F429365

General Info

Members Datasets Scaffolds Average Seq Length
382 267 764 322

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0084751|Ga0466970_0084751_76_1215
Length 379
Sequence VRSGAVRDRQNRRAGDKGLWTSPTSQNGWILCRGKDGDTPCCGAIRAAPTLAIRPSRKATAVKAWQVPVHGEPADVLRSADVAVPEAGPGQLLVRVRAAALNFPDVLMCRGQYQVQPPLPYTPGVELCGEVVGSGERIVATPALPHGALAEYALVDADAAFPAPAALDDAEAAGFLLAYQTGWFGLHRRAHLRPGETLLVHAAAGGVGSAAVQLGKAAGARVIAVAGGATKAEAARQLGADVVIDRQEQDFVTVVKDVTDGRGADVVYDPVGGAAYQGSTKCVAFEGRIVXXXXAGGVIPTPALNHALVKNYSILGLHWGLYRTKDPEAVTACHRELIRLADAGSIKTLIGERLPFDAAPAGLARLAAGDAVGRLVVLP

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
70 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
75 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
76 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
79 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
120 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
203 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
204 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
206 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
207 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
208 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
209 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
210 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
211 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
212 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
213 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
214 2643221647 Streptomyces sp. Root369 Isolate Unclassified
215 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
216 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
217 2643221679 Angustibacter sp. Root456 Isolate Unclassified
218 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
219 2643221692 Nocardia sp. Root136 Isolate Unclassified
220 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
221 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
222 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
223 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
224 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
225 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
226 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
227 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
228 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
229 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
230 2858868258 Micromonospora sp. MH33 Isolate Unclassified
231 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
232 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
233 2867369537 Streptomyces sp. Z26 Isolate Unclassified
234 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
235 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
236 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
237 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
238 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
239 2902582711 Micromonospora sp. AP08 Isolate Unclassified
240 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
241 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
242 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
243 2922554459 Rhodococcus sp. 66b Isolate Unclassified
244 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
245 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
246 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
247 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
248 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
249 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
250 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
251 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
252 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
253 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
254 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
255 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
256 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
257 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
258 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
259 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
260 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
261 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
262 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
263 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
