Ga0206350_10167319
562 Ga0206354_11125662
563 Ga0154015_1310134
564 Ga0224712_10002936
565 Ga0207682_10017434
566 Ga0207682_10190252
567 Ga0207688_10743908
568 Ga0207680_10761557
569 Ga0207680_10896601
570 Ga0207645_10155516
571 Ga0207705_10726055
572 Ga0207684_10183717
573 Ga0207654_10025454
574 Ga0207654_10590008
575 Ga0207695_10000534
576 Ga0207695_10969376
577 Ga0207662_10848710
578 Ga0207657_10276088
579 Ga0207657_10552181
580 Ga0207652_11458125
581 Ga0207681_10457458
582 Ga0207650_10305731
583 Ga0207650_10408055
584 Ga0207650_10533170
585 Ga0207659_10031407
586 Ga0207659_10222876
587 Ga0207659_10728891
588 Ga0207659_11186086
589 Ga0207659_11503248
590 Ga0207687_10004724
591 Ga0207664_11539584
592 Ga0207644_10610040
593 Ga0207644_11772979
594 Ga0207644_11831384
595 Ga0207690_10222641
596 Ga0207690_10848754
597 Ga0207706_10420163
598 Ga0207706_10687514
599 Ga0207686_11413027
600 Ga0207669_10463130
601 Ga0207669_10499326
602 Ga0207669_10621222
603 Ga0207691_10007825
604 Ga0207691_10389695
605 Ga0207691_11223088
606 Ga0207691_11234767
607 Ga0207711_10140972
608 Ga0207711_11167199
609 Ga0207661_10205344
610 Ga0207661_10470687
611 Ga0207661_11003601
612 Ga0207661_11247301
613 Ga0207661_11295067
614 Ga0207679_11409165
615 Ga0207667_10400722
616 Ga0207667_11518163
617 Ga0207651_10003118
618 Ga0207651_10560044
619 Ga0207651_10768370
620 Ga0207651_12008241
621 Ga0207651_12153371
622 Ga0207668_10146289
623 Ga0207668_10192913
624 Ga0207668_10221462
625 Ga0207640_11298572
626 Ga0207658_10108431
627 Ga0207677_10948845
628 Ga0207677_11234588
629 Ga0207677_11857120
630 Ga0207703_10263360
631 Ga0207703_11696120
632 Ga0207703_11962654
633 Ga0207639_10831741
634 Ga0207678_10299298
635 Ga0207678_10698837
636 Ga0207678_11250148
637 Ga0207702_10725290
638 Ga0207702_12160924
639 Ga0207641_10582509
640 Ga0207648_10249811
641 Ga0207648_11132365
642 Ga0207648_11399014
643 Ga0207674_10004220
644 Ga0207674_10056029
645 Ga0207674_11412285
646 Ga0207675_101099150
647 Ga0207675_102096429
648 Ga0207683_10193244
649 Ga0207683_10583066
650 Ga0207698_10073614
651 Ga0207698_11308926
652 Ga0207428_10602236
653 Ga0268266_11334969
654 Ga0268266_11487938
655 Ga0268265_10058653
656 Ga0268265_12260535
657 Ga0268265_12499398
658 Ga0268264_10187555
659 Ga0268264_11446187
660 Ga0268264_12131373
661 Ga0307408_100118939
662 Ga0307413_10747377
663 Ga0307413_11505255
664 Ga0307410_10205050
665 Ga0307410_10221551
666 Ga0307410_10430550
667 Ga0307410_11150240
668 Ga0307410_11579229
669 Ga0307406_10257290
670 Ga0307406_10464287
671 Ga0307406_11603017
672 Ga0307407_10594686
673 Ga0307407_10666664
674 Ga0307412_11008022
675 Ga0307412_11600445
676 Ga0307409_100591660
677 Ga0307409_102506033
678 Ga0307409_102839644
679 Ga0307416_100720439
680 Ga0307416_101832282
681 Ga0307414_10507942
682 Ga0307414_10935945
683 Ga0307414_11326710
684 Ga0307411_10954757
685 Ga0307411_11623801
686 Ga0307411_12015715
687 Ga0307415_101879396
688 Ga0307415_102318837
689 Ga0316593_10104473
690 Ga0316588_1132181
691 Ga0373955_0439802
692 Ga0373933_0599254
693 Ga0373947_0573846
694 Ga0373937_0647169
695 Ga0395899_0118547
696 Ga0395900_0273353
697 Ga0395900_0959658
698 Ga0395905_0395621
699 Ga0395905_0468574
