F429629

General Info

Members Datasets Scaffolds Average Seq Length
383 241 378 167

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10000409|Ga0307511_1000040919
Length 196
Sequence MVTGRSEQTQIPRTDPASANSPGSSGSLFRLIMKDKSTEKIWSLLEDINDPEVPVLSILDLGIVRDVSAEEDRVEVVVTPTYSGCPAMDVIRMNIRMVLLEQGYKDVVIRTVLSPAWTTDWMSEKGKDKLRAYGIAAPTPVQQVCHPGLFQQEEAIPCPRCHSHHTTLISQFGSTACKALYRCEDCKEPFDYFKCH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
3 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
4 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
5 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
6 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
7 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
145 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
146 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
163 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
164 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
167 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
168 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
169 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
170 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
171 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
172 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
223 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
235 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
237 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
241 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0.52
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.83
Nodule 0
Rhizoplane 2.35
Rhizosphere 89.82
Stem 0
Stem Tuber 0
Unclassified 6.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1762462 2162886007 Bacteria 256265
2 CNXas_1011188 3300000545 Bacteria 636
3 JGI24736J21556_1018653 3300001904 Bacteria 1097
4 JGI24744J21845_10059761 3300002077 Unclassified 698
5 rootH1_10190871 3300003316 Bacteria 1703
6 rootH2_10006463 3300003320 Bacteria 45674
7 rootH2_10043903 3300003320 Bacteria 12034
8 rootL2_10060842 3300003322 Bacteria 7201
9 rootL2_10115297 3300003322 Bacteria 3067
10 rootL2_10228160 3300003322 Bacteria 3884
11 rootH1_10052994 3300003323 Bacteria 7506
12 rootH1_10062716 3300003323 Unclassified 1399
13 rootH1_10114880 3300003323 Unclassified 3191
14 rootH1_10126130 3300003323 Bacteria 9514
15 rootH1_10205224 3300003323 Bacteria 1723
16 Ga0055529_1002289 3300003763 Bacteria 3850
17 Ga0065165_1001114 3300005262 Bacteria 31744
18 Ga0065704_10000188 3300005289 Bacteria 267216
19 Ga0065715_10317022 3300005293 Bacteria 1009
20 Ga0070676_10009109 3300005328 Bacteria 5369
21 Ga0070670_100116861 3300005331 Bacteria 2300
22 Ga0070670_100126974 3300005331 Unclassified 2202
23 Ga0070670_100147732 3300005331 Bacteria 2034
24 Ga0070670_100735503 3300005331 Bacteria 888
25 Ga0070677_10117997 3300005333 Bacteria 1194
26 Ga0070677_10457546 3300005333 Bacteria 684
27 Ga0068869_100138857 3300005334 Bacteria 1875
28 Ga0068869_100266927 3300005334 Bacteria 1372
29 Ga0070666_10055243 3300005335 Bacteria 2680
30 Ga0070680_100072276 3300005336 Bacteria 2835
31 Ga0070682_100060078 3300005337 Bacteria 2403
32 Ga0068868_100032630 3300005338 Bacteria 4008
33 Ga0070660_100042115 3300005339 Bacteria 3484
34 Ga0070660_100223140 3300005339 Bacteria 1532
35 Ga0070661_100737393 3300005344 Unclassified 805
36 Ga0070668_100004039 3300005347 Bacteria 10856
37 Ga0070669_100115447 3300005353 Bacteria 2042
38 Ga0070674_100015723 3300005356 Bacteria 4731
39 Ga0070667_100027261 3300005367 Bacteria 4753
40 Ga0070667_100096832 3300005367 Bacteria 2545
41 Ga0070694_100330183 3300005444 Bacteria 1176
42 Ga0070678_100319966 3300005456 Bacteria 1324
43 Ga0070662_100048626 3300005457 Bacteria 3055
44 Ga0070662_100648678 3300005457 Bacteria 890
45 Ga0070681_10119680 3300005458 Bacteria 2569
46 Ga0070681_10142407 3300005458 Bacteria 2327
47 Ga0068867_100068824 3300005459 Bacteria 2642
48 Ga0068867_100118408 3300005459 Bacteria 2043
49 Ga0068867_100255701 3300005459 Bacteria 1426
50 Ga0070685_10492122 3300005466 Bacteria 866
51 Ga0070679_100005513 3300005530 Bacteria 11724
52 Ga0070684_100853427 3300005535 Unclassified 852
53 Ga0068853_100004598 3300005539 Bacteria 10710
54 Ga0068853_100008078 3300005539 Bacteria 8441
55 Ga0068853_100187231 3300005539 Bacteria 1879
56 Ga0068853_100510963 3300005539 Bacteria 1135
57 Ga0068853_100665925 3300005539 Unclassified 991
58 Ga0070672_100036184 3300005543 Bacteria 3759
59 Ga0070672_100367629 3300005543 Unclassified 1228
60 Ga0070672_100684367 3300005543 Bacteria 897
61 Ga0070693_101308486 3300005547 Bacteria 560
62 Ga0070665_100000002 3300005548 Bacteria 849037
63 Ga0070665_100001763 3300005548 Bacteria 24676
64 Ga0068855_100584497 3300005563 Bacteria 1206
65 Ga0068855_100636182 3300005563 Bacteria 1147
66 Ga0068857_100445336 3300005577 Bacteria 1210
67 Ga0068854_100290110 3300005578 Bacteria 1320
68 Ga0068856_100120818 3300005614 Bacteria 2621
69 Ga0068852_100003287 3300005616 Bacteria 11289
70 Ga0068859_100564620 3300005617 Bacteria 1232
71 Ga0068864_100219646 3300005618 Unclassified 1753
72 Ga0068866_10011825 3300005718 Bacteria 3789
73 Ga0068861_100008169 3300005719 Bacteria 7202
74 Ga0068851_10064557 3300005834 Bacteria 1882
75 Ga0068870_10085994 3300005840 Bacteria 1749
76 Ga0068863_100120127 3300005841 Bacteria 2505
77 Ga0068863_100495797 3300005841 Bacteria 1202
78 Ga0068858_100402531 3300005842 Bacteria 1315
79 Ga0068860_100000003 3300005843 Bacteria 575741
80 Ga0068860_100014489 3300005843 Bacteria 7719
