F429662

General Info

Members Datasets Scaffolds Average Seq Length
383 259 766 169

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1328769|Ga0436365_1328769_5256_5879
Length 207
Sequence MARKRRHDTATGWQEPFSSLAARSPLAFSARAKQFEGINMAYAIYDASVPVMARALGNLIKIIDKAETQAKEKDIPLQSLLDARLIADMNPFPFQIQSASDAAKGAAARLAGITPPSMPDTEKTFGELKARLQKTIDFLNTVKPEQLAGAEDKEIVMKFPNGELKFSGRDFLAGFALPNFFFHVTTAYALLRHKGIAIGKMDFLGGV

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
147 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
148 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
151 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
161 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
164 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
165 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
169 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
191 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
236 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
237 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
238 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
239 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
240 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
241 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
242 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
243 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
244 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
245 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
246 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
247 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
248 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
249 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
250 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
251 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
252 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
253 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
254 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
255 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.05
Nodule 0
Rhizoplane 3.39
Rhizosphere 76.76
Stem 0
Stem Tuber 0
Unclassified 2.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1328769 3300039437 Bacteria 6589
2 JGI24741J21665_1004602 3300001915 Bacteria 3023
3 JGI24747J21853_1008980 3300001978 Bacteria 983
4 JGI24740J21852_10004768 3300001979 Bacteria 5792
5 JGI24739J22299_10044845 3300001989 Bacteria 1454
6 JGI24737J22298_10002413 3300001990 Bacteria 6661
7 JGI24742J22300_10010718 3300002244 Bacteria 1518
8 JGI25153J46596_10000021 3300003215 Bacteria 252651
9 rootH2_10268605 3300003320 Bacteria 2547
10 Ga0055525_1000229 3300003759 Bacteria 60078
11 Ga0055542_1000194 3300003762 Bacteria 74327
12 Ga0055529_1000034 3300003763 Bacteria 244657
13 Ga0055530_10001993 3300003791 Bacteria 13860
14 Ga0055531_10024631 3300003794 Bacteria 2213
15 Ga0065165_1008847 3300005262 Bacteria 4624
16 Ga0070658_10001204 3300005327 Bacteria 22168
17 Ga0070670_100223412 3300005331 Bacteria 1639
18 Ga0068869_100029401 3300005334 Bacteria 3849
19 Ga0070666_10311878 3300005335 Bacteria 1121
20 Ga0070660_100050954 3300005339 Bacteria 3187
21 Ga0070661_100002921 3300005344 Bacteria 11780
22 Ga0070668_100079916 3300005347 Bacteria 2561
23 Ga0070675_100162412 3300005354 Bacteria 1922
24 Ga0070675_101068430 3300005354 Bacteria 742
25 Ga0070674_100008027 3300005356 Bacteria 6257
26 Ga0070674_100050004 3300005356 Bacteria 2876
27 Ga0070673_100145937 3300005364 Bacteria 2000
28 Ga0070659_100170124 3300005366 Bacteria 1784
29 Ga0070659_100176995 3300005366 Bacteria 1749
30 Ga0070667_100080004 3300005367 Bacteria 2795
31 Ga0070667_100120877 3300005367 Bacteria 2278
32 Ga0070663_100021863 3300005455 Bacteria 4263
33 Ga0070663_100239664 3300005455 Bacteria 1431
