F429574

General Info

Members Datasets Scaffolds Average Seq Length
383 200 382 174

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_11113984|Ga0105245_111139842
Length 205
Sequence MAFPGGHDLFYDRWNSDGKFYPAIHFASLIFYMEKIAVKNSFVEKLNTDFEVRSLDSVCINTSVLKHPWWYNIKYMVAGLLFGIVLVKTEVISWFRIQEMFRFQSFHMYGVIGSAVLTAMMSVWLIKKFRIKTIYGEPIQLYKIRFSKGQVYGGLLFGFGWAMTGACPGPLFALIGSGTTVIIVTLLSAIAGTWVYGFFREKLPH

Samples

Sample ID Description Type Environment
1 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
152 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
153 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
162 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
175 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
176 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
177 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
178 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
179 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
180 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
181 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
182 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
183 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
184 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
185 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
186 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
191 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 1.83
Rhizosphere 96.08
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10063451 3300001979 Bacteria 1011
2 JGI24739J22299_10194979 3300001989 Bacteria 595
3 rootH1_10009835 3300003316 Bacteria 7038
4 rootH2_10006458 3300003320 Bacteria 43676
5 rootL2_10000754 3300003322 Bacteria 26954
6 rootL2_10036669 3300003322 Bacteria 7308
7 rootH1_10058710 3300003323 Bacteria 7475
8 Ga0065707_10419862 3300005295 Bacteria 832
9 Ga0070658_10414749 3300005327 Bacteria 1158
10 Ga0070683_100037080 3300005329 Bacteria 4462
11 Ga0070690_100006178 3300005330 Bacteria 6789
12 Ga0070690_100265718 3300005330 Bacteria 1218
13 Ga0070690_100508933 3300005330 Bacteria 902
14 Ga0070670_100661039 3300005331 Bacteria 938
15 Ga0070670_100863889 3300005331 Bacteria 819
16 Ga0070677_10286641 3300005333 Bacteria 831
17 Ga0068869_100351803 3300005334 Bacteria 1201
18 Ga0068869_100511263 3300005334 Bacteria 1004
19 Ga0070666_10296571 3300005335 Bacteria 1151
20 Ga0070680_100031043 3300005336 Bacteria 4294
21 Ga0070680_100046989 3300005336 Bacteria 3514
22 Ga0070682_100009363 3300005337 Bacteria 5543
23 Ga0070682_100013579 3300005337 Bacteria 4690
24 Ga0070682_100014253 3300005337 Bacteria 4591
25 Ga0068868_100207335 3300005338 Bacteria 1636
26 Ga0070660_100004412 3300005339 Bacteria 9720
27 Ga0070660_100064628 3300005339 Bacteria 2847
28 Ga0070689_101055630 3300005340 Bacteria 725
29 Ga0070687_101062555 3300005343 Bacteria 590
30 Ga0070661_100001789 3300005344 Bacteria 14905
31 Ga0070661_100004634 3300005344 Bacteria 9465
32 Ga0070661_100048891 3300005344 Bacteria 3096
33 Ga0070661_100998057 3300005344 Bacteria 694
34 Ga0070675_100158312 3300005354 Unclassified 1946
35 Ga0070671_100010628 3300005355 Bacteria 7387
36 Ga0070671_100069613 3300005355 Bacteria 2935
37 Ga0070674_100394612 3300005356 Unclassified 1129
38 Ga0070673_100039342 3300005364 Bacteria 3618
39 Ga0070673_100042101 3300005364 Unclassified 3519
40 Ga0070673_100389942 3300005364 Unclassified 1243
41 Ga0070688_100257810 3300005365 Bacteria 1244
42 Ga0070659_100013067 3300005366 Bacteria 6174
43 Ga0070659_100042454 3300005366 Bacteria 3555
44 Ga0070667_100014521 3300005367 Bacteria 6508
45 Ga0070667_100030532 3300005367 Bacteria 4495
46 Ga0070667_100373633 3300005367 Bacteria 1294
47 Ga0070700_100151680 3300005441 Bacteria 1586
48 Ga0070663_100069411 3300005455 Bacteria 2560
49 Ga0070663_100735425 3300005455 Bacteria 841
50 Ga0070678_100150260 3300005456 Bacteria 1876
51 Ga0070678_100262463 3300005456 Bacteria 1453
52 Ga0070678_100837903 3300005456 Bacteria 837
53 Ga0070662_100009217 3300005457 Bacteria 6444
54 Ga0070681_10097313 3300005458 Bacteria 2890
55 Ga0068867_100006192 3300005459 Bacteria 8472
56 Ga0070698_100003376 3300005471 Bacteria 17567
57 Ga0070698_100021248 3300005471 Bacteria 6800
58 Ga0070679_100002484 3300005530 Bacteria 16709
59 Ga0070679_100018388 3300005530 Bacteria 6782
60 Ga0070679_100056526 3300005530 Bacteria 3909
61 Ga0070684_100002013 3300005535 Bacteria 14950
62 Ga0070684_100089183 3300005535 Bacteria 2741
63 Ga0068853_100004150 3300005539 Bacteria 11165
64 Ga0068853_100005673 3300005539 Bacteria 9817
65 Ga0068853_100018118 3300005539 Bacteria 5823
66 Ga0068853_100675932 3300005539 Bacteria 984
67 Ga0070672_100202201 3300005543 Bacteria 1661
68 Ga0070672_100250048 3300005543 Unclassified 1493
69 Ga0070672_100447673 3300005543 Bacteria 1112
70 Ga0070686_100075539 3300005544 Bacteria 2217
71 Ga0070696_100162323 3300005546 Bacteria 1647
72 Ga0068855_100003326 3300005563 Bacteria 19674
73 Ga0068855_100028805 3300005563 Bacteria 6644
74 Ga0068855_100170342 3300005563 Bacteria 2466
75 Ga0070664_100001372 3300005564 Bacteria 19398
76 Ga0070664_100044684 3300005564 Bacteria 3740
77 Ga0070664_100587635 3300005564 Bacteria 1032
78 Ga0070664_100672077 3300005564 Bacteria 963
79 Ga0068857_100004400 3300005577 Bacteria 11908
80 Ga0068857_100039098 3300005577 Bacteria 4201
81 Ga0068857_100045383 3300005577 Bacteria 3898
82 Ga0068857_100813281 3300005577 Bacteria 893
83 Ga0068854_100029824 3300005578 Bacteria 3780
84 Ga0068854_100045718 3300005578 Bacteria 3114
85 Ga0068854_100100397 3300005578 Bacteria 2169
86 Ga0068854_100142962 3300005578 Unclassified 1838
87 Ga0068856_100006123 3300005614 Bacteria 11807
88 Ga0068856_100078045 3300005614 Bacteria 3282
89 Ga0068856_101753828 3300005614 Unclassified 633
90 Ga0070702_100017895 3300005615 Bacteria 3665
91 Ga0070702_100181934 3300005615 Bacteria 1376
92 Ga0068852_100001619 3300005616 Bacteria 15360
93 Ga0068852_100287205 3300005616 Unclassified 1588
94 Ga0068852_100487094 3300005616 Bacteria 1226
95 Ga0068852_100620423 3300005616 Unclassified 1087
96 Ga0068859_100032545 3300005617 Bacteria 5238
97 Ga0068859_100390294 3300005617 Bacteria 1488
98 Ga0068859_101096643 3300005617 Bacteria 876
99 Ga0068864_100046362 3300005618 Bacteria 3729
100 Ga0068864_100241467 3300005618 Unclassified 1674
101 Ga0068864_100256917 3300005618 Bacteria 1624
102 Ga0068866_10114840 3300005718 Bacteria 1508
103 Ga0068866_10641672 3300005718 Bacteria 722
104 Ga0068861_100157416 3300005719 Bacteria 1870
105 Ga0068870_10075134 3300005840 Bacteria 1853
106 Ga0068863_100053143 3300005841 Bacteria 3839
107 Ga0068863_100136626 3300005841 Bacteria 2342