81 Ga0068862_100003804 3300005844 Bacteria 12855
82 Ga0068862_100006112 3300005844 Bacteria 10020
83 Ga0081540_1023945 3300005983 Unclassified 3555
84 Ga0097621_100003774 3300006237 Bacteria 10498
85 Ga0097621_100012880 3300006237 Bacteria 6215
86 Ga0097621_100279106 3300006237 Bacteria 1470
87 Ga0097621_100575677 3300006237 Unclassified 1027
88 Ga0068871_100006775 3300006358 Bacteria 8139
89 Ga0068871_100022320 3300006358 Bacteria 4879
90 Ga0068871_100255396 3300006358 Unclassified 1528
91 Ga0075428_100001020 3300006844 Bacteria 29707
92 Ga0075428_100055322 3300006844 Bacteria 4347
93 Ga0075428_100402200 3300006844 Bacteria 1467
94 Ga0075430_100054711 3300006846 Bacteria 3357
95 Ga0075431_100026802 3300006847 Bacteria 5911
96 Ga0075431_100042473 3300006847 Bacteria 4690
97 Ga0075431_100307297 3300006847 Bacteria 1601
98 Ga0075429_100021214 3300006880 Bacteria 5631
99 Ga0075429_100396449 3300006880 Bacteria 1208
100 Ga0068865_100124631 3300006881 Bacteria 1921
101 Ga0097620_100564615 3300006931 Bacteria 1232
102 Ga0105244_10003953 3300009036 Bacteria 10397
103 Ga0105250_10001065 3300009092 Bacteria 15652
104 Ga0105240_10000066 3300009093 Bacteria 212612
105 Ga0105240_10003002 3300009093 Bacteria 26548
106 Ga0105240_10005046 3300009093 Bacteria 19803
107 Ga0105240_10100095 3300009093 Bacteria 3527
108 Ga0111539_10017029 3300009094 Bacteria 8996
109 Ga0111539_10552420 3300009094 Bacteria 1341
110 Ga0105245_10400878 3300009098 Bacteria 1371
111 Ga0105243_11023313 3300009148 Bacteria 830
112 Ga0105243_12180020 3300009148 Bacteria 590
113 Ga0105241_10000543 3300009174 Bacteria 28453
114 Ga0105242_10742280 3300009176 Bacteria 965
115 Ga0105248_10041649 3300009177 Bacteria 5149
116 Ga0105237_10000144 3300009545 Bacteria 100105
117 Ga0105237_10082921 3300009545 Bacteria 3197
118 Ga0105237_10374767 3300009545 Bacteria 1428
119 Ga0105237_10406187 3300009545 Bacteria 1367
120 Ga0105238_10009361 3300009551 Bacteria 9811
121 Ga0105238_10263166 3300009551 Bacteria 1704
122 Ga0105238_10968901 3300009551 Bacteria 871
123 Ga0105249_10666018 3300009553 Bacteria 1099
124 Ga0105249_10681098 3300009553 Bacteria 1087
125 Ga0105249_11011598 3300009553 Bacteria 900
126 Ga0105249_11522806 3300009553 Unclassified 741
127 Ga0105239_10000876 3300010375 Bacteria 42786
128 Ga0105239_10000925 3300010375 Bacteria 41596
129 Ga0105239_10035277 3300010375 Bacteria 5493
130 Ga0105239_10060402 3300010375 Bacteria 4160
131 Ga0105239_10246662 3300010375 Bacteria 2005
132 Ga0105239_10477183 3300010375 Unclassified 1417
133 Ga0157371_10281065 3300013102 Bacteria 1202
134 Ga0157370_10069162 3300013104 Bacteria 3335
135 Ga0157370_11254097 3300013104 Bacteria 668
136 Ga0157369_10139046 3300013105 Bacteria 2570
137 Ga0157369_10360722 3300013105 Bacteria 1509
138 Ga0157374_10000013 3300013296 Bacteria 461240
139 Ga0157374_11923973 3300013296 Bacteria 617
140 Ga0157378_10016148 3300013297 Bacteria 6538
141 Ga0157378_10018304 3300013297 Bacteria 6149
142 Ga0157378_10022739 3300013297 Bacteria 5517
143 Ga0163162_10001229 3300013306 Bacteria 23943
144 Ga0163162_10007565 3300013306 Bacteria 10581
145 Ga0163162_10112032 3300013306 Bacteria 2827
146 Ga0163162_10860443 3300013306 Bacteria 1021
147 Ga0163162_11172681 3300013306 Unclassified 871
148 Ga0157372_10004419 3300013307 Bacteria 14994
149 Ga0157372_10007311 3300013307 Bacteria 11757
150 Ga0157372_10044212 3300013307 Bacteria 4935
151 Ga0157372_10317277 3300013307 Bacteria 1814
152 Ga0157375_10000422 3300013308 Bacteria 38347
153 Ga0157375_10276259 3300013308 Bacteria 1842
154 Ga0163163_10001496 3300014325 Bacteria 19803
155 Ga0157380_10120417 3300014326 Bacteria 2222
156 Ga0157380_11279970 3300014326 Bacteria 780
157 Ga0157379_10063070 3300014968 Bacteria 3314
158 Ga0157376_10000878 3300014969 Bacteria 19713
159 Ga0157376_10001313 3300014969 Bacteria 16384
160 Ga0206353_11320079 3300020082 Bacteria 1526
161 Ga0207696_1002284 3300025711 Bacteria 9522
162 Ga0207655_1007950 3300025728 Bacteria 6808
163 Ga0207680_10087524 3300025903 Bacteria 1973
164 Ga0207647_10004256 3300025904 Bacteria 10613
165 Ga0207645_10003256 3300025907 Bacteria 12402
166 Ga0207643_10192895 3300025908 Bacteria 1237
167 Ga0207705_10457076 3300025909 Unclassified 990
168 Ga0207654_10006451 3300025911 Bacteria 5906
169 Ga0207707_10016034 3300025912 Bacteria 6534
170 Ga0207695_10000078 3300025913 Bacteria 297378
171 Ga0207695_10001122 3300025913 Bacteria 46534
172 Ga0207695_10001317 3300025913 Bacteria 42084
173 Ga0207695_10012743 3300025913 Bacteria 10065
174 Ga0207695_10215383 3300025913 Unclassified 1830
175 Ga0207671_10000067 3300025914 Bacteria 162184
176 Ga0207671_10001689 3300025914 Bacteria 25015
177 Ga0207671_10003111 3300025914 Bacteria 16871
178 Ga0207671_10467059 3300025914 Bacteria 1005
179 Ga0207693_10225605 3300025915 Unclassified 1471
180 Ga0207660_11049419 3300025917 Bacteria 664
181 Ga0207657_10047669 3300025919 Bacteria 3744
182 Ga0207652_10020590 3300025921 Bacteria 5435
183 Ga0207652_11072676 3300025921 Unclassified 705
184 Ga0207694_10094039 3300025924 Bacteria 2368
185 Ga0207694_10194675 3300025924 Bacteria 1648
186 Ga0207694_10197539 3300025924 Bacteria 1636
187 Ga0207694_10804776 3300025924 Bacteria 794
188 Ga0207650_10111179 3300025925 Bacteria 2121
189 Ga0207644_10026095 3300025931 Bacteria 4023
190 Ga0207706_10001508 3300025933 Bacteria 23112
191 Ga0207706_10663319 3300025933 Bacteria 893
192 Ga0207686_10481192 3300025934 Bacteria 960
193 Ga0207709_10892002 3300025935 Unclassified 722
