F429501

General Info

Members Datasets Scaffolds Average Seq Length
383 229 766 361

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100082190|Ga0070674_1000821902
Length 403
Sequence MLYISYLPLSREFVVSATDQDCIAIKSLKLNTPVIFYFCIHFFIMQRTKVAIIGAGFITDIHMESYHRFVPEAEVVAVYARNIEKAKAFAEKHRIPKWYDDIDKALNDSGCEVVDICLPNYLHAEATLKAAAAGKHIIIEKPLAVTLEEADAMIAACKKAGVKLMYAEELCFAPKYERVRQMVNEGAIGKIYMLKQSEKHSGPHTDWFYDIKFSGGGVIMDMGCHAIGWFRWMLGNAKAKSVYASMSTVLHTERTKGEDNSIVIIEFENGVTAVAEDSWAKHGGMDDRCEVYGTGGVMYADLFMGNAAITYSKHGYGYAMEKADTTVGWSFTVFEEAFNQGYPHELKHFIECIQQNKQPLVTGEDGRAVLEIIYAAYASAGEGKKISLPFTPKVERPVDLWLK

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
157 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
158 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
159 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
219 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
220 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
221 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
222 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
223 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
224 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
225 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
226 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
227 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
228 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
229 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.87
Metatranscriptomes 0
Isolates 3.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.48
Nodule 0
Rhizoplane 3.92
Rhizosphere 86.95
Stem 0
Stem Tuber 0
Unclassified 12.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100082190 3300005356 Unclassified 2304
2 JGI24739J22299_10025675 3300001989 Bacteria 2072
3 JGI24737J22298_10013309 3300001990 Bacteria 2679
4 JGI24735J21928_10000027 3300002067 Bacteria 83494
5 JGI25162J39368_1000088 3300002737 Bacteria 106999
6 rootH1_10015968 3300003316 Bacteria 13898
7 rootH2_10041266 3300003320 Bacteria 13673
8 rootL2_10049967 3300003322 Bacteria 6315
9 rootL2_10082758 3300003322 Bacteria 2817
10 rootL2_10099789 3300003322 Bacteria 8014
11 rootH1_10101783 3300003323 Bacteria 3283
12 rootH1_10263145 3300003323 Unclassified 1406
13 rootH1_10357418 3300003323 Unclassified 1897
14 JGI25160J50197_1003255 3300003354 Bacteria 7318
15 Ga0055541_1005998 3300003841 Bacteria 2095
16 Ga0065714_10079553 3300005288 Unclassified 2505
17 Ga0065712_10000582 3300005290 Bacteria 15199
18 Ga0065712_10093416 3300005290 Bacteria 2293
19 Ga0065715_10000354 3300005293 Bacteria 18024
20 Ga0065707_10134061 3300005295 Unclassified 1871
21 Ga0070676_10034397 3300005328 Bacteria 2910
22 Ga0070676_10076859 3300005328 Unclassified 2017
23 Ga0070683_100002970 3300005329 Bacteria 13601
24 Ga0070683_100006527 3300005329 Bacteria 9796
25 Ga0070683_100037512 3300005329 Bacteria 4437
26 Ga0070690_100041863 3300005330 Bacteria 2901
27 Ga0070670_100027147 3300005331 Bacteria 4925
28 Ga0070670_100110736 3300005331 Bacteria 2366
29 Ga0068869_100002555 3300005334 Bacteria 10982
30 Ga0068869_100020238 3300005334 Bacteria 4561
31 Ga0068869_100066683 3300005334 Bacteria 2653
32 Ga0068869_100146935 3300005334 Bacteria 1825
33 Ga0070666_10123565 3300005335 Bacteria 1796
34 Ga0068868_100009438 3300005338 Bacteria 7022
35 Ga0068868_100261313 3300005338 Bacteria 1460
36 Ga0070660_100137741 3300005339 Bacteria 1956
37 Ga0070660_100168052 3300005339 Bacteria 1770
38 Ga0070689_100001988 3300005340 Bacteria 13242
39 Ga0070661_100002053 3300005344 Bacteria 13879
40 Ga0070661_100008313 3300005344 Bacteria 7168
41 Ga0070661_100151430 3300005344 Bacteria 1753
42 Ga0070669_100163763 3300005353 Bacteria 1730
43 Ga0070675_100013233 3300005354 Bacteria 6484
44 Ga0070675_100066711 3300005354 Bacteria 2977
45 Ga0070675_100112892 3300005354 Bacteria 2301
46 Ga0070671_100213345 3300005355 Bacteria 1637
47 Ga0070674_100112663 3300005356 Unclassified 2000
48 Ga0070673_100021001 3300005364 Bacteria 4722
49 Ga0070659_100008622 3300005366 Bacteria 7456
50 Ga0070659_100014368 3300005366 Bacteria 5916
51 Ga0070667_100054825 3300005367 Bacteria 3367