264 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
265 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
266 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
267 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.46
Metatranscriptomes 1.05
Isolates 16.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.93
Nodule 0.26
Rhizoplane 2.62
Rhizosphere 81.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0084751 3300044765 Bacteria 1716
2 rootH2_10114454 3300003320 Bacteria 4784
3 JGI25160J50197_1037764 3300003354 Bacteria 1152
4 Ga0070668_100090804 3300005347 Bacteria 2407
5 Ga0070671_100000498 3300005355 Bacteria 27450
6 Ga0070671_100326479 3300005355 Bacteria 1308
7 Ga0070709_10003067 3300005434 Bacteria 8974
8 Ga0070714_100017159 3300005435 Bacteria 5862
9 Ga0070714_100059739 3300005435 Bacteria 3270
10 Ga0070713_100018938 3300005436 Bacteria 5242
11 Ga0070713_100063359 3300005436 Bacteria 3099
12 Ga0070713_100094104 3300005436 Bacteria 2582
13 Ga0070711_100183396 3300005439 Bacteria 1603
14 Ga0070681_10056276 3300005458 Bacteria 3915
15 Ga0070706_100210850 3300005467 Bacteria 1814
16 Ga0070706_100405320 3300005467 Bacteria 1269
17 Ga0070698_100032936 3300005471 Bacteria 5368
18 Ga0070698_100299689 3300005471 Bacteria 1538
19 Ga0070665_100001234 3300005548 Bacteria 31063
20 Ga0068856_100050416 3300005614 Bacteria 4103
21 Ga0068856_100108786 3300005614 Bacteria 2768
22 Ga0070702_100023082 3300005615 Bacteria 3300
23 Ga0068863_100013136 3300005841 Bacteria 7992
24 Ga0068862_100170110 3300005844 Bacteria 1950
25 Ga0081539_10001008 3300005985 Bacteria 52049
26 Ga0081539_10009602 3300005985 Bacteria 8037
27 Ga0081539_10010586 3300005985 Bacteria 7458
28 Ga0070717_10342438 3300006028 Bacteria 1335
29 Ga0075365_10093281 3300006038 Bacteria 2053
30 Ga0075364_10010086 3300006051 Bacteria 5695
31 Ga0070715_10054666 3300006163 Bacteria 1730
32 Ga0070716_100019386 3300006173 Bacteria 3554
33 Ga0070716_100052195 3300006173 Bacteria 2327
34 Ga0070712_100027350 3300006175 Bacteria 3808
35 Ga0097621_100368568 3300006237 Bacteria 1281
36 Ga0075370_10000196 3300006353 Bacteria 21255
37 Ga0075370_10011353 3300006353 Bacteria 4678
38 Ga0075428_100000651 3300006844 Bacteria 35741
39 Ga0075428_100184363 3300006844 Bacteria 2258
40 Ga0075428_100192670 3300006844 Bacteria 2204
41 Ga0075431_100066698 3300006847 Bacteria 3716
42 Ga0075431_100126702 3300006847 Bacteria 2635
43 Ga0075431_100171626 3300006847 Bacteria 2228
44 Ga0105244_10038540 3300009036 Bacteria 2492
45 Ga0114129_10002921 3300009147 Bacteria 23900
46 Ga0114129_10406399 3300009147 Bacteria 1794
47 Ga0105243_10001620 3300009148 Bacteria 19586
48 Ga0105243_10033189 3300009148 Bacteria 3991
49 Ga0105243_10085141 3300009148 Bacteria 2590
50 Ga0105237_10183618 3300009545 Bacteria 2092
51 Ga0157369_10085519 3300013105 Bacteria 3370
52 Ga0157369_10351075 3300013105 Bacteria 1532
53 Ga0171462_1001 3300013250 Bacteria 1135406
54 Ga0157378_10004811 3300013297 Bacteria 11831
55 Ga0163162_10155410 3300013306 Bacteria 2407
56 Ga0157375_10046921 3300013308 Bacteria 4215
57 Ga0157375_10841778 3300013308 Bacteria 1064
58 Ga0163163_10101710 3300014325 Bacteria 2896
59 Ga0157380_10102116 3300014326 Bacteria 2390
60 Ga0197907_11408120 3300020069 Bacteria 1837
61 Ga0206353_10603769 3300020082 Bacteria 1885
62 Ga0206353_10807658 3300020082 Bacteria 3959
63 Ga0206353_10916250 3300020082 Bacteria 3889
64 Ga0213875_10000487 3300021388 Bacteria 33809
65 Ga0228598_1014577 3300024227 Bacteria 1555
66 Ga0209758_1005912 3300025297 Bacteria 9100
67 Ga0207426_1016020 3300025302 Bacteria 2703
68 Ga0207699_10004341 3300025906 Bacteria 6781
69 Ga0207699_10049113 3300025906 Bacteria 2482
70 Ga0207699_10107085 3300025906 Bacteria 1785
71 Ga0207705_10020553 3300025909 Bacteria 4714
72 Ga0207684_10173660 3300025910 Bacteria 1858
73 Ga0207707_10045865 3300025912 Bacteria 3807
74 Ga0207693_10017247 3300025915 Bacteria 5758
75 Ga0207693_10040149 3300025915 Bacteria 3685
76 Ga0207693_10070630 3300025915 Bacteria 2733
77 Ga0207663_10063348 3300025916 Bacteria 2354
78 Ga0207660_10006446 3300025917 Bacteria 7610
79 Ga0207657_10023413 3300025919 Bacteria 5751
80 Ga0207652_10029472 3300025921 Bacteria 4589
81 Ga0207700_10082951 3300025928 Bacteria 2508
82 Ga0207700_10273313 3300025928 Bacteria 1451
83 Ga0207664_10020245 3300025929 Bacteria 4928
84 Ga0207664_10072299 3300025929 Bacteria 2780
85 Ga0207664_10130573 3300025929 Bacteria 2114