108 Ga0068863_100569932 3300005841 Bacteria 1119
109 Ga0068863_100922189 3300005841 Unclassified 874
110 Ga0068858_101865388 3300005842 Bacteria 594
111 Ga0068860_100540090 3300005843 Bacteria 1167
112 Ga0068862_100108417 3300005844 Bacteria 2436
113 Ga0097621_100000559 3300006237 Bacteria 26141
114 Ga0097621_100039286 3300006237 Bacteria 3801
115 Ga0097621_100111047 3300006237 Bacteria 2316
116 Ga0068871_100002443 3300006358 Bacteria 12694
117 Ga0068871_100003509 3300006358 Bacteria 10795
118 Ga0068871_100060052 3300006358 Bacteria 3100
119 Ga0068871_100154777 3300006358 Bacteria 1957
120 Ga0068871_100433324 3300006358 Bacteria 1176
121 Ga0068871_101060307 3300006358 Unclassified 757
122 Ga0075428_100004788 3300006844 Bacteria 14994
123 Ga0075428_100130388 3300006844 Bacteria 2735
124 Ga0075428_100600757 3300006844 Bacteria 1175
125 Ga0075430_100668577 3300006846 Bacteria 856
126 Ga0075431_100375182 3300006847 Bacteria 1427
127 Ga0075429_100004456 3300006880 Bacteria 12047
128 Ga0068865_100072125 3300006881 Bacteria 2452
129 Ga0097620_100032545 3300006931 Bacteria 5238
130 Ga0097620_100390327 3300006931 Bacteria 1488
131 Ga0097620_101096678 3300006931 Bacteria 876
132 Ga0105251_10098997 3300009011 Unclassified 1334
133 Ga0105240_10026778 3300009093 Bacteria 7562
134 Ga0105240_10081372 3300009093 Unclassified 3980
135 Ga0105240_11194774 3300009093 Bacteria 806
136 Ga0111539_10197493 3300009094 Unclassified 2346
137 Ga0105245_11113984 3300009098 Bacteria 836
138 Ga0105247_10514661 3300009101 Unclassified 874
139 Ga0114129_10086243 3300009147 Bacteria 4355
140 Ga0105243_10685738 3300009148 Bacteria 997
141 Ga0105241_10391674 3300009174 Bacteria 1217
142 Ga0105241_10462964 3300009174 Bacteria 1124
143 Ga0105242_10026160 3300009176 Bacteria 4624
144 Ga0105242_10086830 3300009176 Bacteria 2626
145 Ga0105242_10121100 3300009176 Bacteria 2245
146 Ga0105242_10289110 3300009176 Bacteria 1492
147 Ga0105248_10005347 3300009177 Bacteria 14131
148 Ga0105237_10237855 3300009545 Bacteria 1822
149 Ga0105249_10014757 3300009553 Bacteria 6905
150 Ga0105249_10016590 3300009553 Bacteria 6536
151 Ga0105249_10167869 3300009553 Bacteria 2126
152 Ga0105249_10222949 3300009553 Bacteria 1856
153 Ga0105249_10428509 3300009553 Bacteria 1358
154 Ga0105249_11059494 3300009553 Unclassified 880
155 Ga0105249_12652403 3300009553 Bacteria 573
156 Ga0105239_10145871 3300010375 Bacteria 2639
157 Ga0105239_10751509 3300010375 Bacteria 1116
158 Ga0105239_10772687 3300010375 Bacteria 1100
159 Ga0105239_11012918 3300010375 Bacteria 955
160 Ga0105246_10596990 3300011119 Unclassified 953
161 Ga0105246_10755716 3300011119 Bacteria 858
162 Ga0157373_10003498 3300013100 Bacteria 11878
163 Ga0157373_10006801 3300013100 Bacteria 8520
164 Ga0157371_10013542 3300013102 Bacteria 6191
165 Ga0157371_10512644 3300013102 Bacteria 886
166 Ga0157370_10002557 3300013104 Bacteria 21831
167 Ga0157370_10096433 3300013104 Bacteria 2775
168 Ga0157370_10251796 3300013104 Bacteria 1633
169 Ga0157370_10284997 3300013104 Bacteria 1526
170 Ga0157370_10388136 3300013104 Bacteria 1286
171 Ga0157369_10004629 3300013105 Bacteria 16161
172 Ga0157369_10010208 3300013105 Bacteria 10716
173 Ga0157369_10054343 3300013105 Bacteria 4325
174 Ga0157369_10124114 3300013105 Bacteria 2739
175 Ga0157369_10201967 3300013105 Bacteria 2086
176 Ga0157369_11808386 3300013105 Bacteria 620
177 Ga0157374_10009869 3300013296 Bacteria 8195
178 Ga0157374_10903987 3300013296 Unclassified 900
179 Ga0157378_10004027 3300013297 Bacteria 12977
180 Ga0157378_10018492 3300013297 Bacteria 6123
181 Ga0157378_10292060 3300013297 Unclassified 1575
182 Ga0163162_10000761 3300013306 Bacteria 29992
183 Ga0163162_10014894 3300013306 Bacteria 7593
184 Ga0163162_10050100 3300013306 Bacteria 4187
185 Ga0163162_10165994 3300013306 Bacteria 2332
186 Ga0163162_10167669 3300013306 Bacteria 2320
187 Ga0163162_10356541 3300013306 Unclassified 1595
188 Ga0163162_10759004 3300013306 Bacteria 1089
189 Ga0157372_10077127 3300013307 Bacteria 3763
190 Ga0157372_10080626 3300013307 Bacteria 3683
191 Ga0157372_10462895 3300013307 Bacteria 1478
192 Ga0157372_10471233 3300013307 Bacteria 1464
193 Ga0157372_10809798 3300013307 Bacteria 1088
194 Ga0157372_11102708 3300013307 Bacteria 918
195 Ga0157375_10000067 3300013308 Bacteria 110313
196 Ga0157375_10012111 3300013308 Bacteria 7642
197 Ga0157375_10143555 3300013308 Bacteria 2516
198 Ga0157375_10160070 3300013308 Bacteria 2392
199 Ga0163163_10040248 3300014325 Bacteria 4564
200 Ga0163163_10060020 3300014325 Bacteria 3764
201 Ga0163163_10280054 3300014325 Bacteria 1719
202 Ga0163163_11781827 3300014325 Unclassified 676
203 Ga0157380_10001827 3300014326 Bacteria 14062
204 Ga0157377_10056326 3300014745 Bacteria 2232
205 Ga0157377_10145637 3300014745 Bacteria 1460
206 Ga0157379_10070781 3300014968 Bacteria 3121
207 Ga0157379_10085325 3300014968 Unclassified 2830
208 Ga0157379_10178692 3300014968 Bacteria 1917
209 Ga0157379_11055331 3300014968 Bacteria 777
210 Ga0157376_10000165 3300014969 Bacteria 46348
211 Ga0157376_10028816 3300014969 Unclassified 4417
212 Ga0157376_10728135 3300014969 Bacteria 999
213 Ga0157376_11276032 3300014969 Bacteria 764
214 Ga0163161_10002761 3300017792 Bacteria 12483
215 Ga0163161_10003712 3300017792 Bacteria 10697
216 Ga0163161_10094520 3300017792 Bacteria 2216
217 Ga0163161_10155904 3300017792 Bacteria 1738
218 Ga0163161_10245525 3300017792 Bacteria 1394
219 Ga0163161_10306510 3300017792 Bacteria 1252
220 Ga0207697_10088801 3300025315 Bacteria 1308
221 Ga0207656_10219981 3300025321 Bacteria 923
222 Ga0207642_10118379 3300025899 Bacteria 1362
223 Ga0207642_10161402 3300025899 Bacteria 1204
224 Ga0207688_10029833 3300025901 Bacteria 3006
225 Ga0207680_10100252 3300025903 Bacteria 1859
226 Ga0207680_10417306 3300025903 Unclassified 950
227 Ga0207647_10062232 3300025904 Bacteria 2274
228 Ga0207645_10107936 3300025907 Bacteria 1801
229 Ga0207643_10180936 3300025908 Bacteria 1276
230 Ga0207705_10037534 3300025909 Bacteria 3467
231 Ga0207705_10041161 3300025909 Bacteria 3314
232 Ga0207705_10087346 3300025909 Bacteria 2280
233 Ga0207695_10011532 3300025913 Bacteria 10695
234 Ga0207695_10297566 3300025913 Bacteria 1505
235 Ga0207695_10976997 3300025913 Unclassified 726
236 Ga0207671_10236872 3300025914 Unclassified 1433
237 Ga0207660_10069977 3300025917 Bacteria 2550
238 Ga0207660_10193566 3300025917 Bacteria 1585
239 Ga0207660_10407139 3300025917 Bacteria 1096
240 Ga0207660_10843338 3300025917 Bacteria 748
241 Ga0207657_10028321 3300025919 Bacteria 5112
242 Ga0207657_10040973 3300025919 Bacteria 4099
243 Ga0207649_10002808 3300025920 Bacteria 9610
244 Ga0207649_10011562 3300025920 Bacteria 4870