194 Ga0207669_10553549 3300025937 Bacteria 928
195 Ga0207704_10068501 3300025938 Bacteria 2237
196 Ga0207704_10079764 3300025938 Bacteria 2111
197 Ga0207691_10002454 3300025940 Bacteria 18133
198 Ga0207691_10605835 3300025940 Bacteria 927
199 Ga0207689_10032326 3300025942 Bacteria 4354
200 Ga0207689_10071735 3300025942 Bacteria 2845
201 Ga0207667_10257538 3300025949 Bacteria 1784
202 Ga0207667_10887639 3300025949 Bacteria 884
203 Ga0207667_11674936 3300025949 Bacteria 603
204 Ga0207712_10766395 3300025961 Bacteria 846
205 Ga0207668_10080658 3300025972 Bacteria 2358
206 Ga0207640_10247274 3300025981 Bacteria 1382
207 Ga0207658_10032393 3300025986 Bacteria 3720
208 Ga0207658_10387562 3300025986 Bacteria 1225
209 Ga0207703_10991660 3300026035 Bacteria 806
210 Ga0207639_10008220 3300026041 Bacteria 7145
211 Ga0207639_10123100 3300026041 Bacteria 2134
212 Ga0207639_10134878 3300026041 Bacteria 2049
213 Ga0207639_11029390 3300026041 Unclassified 771
214 Ga0207708_10056553 3300026075 Bacteria 2993
215 Ga0207702_10123150 3300026078 Bacteria 2323
216 Ga0207641_10041325 3300026088 Bacteria 3864
217 Ga0207648_10003102 3300026089 Bacteria 17547
218 Ga0207648_10130877 3300026089 Bacteria 2208
219 Ga0207648_10148231 3300026089 Bacteria 2070
220 Ga0207648_10257810 3300026089 Bacteria 1556
221 Ga0207648_10392939 3300026089 Bacteria 1255
222 Ga0207676_10157637 3300026095 Bacteria 1963
223 Ga0207676_10208731 3300026095 Bacteria 1731
224 Ga0207675_100000205 3300026118 Bacteria 54926
225 Ga0207675_100152841 3300026118 Bacteria 2198
226 Ga0207675_100663516 3300026118 Bacteria 1050
227 Ga0207683_10183495 3300026121 Unclassified 1898
228 Ga0207683_10799832 3300026121 Bacteria 875
229 Ga0207698_10012503 3300026142 Bacteria 5558
230 Ga0207698_10341863 3300026142 Eukaryota 1410
231 Ga0207698_10409866 3300026142 Bacteria 1298
232 Ga0210002_1001501 3300027617 Bacteria 3303
233 Ga0209983_1000057 3300027665 Bacteria 16946
234 Ga0209971_1003992 3300027682 Bacteria 3488
235 Ga0209966_1011181 3300027695 Bacteria 1632
236 Ga0209998_10000641 3300027717 Bacteria 9378
237 Ga0209974_10002031 3300027876 Bacteria 7395
238 Ga0207428_10163888 3300027907 Bacteria 1687
239 Ga0268266_10000169 3300028379 Bacteria 119437
240 Ga0268266_10012841 3300028379 Bacteria 7232
241 Ga0268265_10034022 3300028380 Bacteria 3711
242 Ga0268265_10765491 3300028380 Unclassified 938
243 Ga0268264_10000063 3300028381 Bacteria 301702
244 Ga0268264_10047955 3300028381 Bacteria 3552
245 Ga0268264_10057818 3300028381 Unclassified 3245
246 Ga0268264_10572311 3300028381 Unclassified 1110
247 Ga0265338_10040332 3300028800 Bacteria 4388
248 Ga0265338_10317283 3300028800 Bacteria 1129
249 Ga0265324_10030788 3300029957 Bacteria 1881
250 Ga0307511_10000409 3300030521 Bacteria 45829
251 Ga0265762_1013360 3300030760 Unclassified 1477
252 Ga0265330_10198359 3300031235 Bacteria 849
253 Ga0265330_10251197 3300031235 Bacteria 745
254 Ga0265320_10012212 3300031240 Bacteria 5013
255 Ga0265325_10146963 3300031241 Bacteria 1117
256 Ga0265331_10283909 3300031250 Bacteria 742
257 Ga0265327_10000013 3300031251 Bacteria 519549
258 Ga0265327_10065119 3300031251 Bacteria 1844
259 Ga0265316_10380018 3300031344 Bacteria 1019
260 Ga0265316_10409389 3300031344 Bacteria 976
261 Ga0307509_10074282 3300031507 Bacteria 3537
262 Ga0307509_10170572 3300031507 Bacteria 2056
263 Ga0307408_100000601 3300031548 Bacteria 30950
264 Ga0265313_10034604 3300031595 Bacteria 2553
265 Ga0265314_10033157 3300031711 Bacteria 3791
266 Ga0265314_10054592 3300031711 Bacteria 2765
267 Ga0307516_10000384 3300031730 Bacteria 57633
268 Ga0307516_10201460 3300031730 Bacteria 1710
269 Ga0307516_10207042 3300031730 Bacteria 1678
270 Ga0307414_10080157 3300032004 Bacteria 2386
271 Ga0307414_10210017 3300032004 Bacteria 1590
272 Ga0307411_10395724 3300032005 Bacteria 1141
273 Ga0307510_10000156 3300033180 Bacteria 56919
274 Ga0436365_1761111 3300039437 Bacteria 1394
275 Ga0439453_0098311 3300041408 Bacteria 650
276 Ga0451789_1050343 3300041443 Bacteria 829
277 Ga0451837_1654371 3300041494 Bacteria 674
278 Ga0451853_3360408 3300041512 Bacteria 591
279 Ga0439443_020824 3300042003 Bacteria 1033
280 Ga0439462_0021726 3300042015 Bacteria 1678
281 Ga0450889_013713 3300042144 Bacteria 859
282 Ga0439435_0077846 3300042436 Bacteria 991
283 Ga0439444_0005341 3300042437 Bacteria 1902
284 Ga0450916_058562 3300042530 Bacteria 622
285 Ga0450893_0011170 3300042532 Bacteria 1482
286 Ga0451577_0000437 3300042876 Bacteria 74033
287 Ga0451577_0010558 3300042876 Bacteria 8810
288 Ga0466972_0036847 3300044658 Bacteria 2391
289 Ga0466982_0079428 3300044672 Bacteria 2031
290 Ga0466961_0032329 3300044693 Bacteria 3361
291 Ga0466964_0076214 3300044706 Bacteria 1429
292 Ga0453684_0940730 3300044712 Bacteria 923
293 Ga0466968_0495587 3300044735 Unclassified 608
294 Ga0466970_0025649 3300044765 Bacteria 3087
295 Ga0466957_0049786 3300044842 Bacteria 2548
296 Ga0466959_0010464 3300045049 Bacteria 6636
297 Ga0495638_0051727 3300046460 Bacteria 2562
298 Ga0495638_0054148 3300046460 Bacteria 2495
299 Ga0495650_0103193 3300046471 Bacteria 1068
300 Ga0495650_0256533 3300046471 Bacteria 593
301 Ga0495606_0012188 3300046507 Bacteria 6928
302 Ga0495648_0001692 3300046524 Bacteria 21327
303 Ga0495654_0006798 3300046530 Bacteria 6459
304 Ga0495597_0000135 3300046542 Bacteria 67103
305 Ga0495633_0320087 3300046558 Unclassified 704
306 Ga0495668_0126814 3300046616 Bacteria 1397
307 Ga0495611_0000061 3300046648 Bacteria 77533
308 Ga0495588_0008224 3300046674 Bacteria 4778