86 Ga0207644_10001027 3300025931 Bacteria 17865
87 Ga0207709_10000598 3300025935 Bacteria 30054
88 Ga0207665_10002237 3300025939 Bacteria 13060
89 Ga0207665_10018120 3300025939 Bacteria 4626
90 Ga0207661_10033540 3300025944 Bacteria 3986
91 Ga0207661_10117879 3300025944 Bacteria 2256
92 Ga0207668_10066467 3300025972 Bacteria 2556
93 Ga0207677_10233090 3300026023 Bacteria 1484
94 Ga0207702_10191792 3300026078 Bacteria 1889
95 Ga0207702_10195455 3300026078 Bacteria 1872
96 Ga0207648_10067194 3300026089 Bacteria 3126
97 Ga0207674_10022016 3300026116 Bacteria 6855
98 Ga0207675_100382825 3300026118 Bacteria 1384
99 Ga0207683_10113639 3300026121 Bacteria 2425
100 Ga0207683_10114487 3300026121 Bacteria 2416
101 Ga0207683_10325548 3300026121 Bacteria 1408
102 Ga0268266_10042706 3300028379 Bacteria 3873
103 Ga0265337_1000897 3300028556 Bacteria 15658
104 Ga0265326_10001864 3300028558 Bacteria 7225
105 Ga0265319_1001915 3300028563 Bacteria 11810
106 Ga0265334_10000989 3300028573 Bacteria 14084
107 Ga0265318_10042494 3300028577 Bacteria 1724
108 Ga0265323_10003004 3300028653 Bacteria 7532
109 Ga0265322_10002424 3300028654 Bacteria 5755
110 Ga0265336_10001676 3300028666 Bacteria 9796
111 Ga0265338_10005587 3300028800 Bacteria 16358
112 Ga0265338_10195914 3300028800 Bacteria 1527
113 Ga0265324_10000927 3300029957 Bacteria 18418
114 Ga0307511_10117848 3300030521 Bacteria 1657
115 Ga0265320_10005783 3300031240 Bacteria 7879
116 Ga0265325_10098004 3300031241 Bacteria 1438
117 Ga0265340_10002222 3300031247 Bacteria 11101
118 Ga0265316_10068238 3300031344 Bacteria 2748
119 Ga0265313_10011135 3300031595 Bacteria 5610
120 Ga0307508_10003791 3300031616 Bacteria 15104
121 Ga0307508_10271412 3300031616 Bacteria 1290
122 Ga0265314_10005075 3300031711 Bacteria 11999
123 Ga0265342_10005997 3300031712 Bacteria 9136
124 Ga0307516_10004318 3300031730 Bacteria 17615
125 Ga0307407_10064690 3300031903 Bacteria 2150
126 Ga0307407_10097678 3300031903 Bacteria 1816
127 Ga0307409_100012789 3300031995 Bacteria 5365
128 Ga0307409_100014406 3300031995 Bacteria 5143
129 Ga0307416_100413432 3300032002 Bacteria 1390
130 Ga0307416_100654619 3300032002 Bacteria 1136
131 Ga0307414_10323045 3300032004 Bacteria 1314
132 Ga0307415_100043406 3300032126 Bacteria 3000
133 Ga0307415_100144919 3300032126 Bacteria 1819
134 Ga0307510_10109723 3300033180 Bacteria 2507
135 Ga0373926_0002440 3300035083 Bacteria 5892
136 Ga0373934_0018907 3300035086 Bacteria 2640
137 Ga0373923_0015963 3300035111 Bacteria 2843
138 Ga0373936_0002180 3300035113 Bacteria 7298
139 Ga0373936_0006653 3300035113 Bacteria 4351
140 Ga0373945_0000246 3300035116 Bacteria 15047
141 Ga0373953_0084450 3300035117 Bacteria 1323
142 Ga0373954_0056500 3300035118 Bacteria 1847
143 Ga0373954_0091277 3300035118 Bacteria 1463
144 Ga0373956_0036174 3300035119 Bacteria 2179
145 Ga0373943_0000378 3300035170 Bacteria 18718
146 Ga0373946_0001361 3300035171 Bacteria 8466
147 Ga0373955_0078416 3300035172 Bacteria 1861
148 Ga0373924_0012563 3300035410 Bacteria 3167
149 Ga0373935_0000481 3300035692 Bacteria 20688
150 Ga0373933_0034126 3300035724 Bacteria 2963
151 Ga0373933_0043398 3300035724 Bacteria 2660
152 Ga0373933_0082980 3300035724 Bacteria 1968
153 Ga0373947_0000547 3300035725 Bacteria 22035
154 Ga0373937_0054070 3300036401 Bacteria 3683
155 Ga0373925_0001636 3300037068 Bacteria 18879
156 Ga0395899_0056583 3300037312 Bacteria 2898
157 Ga0395900_0007342 3300037418 Bacteria 11396
158 Ga0395898_0002245 3300037466 Bacteria 23480
159 Ga0395898_0018210 3300037466 Bacteria 7164
160 Ga0395905_0030516 3300037471 Bacteria 5079
161 Ga0395905_0082008 3300037471 Bacteria 3022
162 Ga0436364_0218008 3300037853 Bacteria 37704
163 Ga0395901_0131068 3300038443 Bacteria 2634
164 Ga0395901_0170288 3300038443 Bacteria 2285
165 Ga0436363_1240116 3300039450 Bacteria 2726
166 Ga0439465_0075335 3300041413 Bacteria 1136
167 Ga0439449_0003158 3300042007 Bacteria 6413
168 Ga0466969_0000239 3300044656 Bacteria 30052
169 Ga0466972_0007660 3300044658 Bacteria 5420
170 Ga0466965_0052562 3300044683 Bacteria 2024
171 Ga0466966_0008764 3300044684 Bacteria 6698
172 Ga0466961_0004752 3300044693 Bacteria 8550
173 Ga0466961_0026837 3300044693 Bacteria 3704
174 Ga0466961_0205710 3300044693 Bacteria 1216
175 Ga0466963_0079993 3300044694 Bacteria 2212
176 Ga0466963_0194412 3300044694 Bacteria 1418
177 Ga0466964_0110983 3300044706 Bacteria 1223