245 Ga0207649_10195313 3300025920 Bacteria 1426
246 Ga0207652_10002120 3300025921 Bacteria 17031
247 Ga0207652_10213149 3300025921 Bacteria 1739
248 Ga0207681_10136557 3300025923 Bacteria 1821
249 Ga0207681_10812618 3300025923 Bacteria 781
250 Ga0207650_10008460 3300025925 Bacteria 7025
251 Ga0207650_10039614 3300025925 Bacteria 3443
252 Ga0207650_10243578 3300025925 Bacteria 1454
253 Ga0207650_10551265 3300025925 Bacteria 967
254 Ga0207650_10654141 3300025925 Bacteria 886
255 Ga0207659_10158357 3300025926 Bacteria 1775
256 Ga0207644_10022748 3300025931 Bacteria 4285
257 Ga0207690_10042213 3300025932 Bacteria 2994
258 Ga0207690_10226757 3300025932 Bacteria 1432
259 Ga0207706_10003683 3300025933 Bacteria 14626
260 Ga0207706_10016096 3300025933 Bacteria 6757
261 Ga0207686_10002586 3300025934 Bacteria 9824
262 Ga0207686_10032518 3300025934 Bacteria 3105
263 Ga0207686_10768240 3300025934 Bacteria 770
264 Ga0207704_10446790 3300025938 Bacteria 1031
265 Ga0207691_10032646 3300025940 Unclassified 4853
266 Ga0207711_10008182 3300025941 Bacteria 8756
267 Ga0207689_10003117 3300025942 Bacteria 15212
268 Ga0207689_10073751 3300025942 Unclassified 2804
269 Ga0207689_10390011 3300025942 Bacteria 1160
270 Ga0207661_10025445 3300025944 Bacteria 4499
271 Ga0207661_10121796 3300025944 Bacteria 2221
272 Ga0207679_10005252 3300025945 Bacteria 8117
273 Ga0207679_10020901 3300025945 Bacteria 4427
274 Ga0207679_10372593 3300025945 Unclassified 1250
275 Ga0207679_10518276 3300025945 Bacteria 1066
276 Ga0207667_10005433 3300025949 Bacteria 15535
277 Ga0207667_10166458 3300025949 Bacteria 2266
278 Ga0207651_10271159 3300025960 Unclassified 1398
279 Ga0207651_10278863 3300025960 Bacteria 1380
280 Ga0207712_10006689 3300025961 Bacteria 7268
281 Ga0207712_10231739 3300025961 Bacteria 1483
282 Ga0207640_10118949 3300025981 Bacteria 1888
283 Ga0207658_10129523 3300025986 Bacteria 2025
284 Ga0207658_10865768 3300025986 Unclassified 822
285 Ga0207677_10499677 3300026023 Bacteria 1051
286 Ga0207639_10012810 3300026041 Bacteria 5852
287 Ga0207639_10022547 3300026041 Bacteria 4536
288 Ga0207639_10234350 3300026041 Bacteria 1593
289 Ga0207639_10395428 3300026041 Bacteria 1244
290 Ga0207678_10086012 3300026067 Bacteria 2687
291 Ga0207708_10275489 3300026075 Bacteria 1362
292 Ga0207702_10031027 3300026078 Bacteria 4455
293 Ga0207702_10078690 3300026078 Bacteria 2855
294 Ga0207702_10298727 3300026078 Bacteria 1528
295 Ga0207702_11634624 3300026078 Bacteria 637
296 Ga0207641_10017818 3300026088 Bacteria 5819
297 Ga0207641_10054919 3300026088 Bacteria 3382
298 Ga0207641_10883821 3300026088 Unclassified 887
299 Ga0207648_10204711 3300026089 Bacteria 1751
300 Ga0207648_10361959 3300026089 Unclassified 1309
301 Ga0207676_10038234 3300026095 Bacteria 3661
302 Ga0207676_10128154 3300026095 Bacteria 2153
303 Ga0207674_10001740 3300026116 Bacteria 27826
304 Ga0207674_10063998 3300026116 Bacteria 3710
305 Ga0207674_10156378 3300026116 Unclassified 2235
306 Ga0207675_100074357 3300026118 Bacteria 3179
307 Ga0207683_10469939 3300026121 Bacteria 1160
308 Ga0207698_10003838 3300026142 Bacteria 9098
309 Ga0207698_10171169 3300026142 Bacteria 1912
310 Ga0207698_10253091 3300026142 Unclassified 1613
311 Ga0207698_10835141 3300026142 Unclassified 925
312 Ga0207428_10226013 3300027907 Bacteria 1402
313 Ga0268265_10088868 3300028380 Bacteria 2463
314 Ga0268265_10145403 3300028380 Unclassified 1991
315 Ga0268264_10038122 3300028381 Bacteria 3965
316 Ga0268264_10090546 3300028381 Bacteria 2637
317 Ga0268264_10479417 3300028381 Bacteria 1210
318 Ga0307516_10405620 3300031730 Bacteria 1022
319 Ga0307414_11833006 3300032004 Unclassified 566
320 Ga0307411_10210177 3300032005 Bacteria 1502
321 Ga0395899_0008250 3300037312 Bacteria 8024
322 Ga0395900_0100020 3300037418 Bacteria 2978
323 Ga0395898_0008380 3300037466 Bacteria 10932
324 Ga0395901_0005031 3300038443 Bacteria 13348
325 Ga0451800_0038765 3300041459 Unclassified 804
326 Ga0451800_0928796 3300041459 Bacteria 1083
327 Ga0451849_0513228 3300041505 Bacteria 731
328 Ga0450923_075462 3300042125 Bacteria 752
329 Ga0453683_0100130 3300044673 Bacteria 1819
330 Ga0453684_0040792 3300044712 Bacteria 6295
331 Ga0495650_0015595 3300046471 Bacteria 3890
332 Ga0495676_0077529 3300047321 Bacteria 2534
333 Ga0496100_0385302 3300048903 Unclassified 1065
334 Ga0496100_0540493 3300048903 Bacteria 901
335 Ga0496104_0362561 3300048907 Bacteria 1362
336 Ga0496104_0581973 3300048907 Bacteria 1030
337 Ga0496114_0050594 3300048917 Bacteria 3459
338 Ga0501297_004706 3300049520 Bacteria 1405
339 Ga0501300_001916 3300049523 Bacteria 3110
340 Ga0501031_0657040 3300049568 Bacteria 674
341 Ga0501034_0062004 3300049571 Bacteria 3754
342 Ga0501037_0121488 3300049573 Unclassified 1878
343 Ga0501042_0086284 3300049578 Bacteria 2251
344 Ga0501043_0461858 3300049579 Bacteria 952
345 Ga0501046_0001780 3300049580 Bacteria 20573
346 Ga0501047_0181101 3300049581 Unclassified 1973
347 Ga0501048_0085003 3300049582 Bacteria 2231
348 Ga0501067_0032166 3300049583 Bacteria 2912
349 Ga0501068_0442976 3300049584 Bacteria 840
350 Ga0501072_0030099 3300049588 Bacteria 4244
351 Ga0501207_062586 3300049654 Unclassified 685
352 Ga0501217_000395 3300049661 Bacteria 7038
353 Ga0501217_018876 3300049661 Bacteria 1605
354 Ga0501223_004780 3300049663 Bacteria 2882
355 Ga0501224_004067 3300049664 Bacteria 2060
356 Ga0501235_005903 3300049669 Bacteria 2665
357 Ga0501242_038073 3300049674 Unclassified 672
358 Ga0501243_001151 3300049675 Bacteria 3761
359 Ga0501246_007348 3300049676 Bacteria 959
360 Ga0501257_017339 3300049686 Bacteria 1674
361 Ga0501259_001452 3300049688 Bacteria 3944
362 Ga0501259_002209 3300049688 Bacteria 3189
363 Ga0501261_007129 3300049690 Bacteria 1432
364 Ga0501221_001295 3300049704 Bacteria 4134
365 Ga0501221_003120 3300049704 Bacteria 2724
366 Ga0501225_0026606 3300049705 Bacteria 1590
367 Ga0501225_0040972 3300049705 Bacteria 1277
368 Ga0501079_0311036 3300049741 Bacteria 1233
369 Ga0501080_0343060 3300049742 Bacteria 1349
370 Ga0501083_0004260 3300049744 Bacteria 10070
371 Ga0501264_004471 3300049761 Bacteria 1268
372 Ga0501280_006926 3300049776 Bacteria 1592
373 Ga0501044_0048035 3300049823 Bacteria 4411
374 nmdc:mga09592_29508_c1 3300050508 Bacteria 4561
375 nmdc:mga0qj67_65235_c1 3300050509 Bacteria 2898
376 nmdc:mga06r32_333630_c1 3300050510 Bacteria 1501
377 nmdc:mga08y16_208530_c1 3300050511 Bacteria 2024
378 nmdc:mga08y16_247460_c1 3300050511 Bacteria 1842
379 nmdc:mga08x19_348705_c1 3300050514 Bacteria 1033
380 Ga0500622_0000328 3300053156 Bacteria 47220
381 Ga0501084_0442230 3300054114 Bacteria 1099
382 Ga0501082_0394106 3300060353 Bacteria 1208