52 Ga0070663_100057197 3300005455 Bacteria 2797
53 Ga0070678_100043338 3300005456 Bacteria 3204
54 Ga0070662_100034219 3300005457 Bacteria 3581
55 Ga0070662_100158432 3300005457 Bacteria 1769
56 Ga0070662_100290737 3300005457 Bacteria 1325
57 Ga0068867_100004842 3300005459 Bacteria 9468
58 Ga0068867_100007722 3300005459 Bacteria 7607
59 Ga0068867_100128600 3300005459 Bacteria 1966
60 Ga0070685_10008813 3300005466 Bacteria 5197
61 Ga0070685_10009297 3300005466 Bacteria 5071
62 Ga0070685_10022583 3300005466 Bacteria 3432
63 Ga0070684_100000214 3300005535 Bacteria 40555
64 Ga0070684_100002052 3300005535 Bacteria 14826
65 Ga0068853_100008191 3300005539 Bacteria 8391
66 Ga0068853_100024786 3300005539 Bacteria 5033
67 Ga0070672_100052748 3300005543 Bacteria 3176
68 Ga0070672_100166374 3300005543 Bacteria 1832
69 Ga0070686_100140506 3300005544 Bacteria 1681
70 Ga0070665_100288992 3300005548 Bacteria 1642
71 Ga0070664_100046062 3300005564 Bacteria 3683
72 Ga0070664_100069619 3300005564 Unclassified 3011
73 Ga0070664_100136808 3300005564 Bacteria 2155
74 Ga0070664_100173905 3300005564 Bacteria 1911
75 Ga0068857_100010859 3300005577 Bacteria 7926
76 Ga0068852_100000207 3300005616 Bacteria 39824
77 Ga0068852_100059024 3300005616 Bacteria 3326
78 Ga0068852_100234188 3300005616 Bacteria 1752
79 Ga0068852_100357851 3300005616 Bacteria 1427
80 Ga0068852_100473297 3300005616 Bacteria 1244
81 Ga0068859_100025646 3300005617 Bacteria 5912
82 Ga0068859_100088167 3300005617 Bacteria 3152
83 Ga0068859_100129871 3300005617 Bacteria 2591
84 Ga0068859_100142565 3300005617 Bacteria 2470
85 Ga0068859_100293959 3300005617 Unclassified 1718
86 Ga0068859_100301918 3300005617 Unclassified 1694
87 Ga0068864_100006615 3300005618 Bacteria 9484
88 Ga0068864_100065331 3300005618 Bacteria 3156
89 Ga0068864_100095285 3300005618 Bacteria 2632
90 Ga0068866_10007503 3300005718 Bacteria 4569
91 Ga0068866_10009236 3300005718 Bacteria 4180
92 Ga0068861_100019515 3300005719 Bacteria 4842
93 Ga0068861_100245661 3300005719 Bacteria 1524
94 Ga0068851_10062545 3300005834 Bacteria 1910
95 Ga0068863_100179087 3300005841 Bacteria 2035
96 Ga0068860_100003295 3300005843 Bacteria 16613
97 Ga0068860_100040657 3300005843 Unclassified 4444
98 Ga0068862_100014981 3300005844 Bacteria 6440
99 Ga0068862_100341641 3300005844 Bacteria 1387
100 Ga0075364_10073951 3300006051 Bacteria 2247
101 Ga0075367_10013153 3300006178 Bacteria 4439
102 Ga0075367_10145132 3300006178 Unclassified 1471
103 Ga0075366_10025985 3300006195 Unclassified 3426
104 Ga0075366_10081467 3300006195 Bacteria 1933
105 Ga0097621_100019441 3300006237 Bacteria 5212
106 Ga0097621_100025707 3300006237 Bacteria 4609
107 Ga0097621_100077014 3300006237 Bacteria 2768
108 Ga0097621_100127596 3300006237 Bacteria 2162
109 Ga0068871_100045411 3300006358 Bacteria 3536
110 Ga0068871_100192135 3300006358 Bacteria 1759
111 Ga0068871_100206588 3300006358 Bacteria 1697
112 Ga0075428_100006288 3300006844 Bacteria 13202
113 Ga0075428_100007449 3300006844 Bacteria 12126
114 Ga0075428_100138202 3300006844 Unclassified 2649
115 Ga0075428_100375618 3300006844 Bacteria 1524
116 Ga0075431_100017215 3300006847 Bacteria 7344
117 Ga0075431_100047624 3300006847 Unclassified 4419
118 Ga0075431_100092208 3300006847 Bacteria 3127
119 Ga0075433_10150080 3300006852 Bacteria 2073
120 Ga0075429_100036247 3300006880 Bacteria 4289
121 Ga0068865_100020254 3300006881 Bacteria 4313
122 Ga0068865_100070070 3300006881 Unclassified 2483
123 Ga0068865_100115048 3300006881 Bacteria 1990
124 Ga0068865_100143744 3300006881 Bacteria 1801
125 Ga0097620_100025648 3300006931 Bacteria 5912
126 Ga0097620_100088172 3300006931 Bacteria 3152
127 Ga0097620_100129871 3300006931 Bacteria 2591
128 Ga0097620_100142559 3300006931 Bacteria 2470
129 Ga0097620_100293941 3300006931 Unclassified 1718
130 Ga0097620_100301926 3300006931 Unclassified 1694
131 Ga0111539_10010793 3300009094 Bacteria 11502
132 Ga0111539_10021839 3300009094 Bacteria 7870
133 Ga0111539_10037201 3300009094 Bacteria 5879
134 Ga0111539_10211086 3300009094 Unclassified 2262
135 Ga0105241_10089501 3300009174 Bacteria 2425
136 Ga0105241_10175788 3300009174 Bacteria 1772