309 Ga0495649_0132449 3300046694 Bacteria 1315
310 Ga0495649_0367978 3300046694 Bacteria 725
311 Ga0495636_0000370 3300047318 Bacteria 16940
312 Ga0495687_001475 3300047443 Bacteria 21512
313 Ga0495681_0023205 3300047470 Bacteria 3301
314 Ga0495686_0000010 3300047472 Bacteria 573229
315 Ga0495686_0312401 3300047472 Bacteria 864
316 Ga0496101_0204278 3300048904 Bacteria 1528
317 Ga0496102_0093102 3300048905 Bacteria 2792
318 Ga0496104_0033571 3300048907 Unclassified 4783
319 Ga0496106_0340408 3300048909 Bacteria 1205
320 Ga0496109_0748433 3300048912 Unclassified 915
321 Ga0496114_0026355 3300048917 Bacteria 4758
322 Ga0496115_0008451 3300048918 Bacteria 7616
323 Ga0496115_0298103 3300048918 Bacteria 1321
324 Ga0501032_0321656 3300049569 Bacteria 998
325 Ga0501034_0055343 3300049571 Bacteria 3992
326 Ga0501034_0374768 3300049571 Bacteria 1349
327 Ga0501034_0958110 3300049571 Unclassified 741
328 Ga0501036_0096817 3300049572 Bacteria 2495
329 Ga0501036_0978878 3300049572 Bacteria 693
330 Ga0501037_0802988 3300049573 Bacteria 621
331 Ga0501039_0195809 3300049575 Bacteria 1589
332 Ga0501040_0621662 3300049576 Bacteria 780
333 Ga0501043_0166061 3300049579 Bacteria 1724
334 Ga0501043_0221867 3300049579 Bacteria 1462
335 Ga0501043_1048236 3300049579 Bacteria 578
336 Ga0501046_0635360 3300049580 Bacteria 755
337 Ga0501047_0103033 3300049581 Bacteria 2734
338 Ga0501047_0176659 3300049581 Bacteria 2003
339 Ga0501047_0306359 3300049581 Bacteria 1430
340 Ga0501069_0027142 3300049585 Bacteria 3137
341 Ga0501070_0002239 3300049586 Bacteria 16997
342 Ga0501070_0005536 3300049586 Bacteria 10769
343 Ga0501071_0171387 3300049587 Bacteria 1624
344 Ga0501072_0200492 3300049588 Bacteria 1591
345 Ga0501074_0220075 3300049590 Bacteria 1352
346 Ga0501074_0337094 3300049590 Bacteria 1070
347 Ga0501075_0036717 3300049591 Bacteria 3658
348 Ga0501076_0115655 3300049592 Bacteria 2170
349 Ga0501077_0048144 3300049593 Bacteria 2708
350 Ga0501219_000277 3300049703 Bacteria 9094
351 Ga0501225_0124192 3300049705 Bacteria 769
352 Ga0501080_0002780 3300049742 Bacteria 15372
353 Ga0501080_0952707 3300049742 Bacteria 746
354 Ga0501081_0539124 3300049743 Bacteria 871
355 Ga0501035_0069976 3300049822 Bacteria 3109
356 Ga0501035_0076923 3300049822 Bacteria 2950
357 Ga0501035_0092426 3300049822 Bacteria 2662
358 Ga0501035_0333794 3300049822 Bacteria 1272
359 Ga0501044_0000396 3300049823 Bacteria 54058
360 Ga0501044_0029505 3300049823 Bacteria 5783
361 Ga0501044_0091922 3300049823 Bacteria 3060
362 Ga0501044_0246133 3300049823 Bacteria 1731
363 Ga0501045_0063751 3300049824 Bacteria 2705
364 Ga0501284_00001 3300050005 Bacteria 261916
365 nmdc:mga09592_254962_c1 3300050508 Bacteria 1521
366 nmdc:mga09592_323970_c1 3300050508 Bacteria 1335
367 nmdc:mga0qj67_235453_c1 3300050509 Bacteria 1486
368 nmdc:mga06r32_111502_c1 3300050510 Bacteria 2692
369 nmdc:mga06r32_265237_c1 3300050510 Bacteria 1705
370 nmdc:mga06r32_36808_c1 3300050510 Bacteria 4627
371 nmdc:mga08y16_85784_c1 3300050511 Bacteria 3282
372 Ga0500592_002656 3300053116 Bacteria 2874
373 Ga0500618_005207 3300053125 Bacteria 3998
374 Ga0500658_0169889 3300053134 Unclassified 990
375 Ga0500568_0000974 3300053139 Bacteria 19719
376 Ga0500622_0002409 3300053156 Bacteria 13517
377 Ga0501082_1208868 3300060353 Bacteria 660
378 Ga0466962_0087595 3300061719 Bacteria 1491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100663516 Ga0207675_1006635162 123
2 3300049571 Ga0501034_0958110 Ga0501034_0958110_266_706 143
3 3300049581 Ga0501047_0176659 Ga0501047_0176659_1371_1811 143
4 3300049586 Ga0501070_0005536 Ga0501070_0005536_5168_5608 143
5 3300049576 Ga0501040_0621662 Ga0501040_0621662_333_770 145
6 iso_pu_bacteria 2891670763 2891670828 149
7 iso_pu_bacteria 8054849141 8054853170 149
8 3300006844 Ga0075428_100001020 Ga0075428_10000102023 151
9 3300006844 Ga0075428_100055322 Ga0075428_1000553225 151
10 3300006846 Ga0075430_100054711 Ga0075430_1000547112 151
11 3300006847 Ga0075431_100026802 Ga0075431_1000268024 151
12 3300006880 Ga0075429_100396449 Ga0075429_1003964492 151
13 3300053125 Ga0500618_005207 Ga0500618_005207_2293_2760 151
14 3300009036 Ga0105244_10003953 Ga0105244_100039535 152
15 3300009092 Ga0105250_10001065 Ga0105250_1000106514 152
16 3300009093 Ga0105240_10003002 Ga0105240_1000300211 152
17 3300025711 Ga0207696_1002284 Ga0207696_10022845 152
18 3300025728 Ga0207655_1007950 Ga0207655_10079505 152
19 3300025913 Ga0207695_10001317 Ga0207695_1000131720 152
20 3300046530 Ga0495654_0006798 Ga0495654_0006798_3650_4150 152
21 3300046542 Ga0495597_0000135 Ga0495597_0000135_43319_43819 152
22 3300046674 Ga0495588_0008224 Ga0495588_0008224_2530_3030 152
23 3300046694 Ga0495649_0132449 Ga0495649_0132449_588_1088 152
24 3300047470 Ga0495681_0023205 Ga0495681_0023205_1928_2428 152
25 3300000545 CNXas_1011188 CNXas_10111881 154
26 3300005328 Ga0070676_10009109 Ga0070676_100091092 154
27 3300005331 Ga0070670_100735503 Ga0070670_1007355032 154
28 3300005333 Ga0070677_10117997 Ga0070677_101179971 154
29 3300005336 Ga0070680_100072276 Ga0070680_1000722763 154
30 3300005339 Ga0070660_100223140 Ga0070660_1002231402 154
31 3300005347 Ga0070668_100004039 Ga0070668_1000040399 154
32 3300005353 Ga0070669_100115447 Ga0070669_1001154473 154
33 3300005356 Ga0070674_100015723 Ga0070674_1000157235 154
34 3300005444 Ga0070694_100330183 Ga0070694_1003301831 154
35 3300005457 Ga0070662_100048626 Ga0070662_1000486261 154
36 3300005459 Ga0068867_100068824 Ga0068867_1000688242 154
37 3300005543 Ga0070672_100036184 Ga0070672_1000361844 154