34 Ga0070678_100000449 3300005456 Bacteria 19525
35 Ga0070662_100176206 3300005457 Bacteria 1683
36 Ga0070662_100889310 3300005457 Bacteria 760
37 Ga0068867_100019517 3300005459 Bacteria 4830
38 Ga0070679_100948482 3300005530 Bacteria 804
39 Ga0070684_100215260 3300005535 Bacteria 1752
40 Ga0068853_100107808 3300005539 Bacteria 2470
41 Ga0068853_100207805 3300005539 Bacteria 1784
42 Ga0070672_100042339 3300005543 Bacteria 3506
43 Ga0070665_100000155 3300005548 Bacteria 125017
44 Ga0070665_100030223 3300005548 Bacteria 5453
45 Ga0070665_100052136 3300005548 Bacteria 4105
46 Ga0070665_100273351 3300005548 Bacteria 1691
47 Ga0068855_100000490 3300005563 Bacteria 48844
48 Ga0068855_100587719 3300005563 Bacteria 1202
49 Ga0070664_100007109 3300005564 Bacteria 9030
50 Ga0068856_100186450 3300005614 Bacteria 2088
51 Ga0068852_100415236 3300005616 Unclassified 1326
52 Ga0068859_101351730 3300005617 Unclassified 785
53 Ga0068866_10183079 3300005718 Bacteria 1239
54 Ga0068870_10075021 3300005840 Bacteria 1854
55 Ga0068863_100279840 3300005841 Bacteria 1616
56 Ga0068858_100000914 3300005842 Bacteria 30605
57 Ga0068858_100863057 3300005842 Bacteria 884
58 Ga0068860_100029097 3300005843 Bacteria 5314
59 Ga0075369_10081506 3300006186 Bacteria 1435
60 Ga0075366_10045606 3300006195 Bacteria 2597
61 Ga0097621_100529413 3300006237 Bacteria 1071
62 Ga0068871_100050361 3300006358 Bacteria 3369
63 Ga0068871_100268102 3300006358 Bacteria 1491
64 Ga0075429_100050793 3300006880 Bacteria 3608
65 Ga0068865_100211375 3300006881 Bacteria 1512
66 Ga0097620_101351958 3300006931 Unclassified 785
67 Ga0105240_10005399 3300009093 Bacteria 19054
68 Ga0105245_10005034 3300009098 Bacteria 11620
69 Ga0105245_10579031 3300009098 Bacteria 1147
70 Ga0105243_10005959 3300009148 Bacteria 9443
71 Ga0105243_10676774 3300009148 Bacteria 1003
72 Ga0105243_11009609 3300009148 Bacteria 835
73 Ga0105241_10014495 3300009174 Bacteria 5773
74 Ga0105241_10162585 3300009174 Bacteria 1837
75 Ga0105242_10100804 3300009176 Bacteria 2446
76 Ga0105242_10244019 3300009176 Bacteria 1616
77 Ga0105237_10200490 3300009545 Bacteria 1995
78 Ga0105237_10573088 3300009545 Bacteria 1136
79 Ga0105237_11116621 3300009545 Bacteria 795
80 Ga0105238_10125713 3300009551 Bacteria 2543
81 Ga0105239_10000266 3300010375 Bacteria 77602
82 Ga0157324_1001126 3300012506 Bacteria 1415
83 Ga0157373_10000483 3300013100 Bacteria 31535
84 Ga0157373_10388239 3300013100 Bacteria 999
85 Ga0157371_10000309 3300013102 Bacteria 63514
86 Ga0157369_11080012 3300013105 Bacteria 821
87 Ga0157378_10012410 3300013297 Bacteria 7460
88 Ga0163162_10735543 3300013306 Bacteria 1106
89 Ga0157372_10258672 3300013307 Bacteria 2021
90 Ga0157379_10030892 3300014968 Bacteria 4771
91 Ga0163161_10039741 3300017792 Bacteria 3379
92 Ga0213873_10048608 3300021358 Bacteria 1116
93 Ga0213876_10004697 3300021384 Bacteria 7603
94 Ga0209674_106625 3300025226 Bacteria 1557
95 Ga0209563_100047 3300025230 Bacteria 366620
96 Ga0209437_111024 3300025233 Bacteria 1363
97 Ga0209646_1007160 3300025246 Bacteria 1835
98 Ga0209026_1009780 3300025250 Bacteria 1850
99 Ga0209677_105457 3300025253 Bacteria 3313
100 Ga0209148_1000093 3300025254 Bacteria 245339
101 Ga0209233_1000058 3300025261 Bacteria 421872
102 Ga0209455_1000045 3300025272 Bacteria 383329
103 Ga0209455_1013966 3300025272 Bacteria 1839
104 Ga0209758_1000023 3300025297 Bacteria 612453
105 Ga0209050_1000098 3300025298 Bacteria 236717
106 Ga0209257_1000235 3300025304 Bacteria 129620
107 Ga0207656_10012913 3300025321 Bacteria 3181
108 Ga0207688_10095318 3300025901 Bacteria 1713
109 Ga0207680_10001319 3300025903 Bacteria 11700
110 Ga0207680_10511341 3300025903 Bacteria 856
111 Ga0207647_10021223 3300025904 Bacteria 4338
112 Ga0207645_10064126 3300025907 Bacteria 2348
113 Ga0207643_10179807 3300025908 Bacteria 1279
114 Ga0207705_10000799 3300025909 Bacteria 25876