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10284997 Ga0157370_102849973 161
2 3300003316 rootH1_10009835 rootH1_100098355 162
3 3300003320 rootH2_10006458 rootH2_100064583 162
4 3300003322 rootL2_10000754 rootL2_100007545 162
5 3300003323 rootH1_10058710 rootH1_100587103 162
6 3300005331 Ga0070670_100661039 Ga0070670_1006610391 164
7 3300005334 Ga0068869_100351803 Ga0068869_1003518032 164
8 3300005459 Ga0068867_100006192 Ga0068867_1000061927 164
9 3300005616 Ga0068852_100487094 Ga0068852_1004870942 164
10 3300010375 Ga0105239_10145871 Ga0105239_101458713 164
11 3300013306 Ga0163162_10165994 Ga0163162_101659944 164
12 3300025942 Ga0207689_10390011 Ga0207689_103900112 164
13 3300026095 Ga0207676_10128154 Ga0207676_101281543 164
14 3300032005 Ga0307411_10210177 Ga0307411_102101773 164
15 3300049688 Ga0501259_002209 Ga0501259_002209_132_632 164
16 3300049705 Ga0501225_0040972 Ga0501225_0040972_405_905 164
17 3300053156 Ga0500622_0000328 Ga0500622_0000328_26978_27475 164
18 3300049571 Ga0501034_0062004 Ga0501034_0062004_1630_2127 165
19 3300005616 Ga0068852_100620423 Ga0068852_1006204232 167
20 iso_pu_bacteria 2890737413 2890739460 167
21 3300009094 Ga0111539_10197493 Ga0111539_101974933 169
22 3300050511 nmdc:mga08y16_208530_c1 nmdc:mga08y16_208530_c1_633_1145 169
23 3300003322 rootL2_10036669 rootL2_100366697 170
24 3300005367 Ga0070667_100014521 Ga0070667_1000145214 170
25 3300005618 Ga0068864_100241467 Ga0068864_1002414672 170
26 3300006844 Ga0075428_100004788 Ga0075428_10000478814 170
27 3300006844 Ga0075428_100130388 Ga0075428_1001303883 170
28 3300006846 Ga0075430_100668577 Ga0075430_1006685772 170
29 3300006847 Ga0075431_100375182 Ga0075431_1003751822 170
30 3300006880 Ga0075429_100004456 Ga0075429_1000044567 170
31 3300009011 Ga0105251_10098997 Ga0105251_100989971 170
32 3300009553 Ga0105249_10016590 Ga0105249_100165905 170
33 3300025923 Ga0207681_10812618 Ga0207681_108126181 170
34 3300025925 Ga0207650_10243578 Ga0207650_102435781 170
35 3300025925 Ga0207650_10654141 Ga0207650_106541412 170
36 3300025986 Ga0207658_10129523 Ga0207658_101295233 170
37 3300026089 Ga0207648_10361959 Ga0207648_103619592 170
38 3300028380 Ga0268265_10145403 Ga0268265_101454032 170
39 3300028381 Ga0268264_10038122 Ga0268264_100381223 170
40 3300049520 Ga0501297_004706 Ga0501297_004706_574_1086 170
41 3300049661 Ga0501217_000395 Ga0501217_000395_1504_2016 170
42 3300049663 Ga0501223_004780 Ga0501223_004780_1771_2283 170
43 3300049664 Ga0501224_004067 Ga0501224_004067_618_1130 170
44 3300049669 Ga0501235_005903 Ga0501235_005903_43_555 170
45 3300049674 Ga0501242_038073 Ga0501242_038073_46_558 170
46 3300049675 Ga0501243_001151 Ga0501243_001151_3119_3631 170
47 3300049676 Ga0501246_007348 Ga0501246_007348_22_534 170
48 3300049688 Ga0501259_001452 Ga0501259_001452_1971_2483 170
49 3300049690 Ga0501261_007129 Ga0501261_007129_122_634 170
50 3300049704 Ga0501221_001295 Ga0501221_001295_1620_2132 170
51 3300049705 Ga0501225_0026606 Ga0501225_0026606_452_964 170
52 3300049761 Ga0501264_004471 Ga0501264_004471_399_911 170
53 3300049776 Ga0501280_006926 Ga0501280_006926_531_1043 170
54 3300050508 nmdc:mga09592_29508_c1 nmdc:mga09592_29508_c1_1605_2117 170
55 3300050509 nmdc:mga0qj67_65235_c1 nmdc:mga0qj67_65235_c1_683_1195 170
56 3300050510 nmdc:mga06r32_333630_c1 nmdc:mga06r32_333630_c1_244_756 170
57 3300005336 Ga0070680_100031043 Ga0070680_1000310435 171
58 3300005337 Ga0070682_100013579 Ga0070682_1000135794 171
59 3300005458 Ga0070681_10097313 Ga0070681_100973133 171
60 3300005530 Ga0070679_100018388 Ga0070679_1000183883 171
61 3300005535 Ga0070684_100089183 Ga0070684_1000891833 171
62 3300005539 Ga0068853_100005673 Ga0068853_1000056732 171
63 3300005563 Ga0068855_100028805 Ga0068855_1000288056 171
64 3300005578 Ga0068854_100100397 Ga0068854_1001003971 171
65 3300005614 Ga0068856_100006123 Ga0068856_1000061235 171
66 3300005616 Ga0068852_100287205 Ga0068852_1002872052 171
67 3300009093 Ga0105240_10026778 Ga0105240_100267786 171
68 3300009093 Ga0105240_11194774 Ga0105240_111947741 171
69 3300009545 Ga0105237_10237855 Ga0105237_102378552 171
70 3300013100 Ga0157373_10006801 Ga0157373_100068015 171
71 3300013102 Ga0157371_10512644 Ga0157371_105126441 171
72 3300013104 Ga0157370_10251796 Ga0157370_102517962 171
73 3300013104 Ga0157370_10388136 Ga0157370_103881362 171
74 3300013105 Ga0157369_10004629 Ga0157369_100046298 171
75 3300013105 Ga0157369_11808386 Ga0157369_118083861 171
76 3300013307 Ga0157372_10080626 Ga0157372_100806262 171
77 3300025913 Ga0207695_10011532 Ga0207695_100115327 171
78 3300025914 Ga0207671_10236872 Ga0207671_102368722 171
79 3300025917 Ga0207660_10843338 Ga0207660_108433382 171
80 3300025921 Ga0207652_10213149 Ga0207652_102131493 171
81 3300025949 Ga0207667_10005433 Ga0207667_100054338 171
82 3300026041 Ga0207639_10022547 Ga0207639_100225474 171
83 3300026078 Ga0207702_10031027 Ga0207702_100310273 171
84 3300026142 Ga0207698_10253091 Ga0207698_102530912 171
85 3300032004 Ga0307414_11833006 Ga0307414_118330061 171
86 3300049523 Ga0501300_001916 Ga0501300_001916_1100_1615 171
87 3300049654 Ga0501207_062586 Ga0501207_062586_155_670 171
88 3300049661 Ga0501217_018876 Ga0501217_018876_924_1439 171
89 3300049686 Ga0501257_017339 Ga0501257_017339_701_1216 171
90 3300049704 Ga0501221_003120 Ga0501221_003120_599_1114 171
91 3300005327 Ga0070658_10414749 Ga0070658_104147492 172
92 3300005331 Ga0070670_100863889 Ga0070670_1008638891 172
93 3300005340 Ga0070689_101055630 Ga0070689_1010556301 172
94 3300005356 Ga0070674_100394612 Ga0070674_1003946122 172
95 3300005364 Ga0070673_100042101 Ga0070673_1000421014 172
96 3300005441 Ga0070700_100151680 Ga0070700_1001516802 172
97 3300005471 Ga0070698_100003376 Ga0070698_1000033766 172