38 3300005578 Ga0068854_100290110 Ga0068854_1002901102 154
39 3300005719 Ga0068861_100008169 Ga0068861_1000081695 154
40 3300005840 Ga0068870_10085994 Ga0068870_100859942 154
41 3300005844 Ga0068862_100003804 Ga0068862_10000380412 154
42 3300006844 Ga0075428_100402200 Ga0075428_1004022002 154
43 3300006847 Ga0075431_100042473 Ga0075431_1000424736 154
44 3300006847 Ga0075431_100307297 Ga0075431_1003072972 154
45 3300006880 Ga0075429_100021214 Ga0075429_1000212141 154
46 3300009094 Ga0111539_10017029 Ga0111539_100170296 154
47 3300009094 Ga0111539_10552420 Ga0111539_105524202 154
48 3300014326 Ga0157380_10120417 Ga0157380_101204172 154
49 3300025907 Ga0207645_10003256 Ga0207645_1000325610 154
50 3300025908 Ga0207643_10192895 Ga0207643_101928952 154
51 3300025917 Ga0207660_11049419 Ga0207660_110494191 154
52 3300025933 Ga0207706_10001508 Ga0207706_100015087 154
53 3300025937 Ga0207669_10553549 Ga0207669_105535492 154
54 3300025938 Ga0207704_10068501 Ga0207704_100685012 154
55 3300025940 Ga0207691_10002454 Ga0207691_1000245421 154
56 3300025972 Ga0207668_10080658 Ga0207668_100806582 154
57 3300025981 Ga0207640_10247274 Ga0207640_102472742 154
58 3300026075 Ga0207708_10056553 Ga0207708_100565533 154
59 3300026089 Ga0207648_10003102 Ga0207648_1000310213 154
60 3300026118 Ga0207675_100000205 Ga0207675_10000020535 154
61 3300027617 Ga0210002_1001501 Ga0210002_10015013 154
62 3300027665 Ga0209983_1000057 Ga0209983_100005716 154
63 3300027682 Ga0209971_1003992 Ga0209971_10039922 154
64 3300027695 Ga0209966_1011181 Ga0209966_10111811 154
65 3300027717 Ga0209998_10000641 Ga0209998_100006416 154
66 3300027876 Ga0209974_10002031 Ga0209974_100020312 154
67 3300027907 Ga0207428_10163888 Ga0207428_101638882 154
68 3300028380 Ga0268265_10034022 Ga0268265_100340222 154
69 3300041408 Ga0439453_0098311 Ga0439453_0098311_45_545 154
70 3300042003 Ga0439443_020824 Ga0439443_020824_274_774 154
71 3300042144 Ga0450889_013713 Ga0450889_013713_108_608 154
72 3300042436 Ga0439435_0077846 Ga0439435_0077846_292_792 154
73 3300042437 Ga0439444_0005341 Ga0439444_0005341_1278_1778 154
74 3300042530 Ga0450916_058562 Ga0450916_058562_47_547 154
75 3300042532 Ga0450893_0011170 Ga0450893_0011170_656_1153 154
76 3300046471 Ga0495650_0256533 Ga0495650_0256533_24_509 154
77 3300049569 Ga0501032_0321656 Ga0501032_0321656_304_801 154
78 3300049572 Ga0501036_0096817 Ga0501036_0096817_211_708 154
79 3300049575 Ga0501039_0195809 Ga0501039_0195809_546_1043 154
80 3300049579 Ga0501043_1048236 Ga0501043_1048236_60_557 154
81 3300049580 Ga0501046_0635360 Ga0501046_0635360_25_522 154
82 3300049587 Ga0501071_0171387 Ga0501071_0171387_885_1382 154
83 3300049588 Ga0501072_0200492 Ga0501072_0200492_673_1170 154
84 3300049590 Ga0501074_0337094 Ga0501074_0337094_91_588 154
85 3300049591 Ga0501075_0036717 Ga0501075_0036717_1448_1945 154
86 3300049592 Ga0501076_0115655 Ga0501076_0115655_1227_1724 154
87 3300049743 Ga0501081_0539124 Ga0501081_0539124_230_727 154
88 3300049822 Ga0501035_0333794 Ga0501035_0333794_323_820 154
89 3300049824 Ga0501045_0063751 Ga0501045_0063751_758_1255 154
90 3300050508 nmdc:mga09592_254962_c1 nmdc:mga09592_254962_c1_168_665 154
91 3300050508 nmdc:mga09592_323970_c1 nmdc:mga09592_323970_c1_415_912 154
92 3300050509 nmdc:mga0qj67_235453_c1 nmdc:mga0qj67_235453_c1_273_770 154
93 3300050510 nmdc:mga06r32_111502_c1 nmdc:mga06r32_111502_c1_376_873 154
94 3300050510 nmdc:mga06r32_265237_c1 nmdc:mga06r32_265237_c1_490_987 154
95 3300050510 nmdc:mga06r32_36808_c1 nmdc:mga06r32_36808_c1_614_1111 154
96 3300050511 nmdc:mga08y16_85784_c1 nmdc:mga08y16_85784_c1_298_795 154
97 3300060353 Ga0501082_1208868 Ga0501082_1208868_16_513 154
98 3300002077 JGI24744J21845_10059761 JGI24744J21845_100597612 156
99 3300005293 Ga0065715_10317022 Ga0065715_103170222 156
100 3300005331 Ga0070670_100147732 Ga0070670_1001477323 156
101 3300005333 Ga0070677_10457546 Ga0070677_104575461 156
102 3300005458 Ga0070681_10119680 Ga0070681_101196802 156
103 3300005547 Ga0070693_101308486 Ga0070693_1013084861 156
104 3300013104 Ga0157370_10069162 Ga0157370_100691622 156
105 3300014326 Ga0157380_11279970 Ga0157380_112799701 156
106 3300025912 Ga0207707_10016034 Ga0207707_100160342 156
107 3300044706 Ga0466964_0076214 Ga0466964_0076214_775_1317 156
108 3300048918 Ga0496115_0008451 Ga0496115_0008451_176_664 156
109 iso_pu_bacteria 2881955468 2881957655 156
110 3300005331 Ga0070670_100116861 Ga0070670_1001168613 157
111 3300005334 Ga0068869_100138857 Ga0068869_1001388572 157
112 3300005337 Ga0070682_100060078 Ga0070682_1000600782 157
113 3300005339 Ga0070660_100042115 Ga0070660_1000421151 157
114 3300005367 Ga0070667_100027261 Ga0070667_1000272612 157
115 3300005459 Ga0068867_100118408 Ga0068867_1001184084 157
116 3300005530 Ga0070679_100005513 Ga0070679_1000055132 157
117 3300005563 Ga0068855_100584497 Ga0068855_1005844972 157
118 3300005616 Ga0068852_100003287 Ga0068852_1000032875 157
119 3300005617 Ga0068859_100564620 Ga0068859_1005646202 157
120 3300005841 Ga0068863_100495797 Ga0068863_1004957972 157
121 3300005843 Ga0068860_100014489 Ga0068860_1000144897 157
122 3300005844 Ga0068862_100006112 Ga0068862_1000061125 157
123 3300006931 Ga0097620_100564615 Ga0097620_1005646152 157
124 3300009098 Ga0105245_10400878 Ga0105245_104008782 157
125 3300009553 Ga0105249_10681098 Ga0105249_106810982 157
126 3300013102 Ga0157371_10281065 Ga0157371_102810652 157
127 3300013105 Ga0157369_10139046 Ga0157369_101390462 157
128 3300013307 Ga0157372_10007311 Ga0157372_1000731112 157