137 Ga0105242_10060203 3300009176 Unclassified 3119
138 Ga0105242_10269608 3300009176 Bacteria 1541
139 Ga0105248_10016244 3300009177 Bacteria 8193
140 Ga0105237_10001576 3300009545 Bacteria 29681
141 Ga0105237_10021141 3300009545 Bacteria 6694
142 Ga0105249_10042631 3300009553 Bacteria 4129
143 Ga0105249_10211618 3300009553 Bacteria 1903
144 Ga0105239_10000087 3300010375 Bacteria 129698
145 Ga0105239_10005247 3300010375 Bacteria 15243
146 Ga0105239_10157572 3300010375 Bacteria 2536
147 Ga0105239_10458288 3300010375 Bacteria 1447
148 Ga0105246_10070480 3300011119 Bacteria 2459
149 Ga0157371_10008962 3300013102 Bacteria 7914
150 Ga0157369_10072294 3300013105 Bacteria 3702
151 Ga0157369_10084575 3300013105 Unclassified 3391
152 Ga0157369_10131176 3300013105 Bacteria 2656
153 Ga0157374_10000660 3300013296 Bacteria 30313
154 Ga0157374_10003316 3300013296 Bacteria 13520
155 Ga0157374_10017698 3300013296 Bacteria 6280
156 Ga0157374_10056103 3300013296 Bacteria 3677
157 Ga0157378_10188764 3300013297 Bacteria 1943
158 Ga0163162_10000985 3300013306 Bacteria 26500
159 Ga0163162_10002414 3300013306 Bacteria 17587
160 Ga0163162_10053925 3300013306 Bacteria 4042
161 Ga0163162_10057237 3300013306 Bacteria 3926
162 Ga0163162_10071909 3300013306 Bacteria 3513
163 Ga0163162_10079702 3300013306 Bacteria 3341
164 Ga0163162_10418531 3300013306 Bacteria 1472
165 Ga0157372_10000538 3300013307 Bacteria 41695
166 Ga0157372_10026245 3300013307 Bacteria 6339
167 Ga0157372_10032279 3300013307 Bacteria 5740
168 Ga0157372_10102008 3300013307 Unclassified 3277
169 Ga0157375_10003088 3300013308 Bacteria 14452
170 Ga0157375_10025379 3300013308 Bacteria 5506
171 Ga0157375_10131000 3300013308 Bacteria 2627
172 Ga0157375_10408661 3300013308 Bacteria 1524
173 Ga0163163_10002002 3300014325 Bacteria 17218
174 Ga0163163_10053968 3300014325 Bacteria 3969
175 Ga0163163_10078446 3300014325 Unclassified 3299
176 Ga0163163_10084198 3300014325 Unclassified 3185
177 Ga0163163_10235282 3300014325 Bacteria 1881
178 Ga0157380_10033491 3300014326 Bacteria 3956
179 Ga0182008_10000562 3300014497 Bacteria 27457
180 Ga0157377_10021069 3300014745 Bacteria 3424
181 Ga0157377_10054028 3300014745 Bacteria 2273
182 Ga0157379_10230450 3300014968 Unclassified 1679
183 Ga0157376_10025645 3300014969 Unclassified 4646
184 Ga0157376_10154643 3300014969 Bacteria 2072
185 Ga0182006_1000678 3300015261 Bacteria 23881
186 Ga0182007_10012989 3300015262 Bacteria 3190
187 Ga0182007_10016637 3300015262 Bacteria 2708
188 Ga0163161_10030154 3300017792 Bacteria 3858
189 Ga0163161_10112471 3300017792 Bacteria 2037
190 Ga0213872_10000755 3300021361 Bacteria 23918
191 Ga0209436_100069 3300025208 Bacteria 52691
192 Ga0209566_100279 3300025225 Bacteria 47751
193 Ga0209437_100190 3300025233 Bacteria 125000
194 Ga0209258_103493 3300025242 Bacteria 3361
195 Ga0209129_1007795 3300025258 Bacteria 3100
196 Ga0209130_1000905 3300025284 Bacteria 23913
197 Ga0209050_1002880 3300025298 Bacteria 13598
198 Ga0207426_1000342 3300025302 Bacteria 87421
199 Ga0207642_10027623 3300025899 Unclassified 2325
200 Ga0207642_10032908 3300025899 Bacteria 2188
201 Ga0207680_10127089 3300025903 Bacteria 1675
202 Ga0207647_10000011 3300025904 Bacteria 156667
203 Ga0207647_10044732 3300025904 Bacteria 2765
204 Ga0207645_10002079 3300025907 Bacteria 16016
205 Ga0207645_10024240 3300025907 Bacteria 3936
206 Ga0207645_10053613 3300025907 Bacteria 2577
207 Ga0207705_10087616 3300025909 Bacteria 2277
208 Ga0207654_10142172 3300025911 Bacteria 1531
209 Ga0207671_10001560 3300025914 Bacteria 26209
210 Ga0207671_10004208 3300025914 Bacteria 13869
211 Ga0207657_10090053 3300025919 Unclassified 2561
212 Ga0207649_10004222 3300025920 Bacteria 7829
213 Ga0207649_10023932 3300025920 Bacteria 3543
214 Ga0207649_10085654 3300025920 Bacteria 2051
215 Ga0207681_10089001 3300025923 Bacteria 2200
216 Ga0207650_10004502 3300025925 Bacteria 9531
217 Ga0207659_10008148 3300025926 Bacteria 6485
218 Ga0207644_10126301 3300025931 Unclassified 1953
219 Ga0207690_10008257 3300025932 Bacteria 6175
220 Ga0207690_10044574 3300025932 Bacteria 2925
221 Ga0207706_10037856 3300025933 Bacteria 4281