98 3300005471 Ga0070698_100021248 Ga0070698_1000212485 172
99 3300005539 Ga0068853_100675932 Ga0068853_1006759322 172
100 3300005546 Ga0070696_100162323 Ga0070696_1001623232 172
101 3300005577 Ga0068857_100813281 Ga0068857_1008132811 172
102 3300005614 Ga0068856_101753828 Ga0068856_1017538281 172
103 3300005617 Ga0068859_100032545 Ga0068859_1000325452 172
104 3300005617 Ga0068859_101096643 Ga0068859_1010966432 172
105 3300005718 Ga0068866_10641672 Ga0068866_106416721 172
106 3300005719 Ga0068861_100157416 Ga0068861_1001574163 172
107 3300005841 Ga0068863_100136626 Ga0068863_1001366263 172
108 3300005843 Ga0068860_100540090 Ga0068860_1005400902 172
109 3300005844 Ga0068862_100108417 Ga0068862_1001084173 172
110 3300006237 Ga0097621_100111047 Ga0097621_1001110472 172
111 3300006358 Ga0068871_100002443 Ga0068871_1000024435 172
112 3300006358 Ga0068871_101060307 Ga0068871_1010603071 172
113 3300006844 Ga0075428_100600757 Ga0075428_1006007571 172
114 3300006881 Ga0068865_100072125 Ga0068865_1000721252 172
115 3300006931 Ga0097620_100032545 Ga0097620_1000325452 172
116 3300006931 Ga0097620_101096678 Ga0097620_1010966781 172
117 3300009101 Ga0105247_10514661 Ga0105247_105146612 172
118 3300009147 Ga0114129_10086243 Ga0114129_100862433 172
119 3300009176 Ga0105242_10026160 Ga0105242_100261605 172
120 3300009176 Ga0105242_10121100 Ga0105242_101211002 172
121 3300009176 Ga0105242_10289110 Ga0105242_102891101 172
122 3300009553 Ga0105249_10014757 Ga0105249_100147576 172
123 3300009553 Ga0105249_10222949 Ga0105249_102229493 172
124 3300009553 Ga0105249_11059494 Ga0105249_110594941 172
125 3300009553 Ga0105249_12652403 Ga0105249_126524031 172
126 3300011119 Ga0105246_10755716 Ga0105246_107557162 172
127 3300013104 Ga0157370_10002557 Ga0157370_100025573 172
128 3300013306 Ga0163162_10050100 Ga0163162_100501002 172
129 3300013307 Ga0157372_11102708 Ga0157372_111027081 172
130 3300013308 Ga0157375_10160070 Ga0157375_101600702 172
131 3300014325 Ga0163163_10280054 Ga0163163_102800543 172
132 3300014325 Ga0163163_11781827 Ga0163163_117818271 172
133 3300017792 Ga0163161_10306510 Ga0163161_103065102 172
134 3300025899 Ga0207642_10161402 Ga0207642_101614022 172
135 3300025909 Ga0207705_10037534 Ga0207705_100375342 172
136 3300025925 Ga0207650_10551265 Ga0207650_105512652 172
137 3300025926 Ga0207659_10158357 Ga0207659_101583572 172
138 3300025934 Ga0207686_10002586 Ga0207686_100025866 172
139 3300025934 Ga0207686_10032518 Ga0207686_100325184 172
140 3300025934 Ga0207686_10768240 Ga0207686_107682401 172
141 3300025938 Ga0207704_10446790 Ga0207704_104467902 172
142 3300025942 Ga0207689_10003117 Ga0207689_100031174 172
143 3300025942 Ga0207689_10073751 Ga0207689_100737511 172
144 3300025960 Ga0207651_10278863 Ga0207651_102788632 172
145 3300025961 Ga0207712_10231739 Ga0207712_102317392 172
146 3300026075 Ga0207708_10275489 Ga0207708_102754892 172
147 3300026078 Ga0207702_11634624 Ga0207702_116346242 172
148 3300026088 Ga0207641_10017818 Ga0207641_100178184 172
149 3300026116 Ga0207674_10156378 Ga0207674_101563782 172
150 3300026118 Ga0207675_100074357 Ga0207675_1000743573 172
151 3300026121 Ga0207683_10469939 Ga0207683_104699392 172
152 3300027907 Ga0207428_10226013 Ga0207428_102260132 172
153 3300028380 Ga0268265_10088868 Ga0268265_100888682 172
154 3300028381 Ga0268264_10479417 Ga0268264_104794172 172
155 3300031730 Ga0307516_10405620 Ga0307516_104056202 172
156 3300041459 Ga0451800_0038765 Ga0451800_0038765_271_792 172
157 3300041505 Ga0451849_0513228 Ga0451849_0513228_66_584 172
158 3300042125 Ga0450923_075462 Ga0450923_075462_207_725 172
159 3300046471 Ga0495650_0015595 Ga0495650_0015595_1650_2168 172
160 3300049588 Ga0501072_0030099 Ga0501072_0030099_1482_2000 172
161 3300050511 nmdc:mga08y16_247460_c1 nmdc:mga08y16_247460_c1_1145_1663 172
162 3300005295 Ga0065707_10419862 Ga0065707_104198621 173
163 3300005330 Ga0070690_100006178 Ga0070690_1000061787 173
164 3300005330 Ga0070690_100265718 Ga0070690_1002657181 173
165 3300005335 Ga0070666_10296571 Ga0070666_102965712 173
166 3300005336 Ga0070680_100046989 Ga0070680_1000469892 173
167 3300005337 Ga0070682_100014253 Ga0070682_1000142533 173
168 3300005338 Ga0068868_100207335 Ga0068868_1002073352 173
169 3300005339 Ga0070660_100064628 Ga0070660_1000646282 173
170 3300005344 Ga0070661_100048891 Ga0070661_1000488913 173
171 3300005354 Ga0070675_100158312 Ga0070675_1001583122 173
172 3300005355 Ga0070671_100069613 Ga0070671_1000696133 173
173 3300005364 Ga0070673_100039342 Ga0070673_1000393423 173
174 3300005365 Ga0070688_100257810 Ga0070688_1002578101 173
175 3300005367 Ga0070667_100373633 Ga0070667_1003736331 173
176 3300005456 Ga0070678_100150260 Ga0070678_1001502602 173
177 3300005456 Ga0070678_100837903 Ga0070678_1008379032 173
178 3300005530 Ga0070679_100002484 Ga0070679_1000024847 173
179 3300005543 Ga0070672_100202201 Ga0070672_1002022013 173
180 3300005544 Ga0070686_100075539 Ga0070686_1000755392 173
181 3300005564 Ga0070664_100587635 Ga0070664_1005876351 173
182 3300005578 Ga0068854_100029824 Ga0068854_1000298245 173
183 3300005578 Ga0068854_100142962 Ga0068854_1001429622 173
184 3300005615 Ga0070702_100017895 Ga0070702_1000178952 173
185 3300005615 Ga0070702_100181934 Ga0070702_1001819342 173
186 3300005616 Ga0068852_100001619 Ga0068852_10000161911 173
187 3300005617 Ga0068859_100390294 Ga0068859_1003902942 173
188 3300005618 Ga0068864_100256917 Ga0068864_1002569172 173
189 3300005718 Ga0068866_10114840 Ga0068866_101148401 173
190 3300005840 Ga0068870_10075134 Ga0068870_100751343 173
191 3300006358 Ga0068871_100154777 Ga0068871_1001547773 173
192 3300006931 Ga0097620_100390327 Ga0097620_1003903272 173