129 3300025919 Ga0207657_10047669 Ga0207657_100476696 157
130 3300025921 Ga0207652_10020590 Ga0207652_100205906 157
131 3300025942 Ga0207689_10032326 Ga0207689_100323264 157
132 3300025949 Ga0207667_10257538 Ga0207667_102575382 157
133 3300025986 Ga0207658_10387562 Ga0207658_103875622 157
134 3300026089 Ga0207648_10130877 Ga0207648_101308771 157
135 3300026089 Ga0207648_10392939 Ga0207648_103929392 157
136 3300026095 Ga0207676_10157637 Ga0207676_101576372 157
137 3300026142 Ga0207698_10012503 Ga0207698_100125036 157
138 3300028380 Ga0268265_10765491 Ga0268265_107654912 157
139 3300028381 Ga0268264_10047955 Ga0268264_100479554 157
140 3300003320 rootH2_10043903 rootH2_100439034 158
141 3300003322 rootL2_10060842 rootL2_100608423 158
142 3300003323 rootH1_10062716 rootH1_100627162 158
143 3300003323 rootH1_10114880 rootH1_101148803 158
144 3300005335 Ga0070666_10055243 Ga0070666_100552433 158
145 3300005458 Ga0070681_10142407 Ga0070681_101424073 158
146 3300005539 Ga0068853_100004598 Ga0068853_1000045989 158
147 3300005539 Ga0068853_100008078 Ga0068853_1000080786 158
148 3300005548 Ga0070665_100000002 Ga0070665_100000002663 158
149 3300005577 Ga0068857_100445336 Ga0068857_1004453362 158
150 3300005614 Ga0068856_100120818 Ga0068856_1001208184 158
151 3300005834 Ga0068851_10064557 Ga0068851_100645572 158
152 3300005843 Ga0068860_100000003 Ga0068860_100000003284 158
153 3300005983 Ga0081540_1023945 Ga0081540_10239454 158
154 3300006237 Ga0097621_100279106 Ga0097621_1002791062 158
155 3300009093 Ga0105240_10005046 Ga0105240_100050466 158
156 3300009148 Ga0105243_12180020 Ga0105243_121800202 158
157 3300009174 Ga0105241_10000543 Ga0105241_1000054315 158
158 3300009545 Ga0105237_10000144 Ga0105237_1000014450 158
159 3300009551 Ga0105238_10009361 Ga0105238_100093614 158
160 3300009551 Ga0105238_10263166 Ga0105238_102631662 158
161 3300009553 Ga0105249_11011598 Ga0105249_110115982 158
162 3300009553 Ga0105249_11522806 Ga0105249_115228062 158
163 3300010375 Ga0105239_10000925 Ga0105239_1000092513 158
164 3300010375 Ga0105239_10060402 Ga0105239_100604023 158
165 3300010375 Ga0105239_10246662 Ga0105239_102466622 158
166 3300013296 Ga0157374_10000013 Ga0157374_10000013352 158
167 3300013306 Ga0163162_10001229 Ga0163162_1000122914 158
168 3300013307 Ga0157372_10004419 Ga0157372_100044194 158
169 3300013307 Ga0157372_10317277 Ga0157372_103172774 158
170 3300014969 Ga0157376_10001313 Ga0157376_1000131321 158
171 3300025903 Ga0207680_10087524 Ga0207680_100875244 158
172 3300025911 Ga0207654_10006451 Ga0207654_100064516 158
173 3300025913 Ga0207695_10001122 Ga0207695_100011225 158
174 3300025913 Ga0207695_10215383 Ga0207695_102153832 158
175 3300025914 Ga0207671_10001689 Ga0207671_100016893 158
176 3300025914 Ga0207671_10003111 Ga0207671_1000311115 158
177 3300025924 Ga0207694_10094039 Ga0207694_100940392 158
178 3300025924 Ga0207694_10197539 Ga0207694_101975392 158
179 3300025961 Ga0207712_10766395 Ga0207712_107663951 158
180 3300026041 Ga0207639_10008220 Ga0207639_100082205 158
181 3300026041 Ga0207639_10123100 Ga0207639_101231003 158
182 3300026041 Ga0207639_11029390 Ga0207639_110293902 158
183 3300026078 Ga0207702_10123150 Ga0207702_101231501 158
184 3300026142 Ga0207698_10409866 Ga0207698_104098662 158
185 3300028379 Ga0268266_10000169 Ga0268266_1000016988 158
186 3300028381 Ga0268264_10000063 Ga0268264_10000063201 158
187 3300028381 Ga0268264_10572311 Ga0268264_105723111 158
188 3300030760 Ga0265762_1013360 Ga0265762_10133602 158
189 3300031507 Ga0307509_10074282 Ga0307509_100742824 158
190 3300031507 Ga0307509_10170572 Ga0307509_101705722 158
191 3300031548 Ga0307408_100000601 Ga0307408_10000060124 158
192 3300044658 Ga0466972_0036847 Ga0466972_0036847_1615_2103 158
193 3300044693 Ga0466961_0032329 Ga0466961_0032329_2010_2498 158
194 3300044735 Ga0466968_0495587 Ga0466968_0495587_13_501 158
195 3300044842 Ga0466957_0049786 Ga0466957_0049786_599_1087 158
196 3300045049 Ga0466959_0010464 Ga0466959_0010464_3414_3902 158
197 3300046460 Ga0495638_0051727 Ga0495638_0051727_1106_1618 158
198 3300046460 Ga0495638_0054148 Ga0495638_0054148_47_538 158
199 3300046471 Ga0495650_0103193 Ga0495650_0103193_359_838 158
200 3300046524 Ga0495648_0001692 Ga0495648_0001692_4856_5368 158
201 3300046648 Ga0495611_0000061 Ga0495611_0000061_22488_22976 158
202 3300046694 Ga0495649_0367978 Ga0495649_0367978_224_712 158
203 3300047443 Ga0495687_001475 Ga0495687_001475_12087_12599 158
204 3300047472 Ga0495686_0000010 Ga0495686_0000010_500311_500859 158
205 3300047472 Ga0495686_0312401 Ga0495686_0312401_250_738 158
206 3300049581 Ga0501047_0306359 Ga0501047_0306359_583_1071 158
207 3300049585 Ga0501069_0027142 Ga0501069_0027142_1679_2167 158
208 3300049586 Ga0501070_0002239 Ga0501070_0002239_8526_9014 158
209 3300049590 Ga0501074_0220075 Ga0501074_0220075_776_1264 158
210 3300049742 Ga0501080_0002780 Ga0501080_0002780_10177_10665 158
211 3300053134 Ga0500658_0169889 Ga0500658_0169889_122_634 158
212 3300053156 Ga0500622_0002409 Ga0500622_0002409_11800_12312 158
213 3300061719 Ga0466962_0087595 Ga0466962_0087595_565_1053 158
214 3300009545 Ga0105237_10406187 Ga0105237_104061872 159
215 3300009551 Ga0105238_10968901 Ga0105238_109689012 159
216 3300020082 Ga0206353_11320079 Ga0206353_113200793 159
217 3300025914 Ga0207671_10467059 Ga0207671_104670592 159
218 3300025915 Ga0207693_10225605 Ga0207693_102256053 159
219 3300028800 Ga0265338_10317283 Ga0265338_103172832 159
220 3300031235 Ga0265330_10198359 Ga0265330_101983592 159
221 3300031235 Ga0265330_10251197 Ga0265330_102511972 159