222 Ga0207706_10326609 3300025933 Bacteria 1335
223 Ga0207670_10054608 3300025936 Unclassified 2696
224 Ga0207669_10304576 3300025937 Bacteria 1213
225 Ga0207704_10026732 3300025938 Bacteria 3171
226 Ga0207704_10040067 3300025938 Unclassified 2734
227 Ga0207691_10113911 3300025940 Bacteria 2403
228 Ga0207691_10183695 3300025940 Bacteria 1826
229 Ga0207711_10028870 3300025941 Bacteria 4673
230 Ga0207689_10016575 3300025942 Bacteria 6234
231 Ga0207689_10019542 3300025942 Bacteria 5708
232 Ga0207689_10149695 3300025942 Bacteria 1924
233 Ga0207689_10189452 3300025942 Bacteria 1697
234 Ga0207689_10228157 3300025942 Bacteria 1539
235 Ga0207661_10002958 3300025944 Bacteria 11754
236 Ga0207679_10002300 3300025945 Bacteria 11778
237 Ga0207679_10007822 3300025945 Bacteria 6792
238 Ga0207679_10017901 3300025945 Bacteria 4735
239 Ga0207679_10040587 3300025945 Unclassified 3333
240 Ga0207667_10057286 3300025949 Bacteria 4091
241 Ga0207667_10339288 3300025949 Bacteria 1534
242 Ga0207651_10171321 3300025960 Bacteria 1712
243 Ga0207712_10022474 3300025961 Bacteria 4153
244 Ga0207668_10009989 3300025972 Bacteria 5712
245 Ga0207640_10141628 3300025981 Bacteria 1754
246 Ga0207658_10260802 3300025986 Bacteria 1477
247 Ga0207677_10042253 3300026023 Bacteria 3021
248 Ga0207639_10004893 3300026041 Bacteria 9022
249 Ga0207639_10052648 3300026041 Unclassified 3103
250 Ga0207639_10131170 3300026041 Unclassified 2075
251 Ga0207678_10148915 3300026067 Bacteria 1998
252 Ga0207708_10195215 3300026075 Bacteria 1613
253 Ga0207648_10012243 3300026089 Bacteria 8033
254 Ga0207648_10173399 3300026089 Bacteria 1907
255 Ga0207648_10186461 3300026089 Bacteria 1838
256 Ga0207648_10266839 3300026089 Bacteria 1528
257 Ga0207676_10089370 3300026095 Bacteria 2524
258 Ga0207674_10003496 3300026116 Bacteria 19183
259 Ga0207674_10117967 3300026116 Bacteria 2624
260 Ga0207674_10171844 3300026116 Unclassified 2120
261 Ga0207675_100020672 3300026118 Bacteria 6136
262 Ga0207675_100057450 3300026118 Bacteria 3630
263 Ga0207675_100385422 3300026118 Unclassified 1379
264 Ga0207683_10043139 3300026121 Bacteria 3940
265 Ga0207698_10001507 3300026142 Bacteria 13555
266 Ga0207698_10132093 3300026142 Bacteria 2135
267 Ga0207428_10085014 3300027907 Bacteria 2464
268 Ga0207428_10133603 3300027907 Bacteria 1898
269 Ga0268266_10153529 3300028379 Bacteria 2078
270 Ga0268266_10369794 3300028379 Bacteria 1350
271 Ga0268265_10005672 3300028380 Bacteria 8526
272 Ga0268264_10129393 3300028381 Bacteria 2236
273 Ga0265338_10014101 3300028800 Bacteria 8942
274 Ga0265320_10004426 3300031240 Bacteria 9211
275 Ga0265329_10000096 3300031242 Bacteria 41415
276 Ga0307513_10136745 3300031456 Bacteria 2385
277 Ga0307509_10038951 3300031507 Bacteria 5181
278 Ga0265314_10000046 3300031711 Bacteria 199789
279 Ga0307413_10204410 3300031824 Unclassified 1429
280 Ga0307416_100024216 3300032002 Bacteria 4426
281 Ga0307414_10002916 3300032004 Bacteria 9040
282 Ga0307414_10101946 3300032004 Bacteria 2162
283 Ga0307414_10105056 3300032004 Unclassified 2134
284 Ga0307411_10203419 3300032005 Bacteria 1523
285 Ga0373955_0069250 3300035172 Unclassified 1968
286 Ga0373924_0045364 3300035410 Bacteria 1808
287 Ga0373937_0069694 3300036401 Unclassified 3242
288 Ga0373925_0257676 3300037068 Bacteria 1401
289 Ga0395905_0005782 3300037471 Bacteria 12570
290 Ga0395905_0025867 3300037471 Bacteria 5531
291 Ga0436361_0350847 3300039447 Bacteria 24408
292 Ga0450894_002575 3300042131 Bacteria 2425
293 Ga0450896_003890 3300042133 Unclassified 2008
294 Ga0439435_0043461 3300042436 Bacteria 1264
295 Ga0439464_0049999 3300042439 Bacteria 1207
296 Ga0451577_0009459 3300042876 Bacteria 9386
297 Ga0453684_0523854 3300044712 Bacteria 1309
298 Ga0495638_0000013 3300046460 Bacteria 430133
299 Ga0495638_0088984 3300046460 Bacteria 1863
300 Ga0495650_0000098 3300046471 Bacteria 215716
301 Ga0495650_0026690 3300046471 Bacteria 2681
302 Ga0495585_0000029 3300046492 Bacteria 145822
303 Ga0495606_0000021 3300046507 Bacteria 271238
304 Ga0495608_0104941 3300046511 Unclassified 1820
305 Ga0495610_0000735 3300046512 Bacteria 31026
306 Ga0495616_0017699 3300046513 Bacteria 3926