115 Ga0207654_10000697 3300025911 Bacteria 18738
116 Ga0207654_10108505 3300025911 Bacteria 1723
117 Ga0207695_10000516 3300025913 Bacteria 81914
118 Ga0207695_10016997 3300025913 Bacteria 8487
119 Ga0207695_10055180 3300025913 Bacteria 4143
120 Ga0207695_10055754 3300025913 Bacteria 4116
121 Ga0207695_10112833 3300025913 Bacteria 2695
122 Ga0207671_10076441 3300025914 Bacteria 2506
123 Ga0207671_11092904 3300025914 Bacteria 627
124 Ga0207657_10010329 3300025919 Bacteria 9321
125 Ga0207657_10081256 3300025919 Bacteria 2723
126 Ga0207649_10000039 3300025920 Bacteria 118724
127 Ga0207649_10000711 3300025920 Bacteria 21876
128 Ga0207649_10069318 3300025920 Bacteria 2245
129 Ga0207694_10017724 3300025924 Bacteria 5381
130 Ga0207694_10252142 3300025924 Bacteria 1444
131 Ga0207650_10121012 3300025925 Bacteria 2038
132 Ga0207659_10106871 3300025926 Bacteria 2120
133 Ga0207687_10001255 3300025927 Bacteria 17339
134 Ga0207644_10397691 3300025931 Bacteria 1126
135 Ga0207690_10214879 3300025932 Unclassified 1468
136 Ga0207690_10266067 3300025932 Bacteria 1330
137 Ga0207706_10143354 3300025933 Bacteria 2102
138 Ga0207706_10160579 3300025933 Bacteria 1976
139 Ga0207686_10118249 3300025934 Bacteria 1800
140 Ga0207709_10000018 3300025935 Bacteria 431545
141 Ga0207709_10443998 3300025935 Bacteria 1001
142 Ga0207669_10000899 3300025937 Bacteria 12575
143 Ga0207669_10013159 3300025937 Bacteria 4098
144 Ga0207704_10058760 3300025938 Bacteria 2370
145 Ga0207691_10070273 3300025940 Bacteria 3161
146 Ga0207691_10273058 3300025940 Unclassified 1455
147 Ga0207689_10088751 3300025942 Bacteria 2539
148 Ga0207679_10121291 3300025945 Bacteria 2082
149 Ga0207667_10000893 3300025949 Bacteria 37994
150 Ga0207667_10005050 3300025949 Bacteria 16116
151 Ga0207667_10038536 3300025949 Bacteria 5103
152 Ga0207667_10119195 3300025949 Bacteria 2720
153 Ga0207651_10090091 3300025960 Bacteria 2241
154 Ga0207640_10002507 3300025981 Bacteria 9841
155 Ga0207703_10001240 3300026035 Bacteria 23887
156 Ga0207703_10824097 3300026035 Bacteria 887
157 Ga0207639_10003091 3300026041 Bacteria 11191
158 Ga0207639_10179912 3300026041 Bacteria 1798
159 Ga0207678_10030380 3300026067 Bacteria 4718
160 Ga0207702_10005550 3300026078 Bacteria 11021
161 Ga0207702_10034818 3300026078 Bacteria 4212
162 Ga0207702_10320857 3300026078 Bacteria 1475
163 Ga0207648_10050347 3300026089 Bacteria 3642
164 Ga0207674_10012572 3300026116 Bacteria 9458
165 Ga0207683_10004230 3300026121 Bacteria 12395
166 Ga0268266_10000002 3300028379 Bacteria 3059047
167 Ga0268266_10038816 3300028379 Bacteria 4054
168 Ga0268266_10312654 3300028379 Bacteria 1468
169 Ga0268266_10391062 3300028379 Bacteria 1313
170 Ga0268264_10065049 3300028381 Bacteria 3071
171 Ga0265326_10030275 3300028558 Bacteria 1541
172 Ga0265318_10005797 3300028577 Bacteria 5759
173 Ga0307517_10041851 3300028786 Bacteria 4932
174 Ga0265338_10013879 3300028800 Bacteria 9047
175 Ga0265338_10037735 3300028800 Bacteria 4591
176 Ga0265338_10051159 3300028800 Bacteria 3723
177 Ga0265338_10098178 3300028800 Bacteria 2397
178 Ga0265338_10488088 3300028800 Bacteria 868
179 Ga0265320_10000191 3300031240 Bacteria 50802
180 Ga0265325_10001223 3300031241 Bacteria 18297
181 Ga0265325_10006084 3300031241 Bacteria 7382
182 Ga0265329_10219356 3300031242 Bacteria 629
183 Ga0265340_10001183 3300031247 Bacteria 14900
184 Ga0265339_10011493 3300031249 Bacteria 5447
185 Ga0265339_10037431 3300031249 Bacteria 2711
186 Ga0265339_10169718 3300031249 Bacteria 1093
187 Ga0265331_10000080 3300031250 Bacteria 137743
188 Ga0265331_10000660 3300031250 Bacteria 29797
189 Ga0265331_10011375 3300031250 Bacteria 4877
190 Ga0265331_10203391 3300031250 Bacteria 892
191 Ga0265327_10000002 3300031251 Bacteria 856593
192 Ga0265327_10000095 3300031251 Bacteria 194803
193 Ga0265316_10024386 3300031344 Bacteria 5070