178 Ga0453684_0488920 3300044712 Bacteria 1364
179 Ga0466971_0000303 3300044719 Bacteria 18946
180 Ga0466970_0002575 3300044765 Bacteria 8742
181 Ga0466970_0006250 3300044765 Bacteria 5944
182 Ga0466957_0069708 3300044842 Bacteria 2172
183 Ga0466957_0289639 3300044842 Bacteria 1098
184 Ga0466960_0008750 3300044901 Bacteria 4155
185 Ga0466960_0025836 3300044901 Bacteria 2661
186 Ga0466960_0170188 3300044901 Bacteria 1175
187 Ga0466959_0002543 3300045049 Bacteria 11703
188 Ga0466959_0195846 3300045049 Bacteria 1408
189 Ga0466958_0028159 3300045836 Bacteria 3330
190 Ga0466958_0099886 3300045836 Bacteria 1803
191 Ga0466967_0001481 3300045976 Bacteria 13702
192 Ga0466967_0002832 3300045976 Bacteria 11001
193 Ga0466967_0100490 3300045976 Bacteria 2643
194 Ga0466967_0107389 3300045976 Bacteria 2560
195 Ga0466967_0181950 3300045976 Bacteria 1983
196 Ga0466967_0389489 3300045976 Bacteria 1354
197 Ga0495592_0026296 3300046454 Bacteria 4413
198 Ga0495592_0037044 3300046454 Bacteria 3673
199 Ga0495603_0169297 3300046455 Bacteria 1266
200 Ga0495629_0180610 3300046459 Bacteria 1463
201 Ga0495641_0010368 3300046461 Bacteria 5408
202 Ga0495651_0036048 3300046462 Bacteria 3850
203 Ga0495651_0080448 3300046462 Bacteria 2461
204 Ga0495653_0034516 3300046463 Bacteria 4000
205 Ga0495639_0027928 3300046475 Bacteria 2499
206 Ga0495639_0037978 3300046475 Bacteria 2161
207 Ga0495664_0008859 3300046477 Bacteria 5621
208 Ga0495608_0051902 3300046511 Bacteria 2716
209 Ga0495608_0055107 3300046511 Bacteria 2627
210 Ga0495618_0051377 3300046514 Bacteria 2604
211 Ga0495628_0007564 3300046516 Bacteria 9396
212 Ga0495628_0045135 3300046516 Bacteria 3505
213 Ga0495628_0104829 3300046516 Bacteria 2179
214 Ga0495630_0004738 3300046517 Bacteria 9543
215 Ga0495652_0000734 3300046529 Bacteria 37934
216 Ga0495665_0013274 3300046531 Bacteria 4456
217 Ga0495665_0052603 3300046531 Bacteria 2156
218 Ga0495640_0015183 3300046533 Bacteria 5801
219 Ga0495640_0065585 3300046533 Bacteria 2451
220 Ga0495587_0010856 3300046536 Bacteria 5781
221 Ga0495645_0071650 3300046543 Bacteria 2498
222 Ga0495645_0219530 3300046543 Bacteria 1279
223 Ga0495667_0004120 3300046559 Bacteria 9769
224 Ga0495667_0017589 3300046559 Bacteria 4829
225 Ga0495667_0028714 3300046559 Bacteria 3746
226 Ga0495668_0000161 3300046616 Bacteria 101410
227 Ga0495634_0021895 3300046642 Bacteria 4509
228 Ga0495634_0025871 3300046642 Bacteria 4099
229 Ga0495634_0208769 3300046642 Bacteria 1210
230 Ga0495625_0065249 3300046660 Bacteria 2567
231 Ga0495635_0012187 3300046663 Bacteria 6028
232 Ga0495635_0104916 3300046663 Bacteria 1931
233 Ga0495635_0172192 3300046663 Bacteria 1472
234 Ga0495657_0034761 3300046675 Bacteria 3498
235 Ga0495657_0262546 3300046675 Bacteria 1037
236 Ga0495599_0046511 3300046678 Bacteria 2721
237 Ga0495599_0168809 3300046678 Bacteria 1350
238 Ga0495599_0177847 3300046678 Bacteria 1312
239 Ga0495623_0036979 3300046679 Bacteria 3127
240 Ga0495623_0158161 3300046679 Bacteria 1334
241 Ga0495613_0114195 3300046689 Bacteria 1944
242 Ga0495624_0039839 3300046690 Bacteria 3011
243 Ga0495600_0005554 3300046809 Bacteria 7611
244 Ga0495581_0008867 3300047315 Bacteria 5822
245 Ga0495581_0078225 3300047315 Bacteria 1914
246 Ga0495604_0001187 3300047317 Bacteria 21499
247 Ga0495604_0212736 3300047317 Bacteria 1335
248 Ga0495674_0007991 3300047319 Bacteria 10097
249 Ga0495674_0086711 3300047319 Bacteria 2680
250 Ga0495676_0000626 3300047321 Bacteria 29241
251 Ga0495680_0012321 3300047322 Bacteria 7531
252 Ga0495680_0026563 3300047322 Bacteria 4771
253 Ga0495680_0043928 3300047322 Bacteria 3536
254 Ga0495675_0135470 3300047444 Bacteria 1529
255 Ga0495677_0109578 3300047445 Bacteria 1049
256 Ga0495684_0076313 3300047471 Bacteria 2545
257 Ga0495593_0051508 3300047673 Bacteria 2178
258 Ga0496101_0247581 3300048904 Bacteria 1388
259 Ga0496104_0005616 3300048907 Bacteria 10981
260 Ga0496104_0286533 3300048907 Bacteria 1560
261 Ga0496105_0002166 3300048908 Bacteria 14220
262 Ga0496108_0077864 3300048911 Bacteria 2806
263 Ga0496108_0259475 3300048911 Bacteria 1512
264 Ga0496114_0008051 3300048917 Bacteria 8345
265 Ga0496115_0082493 3300048918 Bacteria 2619
266 Ga0496115_0293547 3300048918 Bacteria 1333
267 Ga0496119_0003303 3300048922 Bacteria 16849
268 Ga0496126_0013313 3300048929 Bacteria 8377
269 Ga0496126_0068980 3300048929 Bacteria 3155
270 Ga0501031_0116112 3300049568 Bacteria 1748
271 Ga0501032_0010882 3300049569 Bacteria 6543