307 Ga0495628_0071460 3300046516 Unclassified 2705
308 Ga0495630_0098215 3300046517 Bacteria 2215
309 Ga0495630_0317969 3300046517 Unclassified 1190
310 Ga0495637_0035849 3300046520 Bacteria 2165
311 Ga0495648_0016196 3300046524 Bacteria 5380
312 Ga0495652_0259278 3300046529 Bacteria 1284
313 Ga0495652_0329582 3300046529 Bacteria 1100
314 Ga0495640_0030330 3300046533 Bacteria 3873
315 Ga0495633_0011245 3300046558 Bacteria 4837
316 Ga0495625_0000183 3300046660 Bacteria 98174
317 Ga0495625_0018047 3300046660 Bacteria 5515
318 Ga0495625_0049628 3300046660 Bacteria 3015
319 Ga0495661_0000766 3300046665 Bacteria 30949
320 Ga0495661_0011102 3300046665 Bacteria 6116
321 Ga0495661_0027002 3300046665 Bacteria 3691
322 Ga0495649_0000046 3300046694 Bacteria 120254
323 Ga0495660_0002856 3300046810 Bacteria 10860
324 Ga0495683_0024973 3300047323 Bacteria 3064
325 Ga0495686_0002513 3300047472 Bacteria 17187
326 Ga0495686_0008227 3300047472 Bacteria 7689
327 Ga0496100_0085495 3300048903 Bacteria 2141
328 Ga0496101_0085874 3300048904 Bacteria 2333
329 Ga0496104_0010988 3300048907 Bacteria 8103
330 Ga0496104_0223073 3300048907 Bacteria 1797
331 Ga0496105_0029462 3300048908 Bacteria 4493
332 Ga0496105_0055413 3300048908 Bacteria 3274
333 Ga0496107_0073567 3300048910 Bacteria 2486
334 Ga0496108_0010543 3300048911 Bacteria 7509
335 Ga0496108_0145540 3300048911 Bacteria 2043
336 Ga0496109_0079156 3300048912 Bacteria 3027
337 Ga0496110_0028807 3300048913 Bacteria 4773
338 Ga0496113_0007628 3300048916 Bacteria 6980
339 Ga0496114_0001319 3300048917 Bacteria 18815
340 Ga0496114_0022305 3300048917 Bacteria 5159
341 Ga0495678_007255 3300049459 Bacteria 5772
342 Ga0501031_0207355 3300049568 Bacteria 1278
343 Ga0501032_0043077 3300049569 Bacteria 3059
344 Ga0501033_0035090 3300049570 Bacteria 3760
345 Ga0501033_0298880 3300049570 Bacteria 1134
346 Ga0501034_0032051 3300049571 Bacteria 5339
347 Ga0501036_0077833 3300049572 Bacteria 2806
348 Ga0501036_0234905 3300049572 Bacteria 1538
349 Ga0501037_0010051 3300049573 Bacteria 6942
350 Ga0501038_0013924 3300049574 Bacteria 7331
351 Ga0501040_0027463 3300049576 Bacteria 3833
352 Ga0501043_0043096 3300049579 Bacteria 3547
353 Ga0501043_0219252 3300049579 Bacteria 1472
354 Ga0501046_0231027 3300049580 Bacteria 1367
355 Ga0501047_0084295 3300049581 Bacteria 3054
356 Ga0501067_0054838 3300049583 Bacteria 2208
357 Ga0501069_0050050 3300049585 Bacteria 2323
358 Ga0501076_0035222 3300049592 Bacteria 3917
359 Ga0501079_0044357 3300049741 Bacteria 3432
360 Ga0501081_0013504 3300049743 Bacteria 5368
361 Ga0501035_0028858 3300049822 Bacteria 5062
362 Ga0501044_0018114 3300049823 Bacteria 7552
363 nmdc:mga00v17_53758_c1 3300050491 Bacteria 2455
364 nmdc:mga0k408_120919_c1 3300050493 Unclassified 1551
365 nmdc:mga04h51_12592_c1 3300050495 Bacteria 2377
366 nmdc:mga06r32_83363_c1 3300050510 Unclassified 3115
367 nmdc:mga08y16_41890_c1 3300050511 Bacteria 4796
368 nmdc:mga08y16_51808_c2 3300050511 Bacteria 2508
369 nmdc:mga08y16_83248_c1 3300050511 Bacteria 3334
370 Ga0500641_0004558 3300053096 Bacteria 4897
371 Ga0500616_0000013 3300053153 Bacteria 674172
372 2586209142 2585427687 Bacteria 5544917
373 2599481726 2599185184 Bacteria 6430550
374 2819679266 2818991460 Bacteria 7595395
375 2852623228 2852623160 Bacteria 4376875
376 2884791602 2884791551 Bacteria 8511252
377 2884937907 2884933994 Bacteria 4535041
378 2910249335 2910245624 Bacteria 6935613
379 2919440025 2919437846 Bacteria 6199444
380 2928082001 2928078545 Bacteria 6534839
381 2928152017 2928147474 Bacteria 6512076
382 2932088054 2932082852 Bacteria 6563563
383 3006986980 3006984091 Bacteria 4207523
384 Ga0070674_100082190
385 JGI24739J22299_10025675
386 JGI24737J22298_10013309
387 JGI24735J21928_10000027
388 JGI25162J39368_1000088
389 rootH1_10015968
390 rootH2_10041266
391 rootL2_10049967
392 rootL2_10082758
393 rootL2_10099789
394 rootH1_10101783
395 rootH1_10263145
396 rootH1_10357418
397 JGI25160J50197_1003255
398 Ga0055541_1005998
399 Ga0065714_10079553
400 Ga0065712_10000582
401 Ga0065712_10093416
402 Ga0065715_10000354
403 Ga0065707_10134061
404 Ga0070676_10034397