193 3300009098 Ga0105245_11113984 Ga0105245_111139842 173
194 3300009148 Ga0105243_10685738 Ga0105243_106857382 173
195 3300009174 Ga0105241_10391674 Ga0105241_103916742 173
196 3300009174 Ga0105241_10462964 Ga0105241_104629642 173
197 3300009176 Ga0105242_10086830 Ga0105242_100868302 173
198 3300010375 Ga0105239_11012918 Ga0105239_110129181 173
199 3300013306 Ga0163162_10356541 Ga0163162_103565412 173
200 3300013306 Ga0163162_10759004 Ga0163162_107590042 173
201 3300013308 Ga0157375_10012111 Ga0157375_100121112 173
202 3300014325 Ga0163163_10040248 Ga0163163_100402481 173
203 3300014745 Ga0157377_10056326 Ga0157377_100563263 173
204 3300014968 Ga0157379_10070781 Ga0157379_100707812 173
205 3300014968 Ga0157379_11055331 Ga0157379_110553311 173
206 3300014969 Ga0157376_10728135 Ga0157376_107281352 173
207 3300014969 Ga0157376_11276032 Ga0157376_112760321 173
208 3300017792 Ga0163161_10003712 Ga0163161_100037129 173
209 3300017792 Ga0163161_10094520 Ga0163161_100945204 173
210 3300025901 Ga0207688_10029833 Ga0207688_100298334 173
211 3300025903 Ga0207680_10100252 Ga0207680_101002522 173
212 3300025907 Ga0207645_10107936 Ga0207645_101079364 173
213 3300025908 Ga0207643_10180936 Ga0207643_101809362 173
214 3300025909 Ga0207705_10041161 Ga0207705_100411613 173
215 3300025913 Ga0207695_10297566 Ga0207695_102975663 173
216 3300025917 Ga0207660_10069977 Ga0207660_100699773 173
217 3300025917 Ga0207660_10407139 Ga0207660_104071392 173
218 3300025919 Ga0207657_10040973 Ga0207657_100409733 173
219 3300025920 Ga0207649_10195313 Ga0207649_101953132 173
220 3300025921 Ga0207652_10002120 Ga0207652_1000212010 173
221 3300025923 Ga0207681_10136557 Ga0207681_101365574 173
222 3300025933 Ga0207706_10003683 Ga0207706_1000368313 173
223 3300025940 Ga0207691_10032646 Ga0207691_100326466 173
224 3300025945 Ga0207679_10518276 Ga0207679_105182762 173
225 3300025986 Ga0207658_10865768 Ga0207658_108657682 173
226 3300026023 Ga0207677_10499677 Ga0207677_104996772 173
227 3300026041 Ga0207639_10234350 Ga0207639_102343502 173
228 3300026078 Ga0207702_10298727 Ga0207702_102987273 173
229 3300026142 Ga0207698_10003838 Ga0207698_100038387 173
230 3300026142 Ga0207698_10835141 Ga0207698_108351411 173
231 3300028381 Ga0268264_10090546 Ga0268264_100905462 173
232 3300048903 Ga0496100_0540493 Ga0496100_0540493_189_806 173
233 3300048907 Ga0496104_0581973 Ga0496104_0581973_384_1001 173
234 3300049568 Ga0501031_0657040 Ga0501031_0657040_80_601 173
235 3300049573 Ga0501037_0121488 Ga0501037_0121488_200_721 173
236 3300049578 Ga0501042_0086284 Ga0501042_0086284_104_625 173
237 3300049579 Ga0501043_0461858 Ga0501043_0461858_320_841 173
238 3300049580 Ga0501046_0001780 Ga0501046_0001780_2930_3451 173
239 3300049581 Ga0501047_0181101 Ga0501047_0181101_146_667 173
240 3300049582 Ga0501048_0085003 Ga0501048_0085003_107_628 173
241 3300049583 Ga0501067_0032166 Ga0501067_0032166_1744_2265 173
242 3300049584 Ga0501068_0442976 Ga0501068_0442976_135_656 173
243 3300049741 Ga0501079_0311036 Ga0501079_0311036_172_693 173
244 3300049742 Ga0501080_0343060 Ga0501080_0343060_192_713 173
245 3300049744 Ga0501083_0004260 Ga0501083_0004260_6475_6996 173
246 3300049823 Ga0501044_0048035 Ga0501044_0048035_589_1110 173
247 3300050514 nmdc:mga08x19_348705_c1 nmdc:mga08x19_348705_c1_345_962 173
248 3300054114 Ga0501084_0442230 Ga0501084_0442230_88_609 173
249 3300060353 Ga0501082_0394106 Ga0501082_0394106_653_1174 173
250 3300001979 JGI24740J21852_10063451 JGI24740J21852_100634511 174
251 3300001989 JGI24739J22299_10194979 JGI24739J22299_101949791 174
252 3300005329 Ga0070683_100037080 Ga0070683_1000370804 174
253 3300005330 Ga0070690_100508933 Ga0070690_1005089331 174
254 3300005333 Ga0070677_10286641 Ga0070677_102866411 174
255 3300005334 Ga0068869_100511263 Ga0068869_1005112631 174
256 3300005337 Ga0070682_100009363 Ga0070682_1000093634 174
257 3300005339 Ga0070660_100004412 Ga0070660_1000044124 174
258 3300005343 Ga0070687_101062555 Ga0070687_1010625551 174
259 3300005344 Ga0070661_100001789 Ga0070661_1000017893 174
260 3300005344 Ga0070661_100004634 Ga0070661_1000046343 174
261 3300005344 Ga0070661_100998057 Ga0070661_1009980571 174
262 3300005355 Ga0070671_100010628 Ga0070671_1000106283 174
263 3300005364 Ga0070673_100389942 Ga0070673_1003899422 174
264 3300005366 Ga0070659_100013067 Ga0070659_1000130673 174
265 3300005366 Ga0070659_100042454 Ga0070659_1000424543 174
266 3300005367 Ga0070667_100030532 Ga0070667_1000305324 174
267 3300005455 Ga0070663_100069411 Ga0070663_1000694112 174
268 3300005455 Ga0070663_100735425 Ga0070663_1007354251 174
269 3300005456 Ga0070678_100262463 Ga0070678_1002624632 174
270 3300005457 Ga0070662_100009217 Ga0070662_1000092174 174
271 3300005530 Ga0070679_100056526 Ga0070679_1000565263 174
272 3300005535 Ga0070684_100002013 Ga0070684_1000020133 174
273 3300005539 Ga0068853_100004150 Ga0068853_10000415010 174
274 3300005539 Ga0068853_100018118 Ga0068853_1000181185 174
275 3300005543 Ga0070672_100250048 Ga0070672_1002500482 174
276 3300005543 Ga0070672_100447673 Ga0070672_1004476731 174
277 3300005563 Ga0068855_100003326 Ga0068855_1000033264 174
278 3300005563 Ga0068855_100170342 Ga0068855_1001703423 174
279 3300005564 Ga0070664_100001372 Ga0070664_1000013723 174
280 3300005564 Ga0070664_100044684 Ga0070664_1000446841 174
281 3300005564 Ga0070664_100672077 Ga0070664_1006720772 174
282 3300005577 Ga0068857_100004400 Ga0068857_1000044004 174
283 3300005577 Ga0068857_100039098 Ga0068857_1000390985 174
284 3300005577 Ga0068857_100045383 Ga0068857_1000453834 174
285 3300005578 Ga0068854_100045718 Ga0068854_1000457183 174
286 3300005614 Ga0068856_100078045 Ga0068856_1000780454 174
287 3300005618 Ga0068864_100046362 Ga0068864_1000463622 174