272 Ga0501033_0007029 3300049570 Bacteria 8791
273 Ga0501033_0020604 3300049570 Bacteria 4982
274 Ga0501033_0023621 3300049570 Bacteria 4637
275 Ga0501034_0004581 3300049571 Bacteria 15313
276 Ga0501034_0399935 3300049571 Bacteria 1296
277 Ga0501036_0010233 3300049572 Bacteria 7734
278 Ga0501036_0051258 3300049572 Bacteria 3494
279 Ga0501037_0021289 3300049573 Bacteria 4791
280 Ga0501037_0064177 3300049573 Bacteria 2677
281 Ga0501038_0009168 3300049574 Bacteria 9083
282 Ga0501043_0004307 3300049579 Bacteria 11581
283 Ga0501043_0005723 3300049579 Bacteria 10012
284 Ga0501043_0111610 3300049579 Bacteria 2147
285 Ga0501046_0000203 3300049580 Bacteria 61563
286 Ga0501046_0113940 3300049580 Bacteria 2063
287 Ga0501047_0000088 3300049581 Bacteria 117495
288 Ga0501047_0063835 3300049581 Bacteria 3552
289 Ga0501047_0157342 3300049581 Bacteria 2145
290 Ga0501048_0128353 3300049582 Bacteria 1793
291 Ga0501035_0003031 3300049822 Bacteria 16102
292 Ga0501035_0003433 3300049822 Bacteria 15158
293 Ga0501035_0023759 3300049822 Bacteria 5624
294 Ga0501035_0103260 3300049822 Bacteria 2500
295 Ga0501035_0209479 3300049822 Bacteria 1668
296 Ga0501044_0002984 3300049823 Bacteria 19179
297 Ga0501044_0049146 3300049823 Bacteria 4354
298 Ga0501044_0178285 3300049823 Bacteria 2093
299 Ga0501045_0091127 3300049824 Bacteria 2253
300 Ga0501045_0129106 3300049824 Bacteria 1879
301 nmdc:mga03n38_116274_c1 3300050490 Bacteria 1309
302 nmdc:mga00v17_47651_c1 3300050491 Bacteria 2596
303 nmdc:mga00v17_502_c1 3300050491 Bacteria 22028
304 nmdc:mga07m45_1383_c1 3300050496 Bacteria 11071
305 nmdc:mga07m45_38481_c1 3300050496 Bacteria 2669
306 nmdc:mga05p37_357487_c1 3300050507 Bacteria 1718
307 nmdc:mga05p37_9360_c1 3300050507 Bacteria 11594
308 nmdc:mga06r32_115791_c1 3300050510 Bacteria 2640
309 nmdc:mga06r32_5283_c1 3300050510 Bacteria 11617
310 nmdc:mga06r32_67353_c1 3300050510 Bacteria 3456
311 Ga0495601_0001239 3300053077 Bacteria 13997
312 Ga0495601_0004888 3300053077 Bacteria 7779
313 Ga0495601_0060101 3300053077 Bacteria 2411
314 Ga0495612_0001105 3300053078 Bacteria 11047
315 Ga0495619_0005893 3300053085 Bacteria 7766
316 Ga0500560_000730 3300053107 Bacteria 4960
317 Ga0500573_0039231 3300053140 Bacteria 2736
318 Ga0500600_0050979 3300053149 Bacteria 2348
319 Ga0466962_0000119 3300061719 Bacteria 31964
320 2523384236 2523231044 Bacteria 6434991
321 2523386698 2523231044 Bacteria 6434991
322 2552113973 2551306166 Bacteria 9731570
323 2566993942 2565956761 Bacteria 6601618
324 2643853494 2643221567 Bacteria 4163945
325 2643943109 2643221587 Bacteria 7586415
326 2644013859 2643221601 Bacteria 7493239
327 2644137455 2643221624 Bacteria 4384879
328 2644174579 2643221631 Bacteria 8168043
329 2644264318 2643221647 Bacteria 10741251
330 2644430569 2643221677 Bacteria 7584031
331 2644438336 2643221678 Bacteria 9540101
332 2644446068 2643221679 Bacteria 3839507
333 2644502971 2643221690 Bacteria 4654705
334 2644515555 2643221692 Bacteria 7282860
335 2644525310 2643221694 Bacteria 4392972
336 2644669395 2643221722 Bacteria 4247614
337 2738889152 2738541308 Bacteria 7020677
338 2739239629 2738543011 Bacteria 5731169
339 2774394560 2773857762 Bacteria 5971770
340 2793980876 2791355406 Bacteria 11364898
341 2809194584 2808606439 Bacteria 5952208
342 2811842989 2808606982 Bacteria 7791042
343 2812349333 2811994878 Bacteria 5992952
344 2819743625 2818991472 Bacteria 10089953
345 2858868861 2858868258 Bacteria 7683772
346 2861523779 2861520306 Bacteria 8348283
347 2862516146 2862507626 Bacteria 9425308
348 2867370211 2867369537 Bacteria 6501581
349 2873158023 2873151551 Bacteria 8625867
350 2875398274 2875391855 Bacteria 7600475
351 2884994704 2884994152 Bacteria 4492978
352 2889304694 2889300758 Bacteria 5690814
353 2891972963 2891968417 Bacteria 5821697
354 2902583297 2902582711 Bacteria 6187705
355 2904536990 2904535858 Bacteria 6308016
356 2912764553 2912757875 Bacteria 7940295
357 2918508115 2918501144 Bacteria 8668083
358 2922559611 2922554459 Bacteria 6683962
359 2939744920 2939743619 Bacteria 5762299
360 2954008707 2954002825 Bacteria 9173742
361 2954389001 2954380949 Bacteria 10050426
362 2954699742 2954691527 Bacteria 10720516
363 2954702457 2954701450 Bacteria 10834262
364 2954718681 2954711539 Bacteria 10867210
365 2954728652 2954721474 Bacteria 10456478
366 2954733160 2954731030 Bacteria 10243860
367 2954747548 2954740390 Bacteria 10229294