194 Ga0265316_10031192 3300031344 Bacteria 4361
195 Ga0265316_10431532 3300031344 Bacteria 946
196 Ga0307513_10013930 3300031456 Bacteria 9854
197 Ga0265313_10025474 3300031595 Bacteria 3133
198 Ga0265313_10037002 3300031595 Bacteria 2446
199 Ga0265313_10053558 3300031595 Bacteria 1920
200 Ga0265313_10074408 3300031595 Bacteria 1557
201 Ga0265313_10142075 3300031595 Bacteria 1032
202 Ga0265314_10012819 3300031711 Bacteria 6811
203 Ga0265314_10016222 3300031711 Bacteria 5895
204 Ga0265342_10035632 3300031712 Bacteria 3045
205 Ga0265342_10298134 3300031712 Bacteria 850
206 Ga0307413_10264177 3300031824 Unclassified 1285
207 Ga0307414_10812092 3300032004 Bacteria 853
208 Ga0307411_10786306 3300032005 Unclassified 837
209 Ga0307510_10104739 3300033180 Bacteria 2600
210 Ga0373927_0284907 3300035695 Bacteria 1087
211 Ga0373937_0633986 3300036401 Bacteria 1014
212 Ga0436365_0286398 3300039437 Bacteria 8166
213 Ga0436362_0300430 3300039453 Bacteria 2059
214 Ga0451787_435675 3300041441 Bacteria 1224
215 Ga0451802_1070427 3300041460 Bacteria 736
216 Ga0451804_0468559 3300041463 Bacteria 598
217 Ga0451853_3474583 3300041512 Bacteria 1096
218 Ga0439459_0162928 3300042438 Bacteria 590
219 Ga0495617_030458 3300046452 Bacteria 1814
220 Ga0495617_071593 3300046452 Bacteria 1140
221 Ga0495638_0000018 3300046460 Bacteria 389696
222 Ga0495650_0001510 3300046471 Bacteria 22137
223 Ga0495584_0017383 3300046491 Bacteria 3662
224 Ga0495585_0002437 3300046492 Bacteria 13333
225 Ga0495585_0122348 3300046492 Bacteria 1375
226 Ga0495596_0022020 3300046500 Bacteria 2597
227 Ga0495583_0003129 3300046506 Bacteria 13066
228 Ga0495583_0003712 3300046506 Bacteria 11355
229 Ga0495583_0008809 3300046506 Bacteria 6115
230 Ga0495606_0050511 3300046507 Bacteria 2720
231 Ga0495606_0189844 3300046507 Bacteria 1178
232 Ga0495610_0174598 3300046512 Bacteria 898
233 Ga0495616_0000022 3300046513 Bacteria 149720
234 Ga0495616_0049182 3300046513 Bacteria 2115
235 Ga0495620_0152605 3300046515 Bacteria 900
236 Ga0495628_0062806 3300046516 Bacteria 2911
237 Ga0495631_0053540 3300046518 Bacteria 1761
238 Ga0495631_0055432 3300046518 Bacteria 1727
239 Ga0495632_0003057 3300046519 Bacteria 12168
240 Ga0495637_0036451 3300046520 Bacteria 2142
241 Ga0495643_0001892 3300046522 Bacteria 17687
242 Ga0495643_0006477 3300046522 Bacteria 7705
243 Ga0495643_0010973 3300046522 Bacteria 5544
244 Ga0495648_0000018 3300046524 Bacteria 282490
245 Ga0495648_0000024 3300046524 Bacteria 235605
246 Ga0495648_0023969 3300046524 Bacteria 4167
247 Ga0495663_0001458 3300046525 Bacteria 7451
248 Ga0495642_0007841 3300046528 Bacteria 4092
249 Ga0495652_0520842 3300046529 Bacteria 822
250 Ga0495652_0826437 3300046529 Bacteria 615
251 Ga0495587_0119156 3300046536 Bacteria 1512
252 Ga0495609_0204981 3300046538 Bacteria 823
253 Ga0495597_0010912 3300046542 Bacteria 4421
254 Ga0495622_0015230 3300046557 Bacteria 3574
255 Ga0495633_0002753 3300046558 Bacteria 12159
256 Ga0495633_0012555 3300046558 Bacteria 4498
257 Ga0495668_0000090 3300046616 Bacteria 144763
258 Ga0495668_0011325 3300046616 Bacteria 5349
259 Ga0495668_0104647 3300046616 Bacteria 1548
260 Ga0495611_0003702 3300046648 Bacteria 6688
261 Ga0495611_0066382 3300046648 Bacteria 1645
262 Ga0495611_0187759 3300046648 Bacteria 965
263 Ga0495611_0246305 3300046648 Bacteria 829
264 Ga0495625_0000259 3300046660 Bacteria 82465
265 Ga0495625_0005010 3300046660 Bacteria 12285
266 Ga0495625_0057156 3300046660 Bacteria 2775
267 Ga0495625_0103158 3300046660 Bacteria 1956
268 Ga0495625_0186764 3300046660 Bacteria 1375
269 Ga0495635_0255037 3300046663 Bacteria 1182
270 Ga0495661_0431950 3300046665 Bacteria 636
271 Ga0495669_0000397 3300046684 Bacteria 21458
272 Ga0495670_0099693 3300046691 Bacteria 1495
273 Ga0495670_0573366 3300046691 Bacteria 614