405 Ga0070676_10076859
406 Ga0070683_100002970
407 Ga0070683_100006527
408 Ga0070683_100037512
409 Ga0070690_100041863
410 Ga0070670_100027147
411 Ga0070670_100110736
412 Ga0068869_100002555
413 Ga0068869_100020238
414 Ga0068869_100066683
415 Ga0068869_100146935
416 Ga0070666_10123565
417 Ga0068868_100009438
418 Ga0068868_100261313
419 Ga0070660_100137741
420 Ga0070660_100168052
421 Ga0070689_100001988
422 Ga0070661_100002053
423 Ga0070661_100008313
424 Ga0070661_100151430
425 Ga0070669_100163763
426 Ga0070675_100013233
427 Ga0070675_100066711
428 Ga0070675_100112892
429 Ga0070671_100213345
430 Ga0070674_100112663
431 Ga0070673_100021001
432 Ga0070659_100008622
433 Ga0070659_100014368
434 Ga0070667_100054825
435 Ga0070663_100057197
436 Ga0070678_100043338
437 Ga0070662_100034219
438 Ga0070662_100158432
439 Ga0070662_100290737
440 Ga0068867_100004842
441 Ga0068867_100007722
442 Ga0068867_100128600
443 Ga0070685_10008813
444 Ga0070685_10009297
445 Ga0070685_10022583
446 Ga0070684_100000214
447 Ga0070684_100002052
448 Ga0068853_100008191
449 Ga0068853_100024786
450 Ga0070672_100052748
451 Ga0070672_100166374
452 Ga0070686_100140506
453 Ga0070665_100288992
454 Ga0070664_100046062
455 Ga0070664_100069619
456 Ga0070664_100136808
457 Ga0070664_100173905
458 Ga0068857_100010859
459 Ga0068852_100000207
460 Ga0068852_100059024
461 Ga0068852_100234188
462 Ga0068852_100357851
463 Ga0068852_100473297
464 Ga0068859_100025646
465 Ga0068859_100088167
466 Ga0068859_100129871
467 Ga0068859_100142565
468 Ga0068859_100293959
469 Ga0068859_100301918
470 Ga0068864_100006615
471 Ga0068864_100065331
472 Ga0068864_100095285
473 Ga0068866_10007503
474 Ga0068866_10009236
475 Ga0068861_100019515
476 Ga0068861_100245661
477 Ga0068851_10062545
478 Ga0068863_100179087
479 Ga0068860_100003295
480 Ga0068860_100040657
481 Ga0068862_100014981
482 Ga0068862_100341641
483 Ga0075364_10073951
484 Ga0075367_10013153
485 Ga0075367_10145132
486 Ga0075366_10025985
487 Ga0075366_10081467
488 Ga0097621_100019441
489 Ga0097621_100025707
490 Ga0097621_100077014
491 Ga0097621_100127596
492 Ga0068871_100045411
493 Ga0068871_100192135
494 Ga0068871_100206588
495 Ga0075428_100006288
496 Ga0075428_100007449
497 Ga0075428_100138202
498 Ga0075428_100375618
499 Ga0075431_100017215
500 Ga0075431_100047624
501 Ga0075431_100092208
502 Ga0075433_10150080
503 Ga0075429_100036247
504 Ga0068865_100020254
505 Ga0068865_100070070
506 Ga0068865_100115048
507 Ga0068865_100143744
508 Ga0097620_100025648
509 Ga0097620_100088172
510 Ga0097620_100129871
511 Ga0097620_100142559
512 Ga0097620_100293941
513 Ga0097620_100301926
514 Ga0111539_10010793
515 Ga0111539_10021839
516 Ga0111539_10037201
517 Ga0111539_10211086
518 Ga0105241_10089501
519 Ga0105241_10175788
520 Ga0105242_10060203
521 Ga0105242_10269608
522 Ga0105248_10016244
523 Ga0105237_10001576
524 Ga0105237_10021141
525 Ga0105249_10042631
526 Ga0105249_10211618
527 Ga0105239_10000087
528 Ga0105239_10005247
529 Ga0105239_10157572
530 Ga0105239_10458288
531 Ga0105246_10070480
532 Ga0157371_10008962
533 Ga0157369_10072294
534 Ga0157369_10084575
535 Ga0157369_10131176
536 Ga0157374_10000660
537 Ga0157374_10003316
538 Ga0157374_10017698
539 Ga0157374_10056103
540 Ga0157378_10188764
541 Ga0163162_10000985
542 Ga0163162_10002414
543 Ga0163162_10053925
544 Ga0163162_10057237
545 Ga0163162_10071909
546 Ga0163162_10079702
547 Ga0163162_10418531
548 Ga0157372_10000538
549 Ga0157372_10026245
550 Ga0157372_10032279
551 Ga0157372_10102008
552 Ga0157375_10003088
553 Ga0157375_10025379
554 Ga0157375_10131000
555 Ga0157375_10408661
556 Ga0163163_10002002
557 Ga0163163_10053968
558 Ga0163163_10078446
559 Ga0163163_10084198
560 Ga0163163_10235282
561 Ga0157380_10033491
562 Ga0182008_10000562
563 Ga0157377_10021069
564 Ga0157377_10054028
565 Ga0157379_10230450
566 Ga0157376_10025645
567 Ga0157376_10154643
568 Ga0182006_1000678
569 Ga0182007_10012989
570 Ga0182007_10016637
571 Ga0163161_10030154
572 Ga0163161_10112471
573 Ga0213872_10000755
574 Ga0209436_100069
575 Ga0209566_100279
576 Ga0209437_100190
577 Ga0209258_103493
578 Ga0209129_1007795
579 Ga0209130_1000905
580 Ga0209050_1002880