368 2954752040 2954749733 Bacteria 10366972
369 2954766664 2954759201 Bacteria 9358192
370 2990093947 2990088156 Bacteria 6657676
371 2997602545 2997600082 Bacteria 9896405
372 3006426882 3006425503 Bacteria 6491253
373 3006491145 3006486233 Bacteria 8157040
374 8045832424 8045830549 Bacteria 4444727
375 8047893850 8047893842 Bacteria 11723082
376 8048135375 8048127548 Bacteria 11053136
377 8048364866 8048356638 Bacteria 11044339
378 8048370867 8048369669 Bacteria 11666822
379 8048388555 8048379754 Bacteria 11877923
380 8054163229 8054160619 Bacteria 7783213
381 8055418037 8055412473 Bacteria 6257500
382 8056060489 8056060235 Bacteria 7259403
383 Ga0466970_0084751
384 rootH2_10114454
385 JGI25160J50197_1037764
386 Ga0070668_100090804
387 Ga0070671_100000498
388 Ga0070671_100326479
389 Ga0070709_10003067
390 Ga0070714_100017159
391 Ga0070714_100059739
392 Ga0070713_100018938
393 Ga0070713_100063359
394 Ga0070713_100094104
395 Ga0070711_100183396
396 Ga0070681_10056276
397 Ga0070706_100210850
398 Ga0070706_100405320
399 Ga0070698_100032936
400 Ga0070698_100299689
401 Ga0070665_100001234
402 Ga0068856_100050416
403 Ga0068856_100108786
404 Ga0070702_100023082
405 Ga0068863_100013136
406 Ga0068862_100170110
407 Ga0081539_10001008
408 Ga0081539_10009602
409 Ga0081539_10010586
410 Ga0070717_10342438
411 Ga0075365_10093281
412 Ga0075364_10010086
413 Ga0070715_10054666
414 Ga0070716_100019386
415 Ga0070716_100052195
416 Ga0070712_100027350
417 Ga0097621_100368568
418 Ga0075370_10000196
419 Ga0075370_10011353
420 Ga0075428_100000651
421 Ga0075428_100184363
422 Ga0075428_100192670
423 Ga0075431_100066698
424 Ga0075431_100126702
425 Ga0075431_100171626
426 Ga0105244_10038540
427 Ga0114129_10002921
428 Ga0114129_10406399
429 Ga0105243_10001620
430 Ga0105243_10033189
431 Ga0105243_10085141
432 Ga0105237_10183618
433 Ga0157369_10085519
434 Ga0157369_10351075
435 Ga0171462_1001
436 Ga0157378_10004811
437 Ga0163162_10155410
438 Ga0157375_10046921
439 Ga0157375_10841778
440 Ga0163163_10101710
441 Ga0157380_10102116
442 Ga0197907_11408120
443 Ga0206353_10603769
444 Ga0206353_10807658
445 Ga0206353_10916250
446 Ga0213875_10000487
447 Ga0228598_1014577
448 Ga0209758_1005912
449 Ga0207426_1016020
450 Ga0207699_10004341
451 Ga0207699_10049113
452 Ga0207699_10107085
453 Ga0207705_10020553
454 Ga0207684_10173660
455 Ga0207707_10045865
456 Ga0207693_10017247
457 Ga0207693_10040149
458 Ga0207693_10070630
459 Ga0207663_10063348
460 Ga0207660_10006446
461 Ga0207657_10023413
462 Ga0207652_10029472
463 Ga0207700_10082951
464 Ga0207700_10273313
465 Ga0207664_10020245
466 Ga0207664_10072299
467 Ga0207664_10130573
468 Ga0207644_10001027
469 Ga0207709_10000598
470 Ga0207665_10002237
471 Ga0207665_10018120
472 Ga0207661_10033540
473 Ga0207661_10117879
474 Ga0207668_10066467
475 Ga0207677_10233090
476 Ga0207702_10191792
477 Ga0207702_10195455
478 Ga0207648_10067194
479 Ga0207674_10022016
480 Ga0207675_100382825
481 Ga0207683_10113639
482 Ga0207683_10114487
483 Ga0207683_10325548
484 Ga0268266_10042706
485 Ga0265337_1000897
486 Ga0265326_10001864
487 Ga0265319_1001915
488 Ga0265334_10000989
489 Ga0265318_10042494
490 Ga0265323_10003004
491 Ga0265322_10002424
492 Ga0265336_10001676
493 Ga0265338_10005587
494 Ga0265338_10195914
495 Ga0265324_10000927
496 Ga0307511_10117848
497 Ga0265320_10005783
498 Ga0265325_10098004
499 Ga0265340_10002222
500 Ga0265316_10068238
501 Ga0265313_10011135
502 Ga0307508_10003791
503 Ga0307508_10271412
504 Ga0265314_10005075
505 Ga0265342_10005997
506 Ga0307516_10004318
507 Ga0307407_10064690
508 Ga0307407_10097678
509 Ga0307409_100012789
510 Ga0307409_100014406
511 Ga0307416_100413432
512 Ga0307416_100654619
513 Ga0307414_10323045
514 Ga0307415_100043406
515 Ga0307415_100144919
516 Ga0307510_10109723
517 Ga0373926_0002440
518 Ga0373934_0018907
519 Ga0373923_0015963
520 Ga0373936_0002180
521 Ga0373936_0006653
522 Ga0373945_0000246
523 Ga0373953_0084450
524 Ga0373954_0056500
525 Ga0373954_0091277
526 Ga0373956_0036174
527 Ga0373943_0000378
528 Ga0373946_0001361
529 Ga0373955_0078416
530 Ga0373924_0012563
531 Ga0373935_0000481
532 Ga0373933_0034126
533 Ga0373933_0043398
534 Ga0373933_0082980
535 Ga0373947_0000547
536 Ga0373937_0054070
537 Ga0373925_0001636
538 Ga0395899_0056583
539 Ga0395900_0007342
540 Ga0395898_0002245
541 Ga0395898_0018210
542 Ga0395905_0030516
543 Ga0395905_0082008
544 Ga0436364_0218008
545 Ga0395901_0131068
546 Ga0395901_0170288