274 Ga0495671_0000011 3300046692 Bacteria 365582
275 Ga0495671_0028116 3300046692 Bacteria 2899
276 Ga0495649_0096217 3300046694 Bacteria 1576
277 Ga0495649_0362460 3300046694 Bacteria 731
278 Ga0495600_0009148 3300046809 Bacteria 6110
279 Ga0495600_0306640 3300046809 Bacteria 1001
280 Ga0495660_0018377 3300046810 Unclassified 4020
281 Ga0495683_0007990 3300047323 Bacteria 5680
282 Ga0495683_0009796 3300047323 Bacteria 5095
283 Ga0495687_001438 3300047443 Bacteria 21865
284 Ga0495687_003073 3300047443 Bacteria 12509
285 Ga0495677_0002480 3300047445 Bacteria 7244
286 Ga0495677_0092658 3300047445 Bacteria 1139
287 Ga0495673_0000013 3300047469 Bacteria 612902
288 Ga0495673_0057470 3300047469 Bacteria 1680
289 Ga0495681_0014955 3300047470 Bacteria 4419
290 Ga0495681_0120695 3300047470 Bacteria 1125
291 Ga0495686_0000082 3300047472 Bacteria 200115
292 Ga0495686_0157086 3300047472 Unclassified 1331
293 Ga0496102_0000875 3300048905 Bacteria 28751
294 Ga0496103_0003661 3300048906 Bacteria 9357
295 Ga0496104_0146920 3300048907 Bacteria 2264
296 Ga0496105_0005963 3300048908 Bacteria 9302
297 Ga0496107_0580458 3300048910 Bacteria 829
298 Ga0496110_0104260 3300048913 Bacteria 2544
299 Ga0496112_0386011 3300048915 Bacteria 1341
300 Ga0496113_0350420 3300048916 Bacteria 1184
301 Ga0496114_0158411 3300048917 Bacteria 1967
302 Ga0496115_0000572 3300048918 Bacteria 28485
303 Ga0496116_0016933 3300048919 Bacteria 5682
304 Ga0496117_0000357 3300048920 Bacteria 80266
305 Ga0496118_0000130 3300048921 Bacteria 133250
306 Ga0496118_0067588 3300048921 Bacteria 2601
307 Ga0496119_0028551 3300048922 Bacteria 3804
308 Ga0496120_0028151 3300048923 Bacteria 3447
309 Ga0496120_0217787 3300048923 Bacteria 914
310 Ga0496121_0002226 3300048924 Bacteria 30274
311 Ga0496121_0002397 3300048924 Bacteria 28732
312 Ga0496122_0003348 3300048925 Bacteria 21146
313 Ga0496123_0006416 3300048926 Bacteria 11403
314 Ga0496124_0000163 3300048927 Bacteria 135337
315 Ga0496125_0002602 3300048928 Bacteria 23166
316 Ga0496126_0002172 3300048929 Bacteria 27237
317 Ga0496126_0013837 3300048929 Bacteria 8185
318 Ga0496126_0032766 3300048929 Bacteria 4892
319 Ga0495682_0160112 3300049460 Bacteria 802
320 Ga0501033_0015022 3300049570 Bacteria 5877
321 Ga0501034_0019585 3300049571 Bacteria 6919
322 Ga0501034_0246557 3300049571 Bacteria 1731
323 Ga0501034_0349854 3300049571 Bacteria 1406
324 Ga0501034_0446919 3300049571 Bacteria 1211
325 Ga0501034_1285999 3300049571 Bacteria 608
326 Ga0501039_0970807 3300049575 Bacteria 661
327 Ga0501043_0119797 3300049579 Bacteria 2064
328 Ga0501043_0264380 3300049579 Bacteria 1322
329 Ga0501043_0786530 3300049579 Bacteria 689
330 Ga0501046_0002393 3300049580 Bacteria 17631
331 Ga0501046_0579421 3300049580 Bacteria 798
332 Ga0501047_0000479 3300049581 Bacteria 43519
333 Ga0501047_0030360 3300049581 Bacteria 5211
334 Ga0501048_0543333 3300049582 Bacteria 834
335 Ga0501069_0327431 3300049585 Bacteria 901
336 Ga0501070_0045321 3300049586 Bacteria 3657
337 Ga0501070_0175439 3300049586 Bacteria 1765
338 Ga0501072_0293808 3300049588 Unclassified 1292
339 Ga0501073_0016185 3300049589 Bacteria 5404
340 Ga0501074_0237178 3300049590 Bacteria 1298
341 Ga0501080_0136025 3300049742 Bacteria 2274
342 Ga0501083_0134715 3300049744 Bacteria 1619
343 Ga0501083_0165235 3300049744 Bacteria 1447
344 Ga0501035_0365511 3300049822 Bacteria 1205
345 Ga0501044_0081142 3300049823 Bacteria 3284
346 Ga0501044_0130323 3300049823 Bacteria 2509
347 Ga0501044_0295944 3300049823 Bacteria 1549
348 Ga0501044_0378208 3300049823 Bacteria 1331
349 Ga0501044_0461779 3300049823 Bacteria 1175
350 nmdc:mga0k408_378989_c1 3300050493 Bacteria 843
351 nmdc:mga09592_48595_c1 3300050508 Bacteria 3576
352 Ga0500610_0000039 3300053079 Bacteria 42883
353 Ga0500643_021305 3300053087 Bacteria 2102
354 Ga0500643_132818 3300053087 Bacteria 669