288 3300005841 Ga0068863_100053143 Ga0068863_1000531434 174
289 3300005841 Ga0068863_100569932 Ga0068863_1005699322 174
290 3300005841 Ga0068863_100922189 Ga0068863_1009221891 174
291 3300005842 Ga0068858_101865388 Ga0068858_1018653881 174
292 3300006237 Ga0097621_100000559 Ga0097621_1000005599 174
293 3300006237 Ga0097621_100039286 Ga0097621_1000392865 174
294 3300006358 Ga0068871_100003509 Ga0068871_1000035096 174
295 3300006358 Ga0068871_100060052 Ga0068871_1000600524 174
296 3300006358 Ga0068871_100433324 Ga0068871_1004333241 174
297 3300009093 Ga0105240_10081372 Ga0105240_100813725 174
298 3300009177 Ga0105248_10005347 Ga0105248_100053478 174
299 3300009553 Ga0105249_10167869 Ga0105249_101678692 174
300 3300009553 Ga0105249_10428509 Ga0105249_104285092 174
301 3300010375 Ga0105239_10751509 Ga0105239_107515091 174
302 3300010375 Ga0105239_10772687 Ga0105239_107726872 174
303 3300011119 Ga0105246_10596990 Ga0105246_105969901 174
304 3300013100 Ga0157373_10003498 Ga0157373_100034986 174
305 3300013102 Ga0157371_10013542 Ga0157371_100135423 174
306 3300013104 Ga0157370_10096433 Ga0157370_100964332 174
307 3300013105 Ga0157369_10010208 Ga0157369_100102087 174
308 3300013105 Ga0157369_10054343 Ga0157369_100543434 174
309 3300013105 Ga0157369_10124114 Ga0157369_101241142 174
310 3300013105 Ga0157369_10201967 Ga0157369_102019673 174
311 3300013296 Ga0157374_10009869 Ga0157374_100098696 174
312 3300013296 Ga0157374_10903987 Ga0157374_109039872 174
313 3300013297 Ga0157378_10004027 Ga0157378_100040279 174
314 3300013297 Ga0157378_10018492 Ga0157378_100184922 174
315 3300013297 Ga0157378_10292060 Ga0157378_102920602 174
316 3300013306 Ga0163162_10000761 Ga0163162_1000076121 174
317 3300013306 Ga0163162_10014894 Ga0163162_100148944 174
318 3300013306 Ga0163162_10167669 Ga0163162_101676693 174
319 3300013307 Ga0157372_10077127 Ga0157372_100771272 174
320 3300013307 Ga0157372_10462895 Ga0157372_104628952 174
321 3300013307 Ga0157372_10471233 Ga0157372_104712333 174
322 3300013307 Ga0157372_10809798 Ga0157372_108097982 174
323 3300013308 Ga0157375_10000067 Ga0157375_1000006787 174
324 3300013308 Ga0157375_10143555 Ga0157375_101435552 174
325 3300014325 Ga0163163_10060020 Ga0163163_100600202 174
326 3300014326 Ga0157380_10001827 Ga0157380_1000182710 174
327 3300014745 Ga0157377_10145637 Ga0157377_101456372 174
328 3300014968 Ga0157379_10085325 Ga0157379_100853251 174
329 3300014968 Ga0157379_10178692 Ga0157379_101786924 174
330 3300014969 Ga0157376_10000165 Ga0157376_1000016516 174
331 3300014969 Ga0157376_10028816 Ga0157376_100288166 174
332 3300017792 Ga0163161_10002761 Ga0163161_100027612 174
333 3300017792 Ga0163161_10155904 Ga0163161_101559042 174
334 3300017792 Ga0163161_10245525 Ga0163161_102455252 174
335 3300025315 Ga0207697_10088801 Ga0207697_100888012 174
336 3300025321 Ga0207656_10219981 Ga0207656_102199812 174
337 3300025899 Ga0207642_10118379 Ga0207642_101183792 174
338 3300025903 Ga0207680_10417306 Ga0207680_104173062 174
339 3300025904 Ga0207647_10062232 Ga0207647_100622323 174
340 3300025909 Ga0207705_10087346 Ga0207705_100873462 174
341 3300025913 Ga0207695_10976997 Ga0207695_109769971 174
342 3300025917 Ga0207660_10193566 Ga0207660_101935661 174
343 3300025919 Ga0207657_10028321 Ga0207657_100283215 174
344 3300025920 Ga0207649_10002808 Ga0207649_100028085 174
345 3300025920 Ga0207649_10011562 Ga0207649_100115624 174
346 3300025925 Ga0207650_10008460 Ga0207650_100084606 174
347 3300025925 Ga0207650_10039614 Ga0207650_100396142 174
348 3300025931 Ga0207644_10022748 Ga0207644_100227482 174
349 3300025932 Ga0207690_10042213 Ga0207690_100422134 174
350 3300025932 Ga0207690_10226757 Ga0207690_102267572 174
351 3300025933 Ga0207706_10016096 Ga0207706_100160964 174
352 3300025941 Ga0207711_10008182 Ga0207711_100081824 174
353 3300025944 Ga0207661_10025445 Ga0207661_100254453 174
354 3300025944 Ga0207661_10121796 Ga0207661_101217963 174
355 3300025945 Ga0207679_10005252 Ga0207679_100052522 174
356 3300025945 Ga0207679_10020901 Ga0207679_100209014 174
357 3300025945 Ga0207679_10372593 Ga0207679_103725932 174
358 3300025949 Ga0207667_10166458 Ga0207667_101664584 174
359 3300025960 Ga0207651_10271159 Ga0207651_102711592 174
360 3300025961 Ga0207712_10006689 Ga0207712_100066896 174
361 3300025981 Ga0207640_10118949 Ga0207640_101189492 174
362 3300026041 Ga0207639_10012810 Ga0207639_100128102 174
363 3300026041 Ga0207639_10395428 Ga0207639_103954282 174
364 3300026067 Ga0207678_10086012 Ga0207678_100860123 174
365 3300026078 Ga0207702_10078690 Ga0207702_100786901 174
366 3300026088 Ga0207641_10054919 Ga0207641_100549193 174
367 3300026088 Ga0207641_10883821 Ga0207641_108838211 174
368 3300026089 Ga0207648_10204711 Ga0207648_102047111 174
369 3300026095 Ga0207676_10038234 Ga0207676_100382342 174
370 3300026116 Ga0207674_10001740 Ga0207674_1000174017 174
371 3300026116 Ga0207674_10063998 Ga0207674_100639983 174
372 3300026142 Ga0207698_10171169 Ga0207698_101711693 174
373 3300037312 Ga0395899_0008250 Ga0395899_0008250_3880_4407 174
374 3300037418 Ga0395900_0100020 Ga0395900_0100020_1376_1903 174
375 3300037466 Ga0395898_0008380 Ga0395898_0008380_7891_8418 174
376 3300038443 Ga0395901_0005031 Ga0395901_0005031_11583_12110 174
377 3300041459 Ga0451800_0928796 Ga0451800_0928796_474_998 174
378 3300044673 Ga0453683_0100130 Ga0453683_0100130_1175_1720 174
379 3300044712 Ga0453684_0040792 Ga0453684_0040792_1654_2199 174
380 3300047321 Ga0495676_0077529 Ga0495676_0077529_710_1234 174
381 3300048903 Ga0496100_0385302 Ga0496100_0385302_158_712 174
382 3300048907 Ga0496104_0362561 Ga0496104_0362561_784_1338 174
383 3300048917 Ga0496114_0050594 Ga0496114_0050594_992_1546 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04143