581 Ga0207426_1000342
582 Ga0207642_10027623
583 Ga0207642_10032908
584 Ga0207680_10127089
585 Ga0207647_10000011
586 Ga0207647_10044732
587 Ga0207645_10002079
588 Ga0207645_10024240
589 Ga0207645_10053613
590 Ga0207705_10087616
591 Ga0207654_10142172
592 Ga0207671_10001560
593 Ga0207671_10004208
594 Ga0207657_10090053
595 Ga0207649_10004222
596 Ga0207649_10023932
597 Ga0207649_10085654
598 Ga0207681_10089001
599 Ga0207650_10004502
600 Ga0207659_10008148
601 Ga0207644_10126301
602 Ga0207690_10008257
603 Ga0207690_10044574
604 Ga0207706_10037856
605 Ga0207706_10326609
606 Ga0207670_10054608
607 Ga0207669_10304576
608 Ga0207704_10026732
609 Ga0207704_10040067
610 Ga0207691_10113911
611 Ga0207691_10183695
612 Ga0207711_10028870
613 Ga0207689_10016575
614 Ga0207689_10019542
615 Ga0207689_10149695
616 Ga0207689_10189452
617 Ga0207689_10228157
618 Ga0207661_10002958
619 Ga0207679_10002300
620 Ga0207679_10007822
621 Ga0207679_10017901
622 Ga0207679_10040587
623 Ga0207667_10057286
624 Ga0207667_10339288
625 Ga0207651_10171321
626 Ga0207712_10022474
627 Ga0207668_10009989
628 Ga0207640_10141628
629 Ga0207658_10260802
630 Ga0207677_10042253
631 Ga0207639_10004893
632 Ga0207639_10052648
633 Ga0207639_10131170
634 Ga0207678_10148915
635 Ga0207708_10195215
636 Ga0207648_10012243
637 Ga0207648_10173399
638 Ga0207648_10186461
639 Ga0207648_10266839
640 Ga0207676_10089370
641 Ga0207674_10003496
642 Ga0207674_10117967
643 Ga0207674_10171844
644 Ga0207675_100020672
645 Ga0207675_100057450
646 Ga0207675_100385422
647 Ga0207683_10043139
648 Ga0207698_10001507
649 Ga0207698_10132093
650 Ga0207428_10085014
651 Ga0207428_10133603
652 Ga0268266_10153529
653 Ga0268266_10369794
654 Ga0268265_10005672
655 Ga0268264_10129393
656 Ga0265338_10014101
657 Ga0265320_10004426
658 Ga0265329_10000096
659 Ga0307513_10136745
660 Ga0307509_10038951
661 Ga0265314_10000046
662 Ga0307413_10204410
663 Ga0307416_100024216
664 Ga0307414_10002916
665 Ga0307414_10101946
666 Ga0307414_10105056
667 Ga0307411_10203419
668 Ga0373955_0069250
669 Ga0373924_0045364
670 Ga0373937_0069694
671 Ga0373925_0257676
672 Ga0395905_0005782
673 Ga0395905_0025867
674 Ga0436361_0350847
675 Ga0450894_002575
676 Ga0450896_003890
677 Ga0439435_0043461
678 Ga0439464_0049999
679 Ga0451577_0009459
680 Ga0453684_0523854
681 Ga0495638_0000013
682 Ga0495638_0088984
683 Ga0495650_0000098
684 Ga0495650_0026690
685 Ga0495585_0000029
686 Ga0495606_0000021
687 Ga0495608_0104941
688 Ga0495610_0000735
689 Ga0495616_0017699
690 Ga0495628_0071460
691 Ga0495630_0098215
692 Ga0495630_0317969
693 Ga0495637_0035849
694 Ga0495648_0016196
695 Ga0495652_0259278
696 Ga0495652_0329582
697 Ga0495640_0030330
698 Ga0495633_0011245
699 Ga0495625_0000183
700 Ga0495625_0018047
701 Ga0495625_0049628
702 Ga0495661_0000766
703 Ga0495661_0011102
704 Ga0495661_0027002
705 Ga0495649_0000046
706 Ga0495660_0002856
707 Ga0495683_0024973
708 Ga0495686_0002513
709 Ga0495686_0008227
710 Ga0496100_0085495
711 Ga0496101_0085874
712 Ga0496104_0010988
713 Ga0496104_0223073
714 Ga0496105_0029462
715 Ga0496105_0055413
716 Ga0496107_0073567
717 Ga0496108_0010543
718 Ga0496108_0145540
719 Ga0496109_0079156
720 Ga0496110_0028807
721 Ga0496113_0007628
722 Ga0496114_0001319
723 Ga0496114_0022305
724 Ga0495678_007255
725 Ga0501031_0207355
726 Ga0501032_0043077
727 Ga0501033_0035090
728 Ga0501033_0298880
729 Ga0501034_0032051
730 Ga0501036_0077833
731 Ga0501036_0234905
732 Ga0501037_0010051
733 Ga0501038_0013924
734 Ga0501040_0027463
735 Ga0501043_0043096
736 Ga0501043_0219252
737 Ga0501046_0231027
738 Ga0501047_0084295
739 Ga0501067_0054838
740 Ga0501069_0050050
741 Ga0501076_0035222
742 Ga0501079_0044357
743 Ga0501081_0013504
744 Ga0501035_0028858
745 Ga0501044_0018114
746 nmdc:mga00v17_53758_c1
747 nmdc:mga0k408_120919_c1
748 nmdc:mga04h51_12592_c1
749 nmdc:mga06r32_83363_c1
750 nmdc:mga08y16_41890_c1
751 nmdc:mga08y16_51808_c2
752 nmdc:mga08y16_83248_c1
753 Ga0500641_0004558
754 Ga0500616_0000013
755 2586209142
756 2599481726
757 2819679266
758 2852623228
759 2884791602
760 2884937907
761 2910249335
762 2919440025
763 2928082001
764 2928152017
765 2932088054
766 3006986980