222 3300031240 Ga0265320_10012212 Ga0265320_100122124 159
223 3300031241 Ga0265325_10146963 Ga0265325_101469632 159
224 3300031250 Ga0265331_10283909 Ga0265331_102839092 159
225 3300031344 Ga0265316_10380018 Ga0265316_103800182 159
226 3300031344 Ga0265316_10409389 Ga0265316_104093892 159
227 3300031595 Ga0265313_10034604 Ga0265313_100346044 159
228 3300031711 Ga0265314_10033157 Ga0265314_100331574 159
229 3300042876 Ga0451577_0000437 Ga0451577_0000437_73131_73616 159
230 3300046507 Ga0495606_0012188 Ga0495606_0012188_2977_3468 159
231 3300048918 Ga0496115_0298103 Ga0496115_0298103_36_530 159
232 3300003316 rootH1_10190871 rootH1_101908713 160
233 3300003322 rootL2_10228160 rootL2_102281603 160
234 3300031730 Ga0307516_10201460 Ga0307516_102014602 160
235 3300032004 Ga0307414_10210017 Ga0307414_102100172 160
236 3300033180 Ga0307510_10000156 Ga0307510_1000015649 160
237 iso_pu_bacteria 2739367655 2739612442 160
238 iso_pu_bacteria 2881927736 2881930847 160
239 3300031251 Ga0265327_10000013 Ga0265327_10000013342 161
240 3300003763 Ga0055529_1002289 Ga0055529_10022893 162
241 3300010375 Ga0105239_10477183 Ga0105239_104771832 162
242 3300031730 Ga0307516_10000384 Ga0307516_100003842 162
243 3300041494 Ga0451837_1654371 Ga0451837_1654371_12_512 162
244 3300049572 Ga0501036_0978878 Ga0501036_0978878_88_588 162
245 3300049581 Ga0501047_0103033 Ga0501047_0103033_332_874 162
246 3300049822 Ga0501035_0076923 Ga0501035_0076923_490_990 162
247 3300053116 Ga0500592_002656 Ga0500592_002656_1996_2514 162
248 3300003320 rootH2_10006463 rootH2_100064638 163
249 3300003322 rootL2_10115297 rootL2_101152974 163
250 3300003323 rootH1_10052994 rootH1_100529944 163
251 3300005262 Ga0065165_1001114 Ga0065165_100111416 163
252 3300005331 Ga0070670_100126974 Ga0070670_1001269742 163
253 3300005334 Ga0068869_100266927 Ga0068869_1002669272 163
254 3300005338 Ga0068868_100032630 Ga0068868_1000326305 163
255 3300005344 Ga0070661_100737393 Ga0070661_1007373932 163
256 3300005367 Ga0070667_100096832 Ga0070667_1000968323 163
257 3300005456 Ga0070678_100319966 Ga0070678_1003199661 163
258 3300005457 Ga0070662_100648678 Ga0070662_1006486782 163
259 3300005459 Ga0068867_100255701 Ga0068867_1002557012 163
260 3300005466 Ga0070685_10492122 Ga0070685_104921221 163
261 3300005535 Ga0070684_100853427 Ga0070684_1008534271 163
262 3300005539 Ga0068853_100187231 Ga0068853_1001872313 163
263 3300005539 Ga0068853_100510963 Ga0068853_1005109631 163
264 3300005543 Ga0070672_100367629 Ga0070672_1003676292 163
265 3300005543 Ga0070672_100684367 Ga0070672_1006843672 163
266 3300005563 Ga0068855_100636182 Ga0068855_1006361822 163
267 3300005618 Ga0068864_100219646 Ga0068864_1002196462 163
268 3300005718 Ga0068866_10011825 Ga0068866_100118254 163
269 3300005841 Ga0068863_100120127 Ga0068863_1001201273 163
270 3300005842 Ga0068858_100402531 Ga0068858_1004025312 163
271 3300006237 Ga0097621_100003774 Ga0097621_10000377410 163
272 3300006237 Ga0097621_100012880 Ga0097621_1000128804 163
273 3300006237 Ga0097621_100575677 Ga0097621_1005756772 163
274 3300006358 Ga0068871_100006775 Ga0068871_1000067757 163
275 3300006358 Ga0068871_100022320 Ga0068871_1000223205 163
276 3300006358 Ga0068871_100255396 Ga0068871_1002553962 163
277 3300006881 Ga0068865_100124631 Ga0068865_1001246311 163
278 3300009148 Ga0105243_11023313 Ga0105243_110233132 163
279 3300009176 Ga0105242_10742280 Ga0105242_107422802 163
280 3300009177 Ga0105248_10041649 Ga0105248_100416495 163
281 3300009553 Ga0105249_10666018 Ga0105249_106660182 163
282 3300013104 Ga0157370_11254097 Ga0157370_112540971 163
283 3300013297 Ga0157378_10016148 Ga0157378_100161485 163
284 3300013297 Ga0157378_10018304 Ga0157378_100183047 163
285 3300013297 Ga0157378_10022739 Ga0157378_100227397 163
286 3300013306 Ga0163162_10007565 Ga0163162_100075654 163
287 3300013306 Ga0163162_10112032 Ga0163162_101120324 163
288 3300013306 Ga0163162_10860443 Ga0163162_108604432 163
289 3300013306 Ga0163162_11172681 Ga0163162_111726812 163
290 3300013308 Ga0157375_10000422 Ga0157375_1000042218 163
291 3300013308 Ga0157375_10276259 Ga0157375_102762593 163
292 3300014325 Ga0163163_10001496 Ga0163163_100014964 163
293 3300014968 Ga0157379_10063070 Ga0157379_100630705 163
294 3300014969 Ga0157376_10000878 Ga0157376_1000087812 163
295 3300025909 Ga0207705_10457076 Ga0207705_104570762 163
296 3300025921 Ga0207652_11072676 Ga0207652_110726761 163
297 3300025925 Ga0207650_10111179 Ga0207650_101111794 163
298 3300025931 Ga0207644_10026095 Ga0207644_100260953 163
299 3300025933 Ga0207706_10663319 Ga0207706_106633192 163
300 3300025934 Ga0207686_10481192 Ga0207686_104811922 163
301 3300025935 Ga0207709_10892002 Ga0207709_108920021 163
302 3300025938 Ga0207704_10079764 Ga0207704_100797642 163
303 3300025940 Ga0207691_10605835 Ga0207691_106058352 163
304 3300025942 Ga0207689_10071735 Ga0207689_100717353 163
305 3300025949 Ga0207667_10887639 Ga0207667_108876391 163
306 3300025949 Ga0207667_11674936 Ga0207667_116749361 163
307 3300025986 Ga0207658_10032393 Ga0207658_100323935 163
308 3300026035 Ga0207703_10991660 Ga0207703_109916602 163
309 3300026041 Ga0207639_10134878 Ga0207639_101348783 163
310 3300026088 Ga0207641_10041325 Ga0207641_100413255 163
311 3300026089 Ga0207648_10148231 Ga0207648_101482314 163
312 3300026089 Ga0207648_10257810 Ga0207648_102578102 163
313 3300026095 Ga0207676_10208731 Ga0207676_102087312 163
314 3300026118 Ga0207675_100152841 Ga0207675_1001528413 163
315 3300026121 Ga0207683_10183495 Ga0207683_101834953 163