355 Ga0500644_0032437 3300053088 Bacteria 1669
356 Ga0500646_0001747 3300053090 Bacteria 5710
357 Ga0500647_0057033 3300053091 Bacteria 1878
358 Ga0500583_0000544 3300053092 Bacteria 11474
359 Ga0500650_0098175 3300053098 Bacteria 1371
360 Ga0500555_004857 3300053103 Bacteria 3814
361 Ga0500594_0002690 3300053118 Bacteria 3867
362 Ga0500595_002900 3300053119 Bacteria 8216
363 Ga0500607_260083 3300053121 Bacteria 681
364 Ga0500642_0000635 3300053130 Bacteria 10479
365 Ga0500655_001296 3300053133 Bacteria 4743
366 Ga0500655_051202 3300053133 Bacteria 823
367 Ga0500559_0125483 3300053136 Bacteria 1196
368 Ga0500559_0137734 3300053136 Bacteria 1142
369 Ga0500568_0018492 3300053139 Bacteria 3047
370 Ga0500577_0112078 3300053142 Bacteria 1127
371 Ga0500588_0009649 3300053146 Bacteria 2303
372 Ga0500604_0000153 3300053151 Bacteria 20294
373 Ga0500604_0011800 3300053151 Bacteria 2353
374 Ga0500622_0057520 3300053156 Bacteria 1989
375 Ga0500622_0070853 3300053156 Bacteria 1762
376 Ga0500627_0071762 3300053158 Bacteria 1534
377 Ga0500636_0001895 3300053177 Bacteria 11462
378 Ga0500645_000005 3300053730 Bacteria 284466
379 Ga0500596_013651 3300053735 Bacteria 1225
380 Ga0501084_1615522 3300054114 Bacteria 542
381 Ga0500661_013224 3300055283 Bacteria 1488
382 Ga0501082_0154539 3300060353 Bacteria 1994
383 8056878549 8056875544 Bacteria 4355797
384 Ga0436365_1328769
385 JGI24741J21665_1004602
386 JGI24747J21853_1008980
387 JGI24740J21852_10004768
388 JGI24739J22299_10044845
389 JGI24737J22298_10002413
390 JGI24742J22300_10010718
391 JGI25153J46596_10000021
392 rootH2_10268605
393 Ga0055525_1000229
394 Ga0055542_1000194
395 Ga0055529_1000034
396 Ga0055530_10001993
397 Ga0055531_10024631
398 Ga0065165_1008847
399 Ga0070658_10001204
400 Ga0070670_100223412
401 Ga0068869_100029401
402 Ga0070666_10311878
403 Ga0070660_100050954
404 Ga0070661_100002921
405 Ga0070668_100079916
406 Ga0070675_100162412
407 Ga0070675_101068430
408 Ga0070674_100008027
409 Ga0070674_100050004
410 Ga0070673_100145937
411 Ga0070659_100170124
412 Ga0070659_100176995
413 Ga0070667_100080004
414 Ga0070667_100120877
415 Ga0070663_100021863
416 Ga0070663_100239664
417 Ga0070678_100000449
418 Ga0070662_100176206
419 Ga0070662_100889310
420 Ga0068867_100019517
421 Ga0070679_100948482
422 Ga0070684_100215260
423 Ga0068853_100107808
424 Ga0068853_100207805
425 Ga0070672_100042339
426 Ga0070665_100000155
427 Ga0070665_100030223
428 Ga0070665_100052136
429 Ga0070665_100273351
430 Ga0068855_100000490
431 Ga0068855_100587719
432 Ga0070664_100007109
433 Ga0068856_100186450
434 Ga0068852_100415236
435 Ga0068859_101351730
436 Ga0068866_10183079
437 Ga0068870_10075021
438 Ga0068863_100279840
439 Ga0068858_100000914
440 Ga0068858_100863057
441 Ga0068860_100029097
442 Ga0075369_10081506
443 Ga0075366_10045606
444 Ga0097621_100529413
445 Ga0068871_100050361
446 Ga0068871_100268102
447 Ga0075429_100050793
448 Ga0068865_100211375
449 Ga0097620_101351958
450 Ga0105240_10005399
451 Ga0105245_10005034
452 Ga0105245_10579031
453 Ga0105243_10005959
454 Ga0105243_10676774
455 Ga0105243_11009609
456 Ga0105241_10014495
457 Ga0105241_10162585
458 Ga0105242_10100804
459 Ga0105242_10244019
460 Ga0105237_10200490
461 Ga0105237_10573088
462 Ga0105237_11116621
463 Ga0105238_10125713
464 Ga0105239_10000266
465 Ga0157324_1001126
466 Ga0157373_10000483
467 Ga0157373_10388239
468 Ga0157371_10000309
469 Ga0157369_11080012
470 Ga0157378_10012410
471 Ga0163162_10735543
472 Ga0157372_10258672
473 Ga0157379_10030892
474 Ga0163161_10039741
475 Ga0213873_10048608
476 Ga0213876_10004697
477 Ga0209674_106625
478 Ga0209563_100047
479 Ga0209437_111024
480 Ga0209646_1007160
481 Ga0209026_1009780
482 Ga0209677_105457
483 Ga0209148_1000093
484 Ga0209233_1000058
485 Ga0209455_1000045
486 Ga0209455_1013966
487 Ga0209758_1000023