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

48

168

0.98

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

176

299

0.95

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

180

388

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2glx-assembly1.cif.gz_A crystal structure analysis of bacterial 1,5-af reductase 0.9168 4 344
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.9105 1 338
3e9m-assembly2.cif.gz_C-2 crystal structure of an oxidoreductase from enterococcus faecalis 0.9039 2 328
2glx-assembly1.cif.gz_A crystal structure analysis of bacterial 1,5-af reductase 0.9036 4 344
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.8991 1 338
ID Description Score Start End Superfamily
af_D4A903_1_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9528 3 121 3.40.50.720
af_M9PE54_6_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.952 3 121 3.40.50.720
af_P42599_1_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9446 4 136 3.40.50.720
3ezyC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9443 5 123 3.40.50.720
af_Q2G1E5_4_119_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.944 5 118 3.40.50.720
ID Description Score Start End GO Terms
AF-Q9KHV5-F1-model_v4 WlbA 0.9594 2 121 GO:0000166
AF-A0A2R6G1Q3-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9525 3 142 GO:0000166
AF-A0A7C7VBA7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9497 2 147 GO:0000166
AF-A0A1H1JMI8-F1-model_v4 Oxidoreductase family, NAD-binding Rossmann fold 0.9483 2 147 GO:0000166
AF-A0A2X3C520-F1-model_v4 Oxidoreductase (EC 1.-.-.-) 0.9473 4 123 GO:0000166
GO:0016491

Map