316 3300026121 Ga0207683_10799832 Ga0207683_107998322 163
317 3300026142 Ga0207698_10341863 Ga0207698_103418632 163
318 3300028381 Ga0268264_10057818 Ga0268264_100578183 163
319 3300030521 Ga0307511_10000409 Ga0307511_1000040919 163
320 3300031730 Ga0307516_10207042 Ga0307516_102070422 163
321 3300032005 Ga0307411_10395724 Ga0307411_103957242 163
322 3300041443 Ga0451789_1050343 Ga0451789_1050343_84_593 163
323 3300041512 Ga0451853_3360408 Ga0451853_3360408_38_562 163
324 3300042015 Ga0439462_0021726 Ga0439462_0021726_148_651 163
325 3300042876 Ga0451577_0010558 Ga0451577_0010558_8237_8737 163
326 3300044672 Ga0466982_0079428 Ga0466982_0079428_979_1491 163
327 3300044712 Ga0453684_0940730 Ga0453684_0940730_46_546 163
328 3300046558 Ga0495633_0320087 Ga0495633_0320087_165_656 163
329 3300047318 Ga0495636_0000370 Ga0495636_0000370_8334_8825 163
330 3300048904 Ga0496101_0204278 Ga0496101_0204278_486_1001 163
331 3300048905 Ga0496102_0093102 Ga0496102_0093102_1928_2443 163
332 3300048907 Ga0496104_0033571 Ga0496104_0033571_2674_3189 163
333 3300048909 Ga0496106_0340408 Ga0496106_0340408_234_749 163
334 3300048912 Ga0496109_0748433 Ga0496109_0748433_280_807 163
335 3300048917 Ga0496114_0026355 Ga0496114_0026355_3171_3686 163
336 3300049571 Ga0501034_0055343 Ga0501034_0055343_2296_2808 163
337 3300049571 Ga0501034_0374768 Ga0501034_0374768_46_564 163
338 3300049573 Ga0501037_0802988 Ga0501037_0802988_35_556 163
339 3300049579 Ga0501043_0166061 Ga0501043_0166061_753_1271 163
340 3300049579 Ga0501043_0221867 Ga0501043_0221867_838_1347 163
341 3300049593 Ga0501077_0048144 Ga0501077_0048144_179_688 163
342 3300049703 Ga0501219_000277 Ga0501219_000277_1286_1789 163
343 3300049705 Ga0501225_0124192 Ga0501225_0124192_13_516 163
344 3300049742 Ga0501080_0952707 Ga0501080_0952707_52_564 163
345 3300049822 Ga0501035_0069976 Ga0501035_0069976_1648_2157 163
346 3300049822 Ga0501035_0092426 Ga0501035_0092426_1144_1653 163
347 3300049823 Ga0501044_0000396 Ga0501044_0000396_37651_38160 163
348 3300049823 Ga0501044_0029505 Ga0501044_0029505_3570_4082 163
349 3300049823 Ga0501044_0091922 Ga0501044_0091922_41_553 163
350 3300049823 Ga0501044_0246133 Ga0501044_0246133_451_969 163
351 3300050005 Ga0501284_00001 Ga0501284_00001_64811_65314 163
352 3300053139 Ga0500568_0000974 Ga0500568_0000974_3412_3936 163
353 3300046616 Ga0495668_0126814 Ga0495668_0126814_688_1188 164
354 3300001904 JGI24736J21556_1018653 JGI24736J21556_10186531 166
355 3300005548 Ga0070665_100001763 Ga0070665_10000176326 166
356 3300009093 Ga0105240_10000066 Ga0105240_10000066162 166
357 3300009093 Ga0105240_10100095 Ga0105240_101000952 166
358 3300009545 Ga0105237_10082921 Ga0105237_100829213 166
359 3300009545 Ga0105237_10374767 Ga0105237_103747672 166
360 3300010375 Ga0105239_10000876 Ga0105239_1000087626 166
361 3300010375 Ga0105239_10035277 Ga0105239_100352774 166
362 3300013296 Ga0157374_11923973 Ga0157374_119239731 166
363 3300025904 Ga0207647_10004256 Ga0207647_100042566 166
364 3300025913 Ga0207695_10000078 Ga0207695_1000007885 166
365 3300025913 Ga0207695_10012743 Ga0207695_100127437 166
366 3300025914 Ga0207671_10000067 Ga0207671_1000006777 166
367 3300025924 Ga0207694_10194675 Ga0207694_101946753 166
368 3300025924 Ga0207694_10804776 Ga0207694_108047762 166
369 3300028379 Ga0268266_10012841 Ga0268266_100128419 166
370 3300028800 Ga0265338_10040332 Ga0265338_100403323 166
371 3300029957 Ga0265324_10030788 Ga0265324_100307884 166
372 3300013105 Ga0157369_10360722 Ga0157369_103607221 167
373 3300013307 Ga0157372_10044212 Ga0157372_100442124 167
374 3300031711 Ga0265314_10054592 Ga0265314_100545922 167
375 3300032004 Ga0307414_10080157 Ga0307414_100801572 167
376 3300039437 Ga0436365_1761111 Ga0436365_1761111_201_719 167
377 2162886007 SwRhRL2b_contig_1762462 SwRhRL2b_0592.00003570 168
378 3300003323 rootH1_10126130 rootH1_101261302 168
379 3300003323 rootH1_10205224 rootH1_102052243 168
380 3300005289 Ga0065704_10000188 Ga0065704_10000188166 168
381 3300005539 Ga0068853_100665925 Ga0068853_1006659251 168
382 3300031251 Ga0265327_10065119 Ga0265327_100651192 168
383 3300044765 Ga0466970_0025649 Ga0466970_0025649_2040_2552 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

38

108

0.95

PF23451

143

194

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.8835 8 104
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.8636 8 99
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.8509 8 104
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.8251 8 104
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.8206 8 99
ID Description Score Start End Superfamily
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9214 17 104 3.30.300.130
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9123 8 105 3.30.300.130
af_O53157_4_110_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9055 8 105 3.30.300.130
3lnoB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8849 8 104 3.30.300.130
af_Q5AH78_81_186_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8822 5 90 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A7C4I9R1-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9602 5 107
AF-A0A2E0D466-F1-model_v4 deleted 0.9596 5 104
AF-A0A831R2I8-F1-model_v4 DUF59 domain-containing protein 0.9594 4 108
AF-A0A7C4U3U0-F1-model_v4 DUF59 domain-containing protein 0.9581 1 100
AF-A0A1V6B8U7-F1-model_v4 Putative 1,2-phenylacetyl-CoA epoxidase, subunit D 0.9537 8 168

Feature Viewer

pLDDT pTM Quality
89.1 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map