700 Ga0395901_0486264
701 Ga0436365_0894641
702 Ga0451845_0125303
703 Ga0439464_0309486
704 Ga0466970_0360896
705 Ga0451576_0017215
706 Ga0495582_0517789
707 Ga0495662_0139169
708 Ga0495664_0081584
709 Ga0495628_0599490
710 Ga0495665_0244581
711 Ga0495667_0558743
712 Ga0495634_0335814
713 Ga0495599_0178145
714 Ga0495613_0310413
715 Ga0495624_0004418
716 Ga0495600_0962543
717 Ga0495581_0086951
718 Ga0495674_1372628
719 Ga0495676_0252535
720 Ga0495684_0001118
721 Ga0495684_0124372
722 Ga0495593_0569021
723 Ga0495614_0100678
724 Ga0496112_1735333
725 Ga0496115_0477595
726 Ga0501307_023329
727 Ga0501291_101832
728 Ga0501311_032706
729 Ga0501312_062894
730 Ga0501032_0467865
731 Ga0501034_0006303
732 Ga0501037_0002193
733 Ga0501047_0157777
734 Ga0501047_0163216
735 Ga0501070_0058287
736 Ga0501071_0626394
737 Ga0501080_0026397
738 Ga0501083_0142505
739 Ga0501283_046935
740 Ga0501044_0002343
741 Ga0501044_0004670
742 Ga0501044_1471858
743 nmdc:mga09592_900997_c1
744 nmdc:mga06r32_298974_c1
745 nmdc:mga06r32_91093_c1
746 nmdc:mga08y16_1151583_c1
747 nmdc:mga0n895_1397799_c1
748 Ga0495601_0630763
749 Ga0587070_072216
750 Ga0587073_0091334
751 Ga0587077_185640
752 Ga0587080_080772
753 Ga0587082_078240
754 Ga0587083_0062927
755 Ga0587088_015719
756 Ga0587090_099089
757 Ga0587095_025284
758 Ga0587106_120393
759 Ga0587125_065094
760 Ga0587101_012925
761 Ga0587109_085900
762 Ga0587117_044625
763 Ga0587117_061829
764 Ga0587072_192186
765 Ga0587107_087248
766 Ga0587114_001608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

25

111

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cvm-assembly1.cif.gz_s cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9007 4 92
6spb-assembly1.cif.gz_T pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.8982 4 90
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.8939 4 84
6enj-assembly1.cif.gz_T polyproline-stalled ribosome in the presence of a+p site trna and elongation-factor p (ef-p) 0.8847 3 89
7f0d-assembly1.cif.gz_T cryo-em structure of mycobacterium tuberculosis 50s ribosome subunit bound with clarithromycin 0.8779 1 92
ID Description Score Start End Superfamily
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8664 4 92 3.30.70.330
4garT00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8512 3 89 3.30.70.330
4ukhK00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8491 4 87 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8488 4 92 3.30.70.330
4qs3X00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8414 5 90 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A1Z8STX0-F1-model_v4 50S ribosomal protein L23 0.9266 4 89 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-Q8D210-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9213 3 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A661IHB9-F1-model_v4 Large ribosomal subunit protein uL23 0.9209 4 92 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-Q493K6-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9204 3 92 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2A4TUL9-F1-model_v4 Large ribosomal subunit protein uL23 0.92 1 92 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map