Sulf_transp

Sulphur transport

95

202

0.87

PF20398

DUF6691

Family of unknown function (DUF6691)

70

204

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r1x-assembly1.cif.gz_A crystal structure of 2-oxo-3-deoxygalactonate kinase from klebsiella pneumoniae 0.5456 113 171
8b6h-assembly1.cif.gz_EG cryo-em structure of cytochrome c oxidase dimer (complex iv) from respiratory supercomplex of tetrahymena thermophila 0.4006 108 171
8gym-assembly1.cif.gz_t7 cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.3785 111 171
8b6h-assembly1.cif.gz_EG cryo-em structure of cytochrome c oxidase dimer (complex iv) from respiratory supercomplex of tetrahymena thermophila 0.2866 108 171
3r1x-assembly1.cif.gz_A crystal structure of 2-oxo-3-deoxygalactonate kinase from klebsiella pneumoniae 0.2221 113 171
ID Description Score Start End Superfamily
3nuwA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;2-keto-3-deoxy-galactonokinase, C-terminal domain 0.5133 113 171 3.30.420.310
1anwB03 Mainly Alpha;Orthogonal Bundle;Annexin V; domain 1;Annexin 0.5011 109 160 1.10.220.10
af_I1KSG6_66_191_1.20.140.50 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;alix/aip1 like domains 0.4824 116 171 1.20.140.50
af_A0A1D6GUL8_419_510_1.10.10.630 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DnaD domain-like 0.3993 108 172 1.10.10.630
af_Q86I14_1_135_1.25.40.180 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.3919 115 173 1.25.40.180
ID Description Score Start End GO Terms
AF-A0A348TQP9-F1-model_v4 Transporter 0.529 88 174 GO:0016020
AF-A0A348TQP9-F1-model_v4 Transporter 0.5181 88 174 GO:0016020
AF-A0A7J6YLZ9-F1-model_v4 deleted 0.4929 82 174
AF-A0A5C6LW40-F1-model_v4 Transporter 0.4477 31 174 GO:0005886
AF-A0A520DUT7-F1-model_v4 Transporter 0.4379 15 174 GO:0005886

Feature Viewer

pLDDT pTM Quality
66.51 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map