547 Ga0436363_1240116
548 Ga0439465_0075335
549 Ga0439449_0003158
550 Ga0466969_0000239
551 Ga0466972_0007660
552 Ga0466965_0052562
553 Ga0466966_0008764
554 Ga0466961_0004752
555 Ga0466961_0026837
556 Ga0466961_0205710
557 Ga0466963_0079993
558 Ga0466963_0194412
559 Ga0466964_0110983
560 Ga0453684_0488920
561 Ga0466971_0000303
562 Ga0466970_0002575
563 Ga0466970_0006250
564 Ga0466957_0069708
565 Ga0466957_0289639
566 Ga0466960_0008750
567 Ga0466960_0025836
568 Ga0466960_0170188
569 Ga0466959_0002543
570 Ga0466959_0195846
571 Ga0466958_0028159
572 Ga0466958_0099886
573 Ga0466967_0001481
574 Ga0466967_0002832
575 Ga0466967_0100490
576 Ga0466967_0107389
577 Ga0466967_0181950
578 Ga0466967_0389489
579 Ga0495592_0026296
580 Ga0495592_0037044
581 Ga0495603_0169297
582 Ga0495629_0180610
583 Ga0495641_0010368
584 Ga0495651_0036048
585 Ga0495651_0080448
586 Ga0495653_0034516
587 Ga0495639_0027928
588 Ga0495639_0037978
589 Ga0495664_0008859
590 Ga0495608_0051902
591 Ga0495608_0055107
592 Ga0495618_0051377
593 Ga0495628_0007564
594 Ga0495628_0045135
595 Ga0495628_0104829
596 Ga0495630_0004738
597 Ga0495652_0000734
598 Ga0495665_0013274
599 Ga0495665_0052603
600 Ga0495640_0015183
601 Ga0495640_0065585
602 Ga0495587_0010856
603 Ga0495645_0071650
604 Ga0495645_0219530
605 Ga0495667_0004120
606 Ga0495667_0017589
607 Ga0495667_0028714
608 Ga0495668_0000161
609 Ga0495634_0021895
610 Ga0495634_0025871
611 Ga0495634_0208769
612 Ga0495625_0065249
613 Ga0495635_0012187
614 Ga0495635_0104916
615 Ga0495635_0172192
616 Ga0495657_0034761
617 Ga0495657_0262546
618 Ga0495599_0046511
619 Ga0495599_0168809
620 Ga0495599_0177847
621 Ga0495623_0036979
622 Ga0495623_0158161
623 Ga0495613_0114195
624 Ga0495624_0039839
625 Ga0495600_0005554
626 Ga0495581_0008867
627 Ga0495581_0078225
628 Ga0495604_0001187
629 Ga0495604_0212736
630 Ga0495674_0007991
631 Ga0495674_0086711
632 Ga0495676_0000626
633 Ga0495680_0012321
634 Ga0495680_0026563
635 Ga0495680_0043928
636 Ga0495675_0135470
637 Ga0495677_0109578
638 Ga0495684_0076313
639 Ga0495593_0051508
640 Ga0496101_0247581
641 Ga0496104_0005616
642 Ga0496104_0286533
643 Ga0496105_0002166
644 Ga0496108_0077864
645 Ga0496108_0259475
646 Ga0496114_0008051
647 Ga0496115_0082493
648 Ga0496115_0293547
649 Ga0496119_0003303
650 Ga0496126_0013313
651 Ga0496126_0068980
652 Ga0501031_0116112
653 Ga0501032_0010882
654 Ga0501033_0007029
655 Ga0501033_0020604
656 Ga0501033_0023621
657 Ga0501034_0004581
658 Ga0501034_0399935
659 Ga0501036_0010233
660 Ga0501036_0051258
661 Ga0501037_0021289
662 Ga0501037_0064177
663 Ga0501038_0009168
664 Ga0501043_0004307
665 Ga0501043_0005723
666 Ga0501043_0111610
667 Ga0501046_0000203
668 Ga0501046_0113940
669 Ga0501047_0000088
670 Ga0501047_0063835
671 Ga0501047_0157342
672 Ga0501048_0128353
673 Ga0501035_0003031
674 Ga0501035_0003433
675 Ga0501035_0023759
676 Ga0501035_0103260
677 Ga0501035_0209479
678 Ga0501044_0002984
679 Ga0501044_0049146
680 Ga0501044_0178285
681 Ga0501045_0091127
682 Ga0501045_0129106
683 nmdc:mga03n38_116274_c1
684 nmdc:mga00v17_47651_c1
685 nmdc:mga00v17_502_c1
686 nmdc:mga07m45_1383_c1
687 nmdc:mga07m45_38481_c1
688 nmdc:mga05p37_357487_c1
689 nmdc:mga05p37_9360_c1
690 nmdc:mga06r32_115791_c1
691 nmdc:mga06r32_5283_c1
692 nmdc:mga06r32_67353_c1
693 Ga0495601_0001239
694 Ga0495601_0004888
695 Ga0495601_0060101
696 Ga0495612_0001105
697 Ga0495619_0005893
698 Ga0500560_000730
699 Ga0500573_0039231
700 Ga0500600_0050979
701 Ga0466962_0000119
702 2523384236
703 2523386698
704 2552113973
705 2566993942
706 2643853494
707 2643943109
708 2644013859
709 2644137455
710 2644174579
711 2644264318
712 2644430569
713 2644438336
714 2644446068
715 2644502971
716 2644515555
717 2644525310
718 2644669395
719 2738889152
720 2739239629
721 2774394560
722 2793980876
723 2809194584
724 2811842989
725 2812349333
726 2819743625
727 2858868861
728 2861523779
729 2862516146
730 2867370211
731 2873158023
732 2875398274
733 2884994704
734 2889304694
735 2891972963
736 2902583297
737 2904536990
738 2912764553
739 2918508115
740 2922559611
741 2939744920
742 2954008707
743 2954389001
744 2954699742
745 2954702457
746 2954718681
747 2954728652
748 2954733160
749 2954747548
750 2954752040
751 2954766664
752 2990093947
753 2997602545
754 3006426882
755 3006491145
756 8045832424
757 8047893850
758 8048135375
759 8048364866
760 8048370867
761 8048388555
762 8054163229
763 8055418037
764 8056060489