488 Ga0209050_1000098
489 Ga0209257_1000235
490 Ga0207656_10012913
491 Ga0207688_10095318
492 Ga0207680_10001319
493 Ga0207680_10511341
494 Ga0207647_10021223
495 Ga0207645_10064126
496 Ga0207643_10179807
497 Ga0207705_10000799
498 Ga0207654_10000697
499 Ga0207654_10108505
500 Ga0207695_10000516
501 Ga0207695_10016997
502 Ga0207695_10055180
503 Ga0207695_10055754
504 Ga0207695_10112833
505 Ga0207671_10076441
506 Ga0207671_11092904
507 Ga0207657_10010329
508 Ga0207657_10081256
509 Ga0207649_10000039
510 Ga0207649_10000711
511 Ga0207649_10069318
512 Ga0207694_10017724
513 Ga0207694_10252142
514 Ga0207650_10121012
515 Ga0207659_10106871
516 Ga0207687_10001255
517 Ga0207644_10397691
518 Ga0207690_10214879
519 Ga0207690_10266067
520 Ga0207706_10143354
521 Ga0207706_10160579
522 Ga0207686_10118249
523 Ga0207709_10000018
524 Ga0207709_10443998
525 Ga0207669_10000899
526 Ga0207669_10013159
527 Ga0207704_10058760
528 Ga0207691_10070273
529 Ga0207691_10273058
530 Ga0207689_10088751
531 Ga0207679_10121291
532 Ga0207667_10000893
533 Ga0207667_10005050
534 Ga0207667_10038536
535 Ga0207667_10119195
536 Ga0207651_10090091
537 Ga0207640_10002507
538 Ga0207703_10001240
539 Ga0207703_10824097
540 Ga0207639_10003091
541 Ga0207639_10179912
542 Ga0207678_10030380
543 Ga0207702_10005550
544 Ga0207702_10034818
545 Ga0207702_10320857
546 Ga0207648_10050347
547 Ga0207674_10012572
548 Ga0207683_10004230
549 Ga0268266_10000002
550 Ga0268266_10038816
551 Ga0268266_10312654
552 Ga0268266_10391062
553 Ga0268264_10065049
554 Ga0265326_10030275
555 Ga0265318_10005797
556 Ga0307517_10041851
557 Ga0265338_10013879
558 Ga0265338_10037735
559 Ga0265338_10051159
560 Ga0265338_10098178
561 Ga0265338_10488088
562 Ga0265320_10000191
563 Ga0265325_10001223
564 Ga0265325_10006084
565 Ga0265329_10219356
566 Ga0265340_10001183
567 Ga0265339_10011493
568 Ga0265339_10037431
569 Ga0265339_10169718
570 Ga0265331_10000080
571 Ga0265331_10000660
572 Ga0265331_10011375
573 Ga0265331_10203391
574 Ga0265327_10000002
575 Ga0265327_10000095
576 Ga0265316_10024386
577 Ga0265316_10031192
578 Ga0265316_10431532
579 Ga0307513_10013930
580 Ga0265313_10025474
581 Ga0265313_10037002
582 Ga0265313_10053558
583 Ga0265313_10074408
584 Ga0265313_10142075
585 Ga0265314_10012819
586 Ga0265314_10016222
587 Ga0265342_10035632
588 Ga0265342_10298134
589 Ga0307413_10264177
590 Ga0307414_10812092
591 Ga0307411_10786306
592 Ga0307510_10104739
593 Ga0373927_0284907
594 Ga0373937_0633986
595 Ga0436365_0286398
596 Ga0436362_0300430
597 Ga0451787_435675
598 Ga0451802_1070427
599 Ga0451804_0468559
600 Ga0451853_3474583
601 Ga0439459_0162928
602 Ga0495617_030458
603 Ga0495617_071593
604 Ga0495638_0000018
605 Ga0495650_0001510
606 Ga0495584_0017383
607 Ga0495585_0002437
608 Ga0495585_0122348
609 Ga0495596_0022020
610 Ga0495583_0003129
611 Ga0495583_0003712
612 Ga0495583_0008809
613 Ga0495606_0050511
614 Ga0495606_0189844
615 Ga0495610_0174598
616 Ga0495616_0000022
617 Ga0495616_0049182
618 Ga0495620_0152605
619 Ga0495628_0062806
620 Ga0495631_0053540
621 Ga0495631_0055432
622 Ga0495632_0003057
623 Ga0495637_0036451
624 Ga0495643_0001892
625 Ga0495643_0006477
626 Ga0495643_0010973
627 Ga0495648_0000018
628 Ga0495648_0000024
629 Ga0495648_0023969
630 Ga0495663_0001458
631 Ga0495642_0007841
632 Ga0495652_0520842
633 Ga0495652_0826437
634 Ga0495587_0119156
635 Ga0495609_0204981
636 Ga0495597_0010912
637 Ga0495622_0015230
638 Ga0495633_0002753
639 Ga0495633_0012555
640 Ga0495668_0000090
641 Ga0495668_0011325
642 Ga0495668_0104647
643 Ga0495611_0003702
644 Ga0495611_0066382
645 Ga0495611_0187759
646 Ga0495611_0246305
647 Ga0495625_0000259
648 Ga0495625_0005010
649 Ga0495625_0057156
650 Ga0495625_0103158
651 Ga0495625_0186764
652 Ga0495635_0255037
653 Ga0495661_0431950
654 Ga0495669_0000397
655 Ga0495670_0099693
656 Ga0495670_0573366
657 Ga0495671_0000011
658 Ga0495671_0028116
659 Ga0495649_0096217
660 Ga0495649_0362460
661 Ga0495600_0009148
662 Ga0495600_0306640
663 Ga0495660_0018377
664 Ga0495683_0007990
665 Ga0495683_0009796
666 Ga0495687_001438
667 Ga0495687_003073
668 Ga0495677_0002480
669 Ga0495677_0092658
670 Ga0495673_0000013
671 Ga0495673_0057470
672 Ga0495681_0014955
673 Ga0495681_0120695
674 Ga0495686_0000082
675 Ga0495686_0157086
676 Ga0496102_0000875
677 Ga0496103_0003661
678 Ga0496104_0146920
679 Ga0496105_0005963
680 Ga0496107_0580458
681 Ga0496110_0104260
682 Ga0496112_0386011
683 Ga0496113_0350420
684 Ga0496114_0158411
685 Ga0496115_0000572
686 Ga0496116_0016933
687 Ga0496117_0000357
688 Ga0496118_0000130
689 Ga0496118_0067588
690 Ga0496119_0028551
691 Ga0496120_0028151
692 Ga0496120_0217787
693 Ga0496121_0002226
694 Ga0496121_0002397
695 Ga0496122_0003348
696 Ga0496123_0006416
697 Ga0496124_0000163
698 Ga0496125_0002602
699 Ga0496126_0002172
700 Ga0496126_0013837
701 Ga0496126_0032766
702 Ga0495682_0160112
703 Ga0501033_0015022
704 Ga0501034_0019585
705 Ga0501034_0246557
706 Ga0501034_0349854
707 Ga0501034_0446919
708 Ga0501034_1285999
709 Ga0501039_0970807
710 Ga0501043_0119797
711 Ga0501043_0264380
712 Ga0501043_0786530
713 Ga0501046_0002393
714 Ga0501046_0579421
715 Ga0501047_0000479
716 Ga0501047_0030360
717 Ga0501048_0543333
718 Ga0501069_0327431
719 Ga0501070_0045321
720 Ga0501070_0175439
721 Ga0501072_0293808
722 Ga0501073_0016185
723 Ga0501074_0237178
724 Ga0501080_0136025
725 Ga0501083_0134715
726 Ga0501083_0165235
727 Ga0501035_0365511
728 Ga0501044_0081142
729 Ga0501044_0130323
730 Ga0501044_0295944
731 Ga0501044_0378208
732 Ga0501044_0461779
733 nmdc:mga0k408_378989_c1
734 nmdc:mga09592_48595_c1
735 Ga0500610_0000039
736 Ga0500643_021305
737 Ga0500643_132818
738 Ga0500644_0032437
739 Ga0500646_0001747
740 Ga0500647_0057033
741 Ga0500583_0000544
742 Ga0500650_0098175
743 Ga0500555_004857
744 Ga0500594_0002690
745 Ga0500595_002900
746 Ga0500607_260083
747 Ga0500642_0000635
748 Ga0500655_001296
749 Ga0500655_051202
750 Ga0500559_0125483
751 Ga0500559_0137734
752 Ga0500568_0018492
753 Ga0500577_0112078
754 Ga0500588_0009649
755 Ga0500604_0000153
756 Ga0500604_0011800
757 Ga0500622_0057520
758 Ga0500622_0070853
759 Ga0500627_0071762
760 Ga0500636_0001895
761 Ga0500645_000005
762 Ga0500596_013651
763 Ga0501084_1615522
764 Ga0500661_013224
765 Ga0501082_0154539
766 8056878549

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09351

DUF1993

Domain of unknown function (DUF1993)

44

204

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.9332 5 167
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.9063 5 167
3qth-assembly1.cif.gz_A crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8741 5 166
3qth-assembly1.cif.gz_B crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8603 5 166
3qth-assembly1.cif.gz_A crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8204 5 166
ID Description Score Start End Superfamily
2oqmC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.922 5 166 1.20.120.450
3qthB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.869 5 166 1.20.120.450
af_Q9VTT1_11_110_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8548 110 154 1.10.287.370
3qthB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7873 5 166 1.20.120.450
af_Q8LD83_4_74_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7145 53 155 1.10.287.370
ID Description Score Start End GO Terms
AF-A0A525J0B8-F1-model_v4 DUF1993 domain-containing protein 0.9872 5 167
AF-A0A520HIL0-F1-model_v4 DUF1993 domain-containing protein 0.9866 25 167 GO:0016020
AF-A0A537EBV4-F1-model_v4 DUF1993 domain-containing protein 0.9847 6 157
AF-A0A2T0XBG4-F1-model_v4 DUF1993 domain-containing protein 0.9838 6 166
AF-A0A2P7ST21-F1-model_v4 DUF1993 domain-containing protein 0.9825 1 165

Map