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

206

335

0.9

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

238

377

0.83

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

88

165

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q1r-assembly1.cif.gz_A crystal structure of putidaredoxin reductase from pseudomonas putida 0.9074 126 157
1yb5-assembly1.cif.gz_A crystal structure of human zeta-crystallin with bound nadp 0.8889 1 303
4rvu-assembly2.cif.gz_C the native structure of mycobacterial rv1454c complexed with nadph 0.8848 1 304
6lhr-assembly2.cif.gz_D crystal structure of the complex between vesicle amine transport-1 and nadp 0.8846 2 304
6tuk-assembly1.cif.gz_B crystal structure of fdr9 0.8838 126 157
ID Description Score Start End Superfamily
af_B0BNC9_147_315_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9411 112 269 3.40.50.720
af_Q9LXZ4_3_339_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9335 3 303 3.90.180.10
af_I1KB52_138_305_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9314 117 271 3.40.50.720
af_I1LVH0_176_320_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9312 113 247 3.40.50.720
af_Q3UNZ8_155_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9301 120 238 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7S2S7N2-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9451 21 306 GO:0016491
AF-A0A355B5N3-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9438 100 303 GO:0008270
GO:0016491
AF-A0A7X4D0G7-F1-model_v4 NADPH:quinone oxidoreductase family protein 0.9427 21 303 GO:0016491
AF-A0A321LKW7-F1-model_v4 Alcohol dehydrogenase 0.9422 1 303 GO:0008270
GO:0016491
AF-A0A845MKT0-F1-model_v4 Zinc-binding dehydrogenase 0.9388 1 303 GO:0016491

Map