F429360

General Info

Members Datasets Scaffolds Average Seq Length
382 206 764 182

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0058161|Ga0453683_0058161_935_1576
Length 213
Sequence MPFDLLFPAASCWTPDNKLGITVNSAKLRPWETVSKETILDHGKFLKVENHVVKLPDGRIIPDWPWLIIPSAAIVLPVTEDGKFLCFRQTKYAVEGTSLATVGGMLEPNETPLDAAKRELREEMGYESIDWVNLGSHILDPNRGIATMHLFLALDVKKAVEQPASDDLEDQQLVVLSRNEIEQALRAGEFKVLAWSAVVAMSLNYLYMSERSS

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
143 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
144 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
145 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
146 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
147 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
148 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
149 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
150 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
156 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
157 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
163 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
164 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
165 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
166 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 1.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.36
Rhizosphere 95.81
Stem 0
Stem Tuber 0
Unclassified 8.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0058161 3300044673 Bacteria 2419
2 SwRhRL3b_contig_3242688 2162886006 Bacteria 1568
3 SwRhRL2b_contig_1665239 2162886007 Bacteria 5204
4 SwRhRL2b_contig_463731 2162886007 Bacteria 7427
5 JGI24743J22301_10002671 3300001991 Bacteria 2725
6 JGI24738J21930_10008145 3300002075 Bacteria 2391
7 Ga0065704_10071041 3300005289 Bacteria 13570
8 Ga0065707_10001018 3300005295 Bacteria 13131
9 Ga0070658_10055548 3300005327 Bacteria 3217
10 Ga0070683_100007662 3300005329 Bacteria 9136
11 Ga0070683_100896392 3300005329 Bacteria 851
12 Ga0070683_101413547 3300005329 Unclassified 669
13 Ga0070670_100220310 3300005331 Bacteria 1651
14 Ga0070677_10064908 3300005333 Bacteria 1518
15 Ga0068869_100056054 3300005334 Bacteria 2873
16 Ga0070680_101140960 3300005336 Unclassified 674
17 Ga0070682_100001845 3300005337 Bacteria 11820
18 Ga0068868_100009554 3300005338 Bacteria 6991
19 Ga0068868_100089934 3300005338 Bacteria 2472
20 Ga0068868_100391630 3300005338 Bacteria 1197
21 Ga0070660_100025665 3300005339 Bacteria 4381
22 Ga0070660_100053516 3300005339 Bacteria 3114
23 Ga0070660_100454101 3300005339 Bacteria 1063
24 Ga0070691_10005845 3300005341 Bacteria 5611
25 Ga0070691_10084881 3300005341 Bacteria 1555
26 Ga0070687_100013032 3300005343 Bacteria 3692
27 Ga0070687_100312488 3300005343 Unclassified 1001
28 Ga0070661_100015784 3300005344 Bacteria 5330
29 Ga0070661_100090472 3300005344 Bacteria 2267
30 Ga0070692_10008375 3300005345 Bacteria 4610
31 Ga0070668_100049706 3300005347 Bacteria 3226
32 Ga0070669_101209542 3300005353 Unclassified 653
33 Ga0070675_100046113 3300005354 Bacteria 3568
34 Ga0070671_100092467 3300005355 Bacteria 2534
35 Ga0070671_100172693 3300005355 Bacteria 1828
36 Ga0070674_100018790 3300005356 Bacteria 4378
37 Ga0070674_100036097 3300005356 Bacteria 3316
38 Ga0070673_100002924 3300005364 Bacteria 10524
39 Ga0070673_101102597 3300005364 Bacteria 741
40 Ga0070688_100006684 3300005365 Bacteria 6181
41 Ga0070659_100013955 3300005366 Bacteria 5996
42 Ga0070659_100018713 3300005366 Bacteria 5229
43 Ga0070667_100179109 3300005367 Unclassified 1874
44 Ga0070701_10007194 3300005438 Bacteria 4738
45 Ga0070701_10036003 3300005438 Bacteria 2491
46 Ga0070705_100065098 3300005440 Bacteria 2181
47 Ga0070700_100103681 3300005441 Bacteria 1878
48 Ga0070663_100013026 3300005455 Bacteria 5283
49 Ga0070663_100130476 3300005455 Bacteria 1908
50 Ga0070662_100029909 3300005457 Bacteria 3806
51 Ga0070681_10107604 3300005458 Bacteria 2729
52 Ga0070681_10924896 3300005458 Unclassified 791
53 Ga0068867_100041776 3300005459 Bacteria 3351
54 Ga0068867_100448136 3300005459 Bacteria 1099
55 Ga0068867_100812279 3300005459 Bacteria 835
56 Ga0070685_10009202 3300005466 Bacteria 5098
57 Ga0070685_10231828 3300005466 Bacteria 1215
58 Ga0070698_100563338 3300005471 Bacteria 1079
59 Ga0070699_100096308 3300005518 Bacteria 2592
60 Ga0070679_100023692 3300005530 Bacteria 6014
61 Ga0070679_100129965 3300005530 Bacteria 2500
62 Ga0070684_100124243 3300005535 Bacteria 2323
63 Ga0070684_100234106 3300005535 Bacteria 1677
64 Ga0070684_100483700 3300005535 Bacteria 1146
65 Ga0068853_100016847 3300005539 Bacteria 6021
66 Ga0068853_100377368 3300005539 Bacteria 1323
67 Ga0070672_100006371 3300005543 Bacteria 7925
68 Ga0070672_100016997 3300005543 Bacteria 5223
69 Ga0070672_100059494 3300005543 Bacteria 3006
70 Ga0070672_100784294 3300005543 Bacteria 838
71 Ga0070695_100097221 3300005545 Bacteria 1977
72 Ga0070693_100169053 3300005547 Bacteria 1398
73 Ga0070704_100112229 3300005549 Bacteria 2076
74 Ga0068855_100137042 3300005563 Bacteria 2792
75 Ga0068855_100955167 3300005563 Bacteria 903
76 Ga0068855_101487137 3300005563 Unclassified 696
77 Ga0070664_100011604 3300005564 Bacteria 7149
78 Ga0070664_100317305 3300005564 Unclassified 1411
79 Ga0068857_100077660 3300005577 Bacteria 2963
80 Ga0068854_100032051 3300005578 Bacteria 3654
81 Ga0068856_100289823 3300005614 Bacteria 1654
82 Ga0070702_100057843 3300005615 Bacteria 2244
83 Ga0070702_100183607 3300005615 Bacteria 1371
84 Ga0068852_100016036 3300005616 Bacteria 5833
85 Ga0068852_100221509 3300005616 Bacteria 1799
86 Ga0068859_100091288 3300005617 Bacteria 3096
87 Ga0068861_100037361 3300005719 Bacteria 3610
88 Ga0068851_10008473 3300005834 Bacteria 4754
89 Ga0068870_10079792 3300005840 Bacteria 1806
90 Ga0068858_100403731 3300005842 Bacteria 1313
91 Ga0068860_100273937 3300005843 Bacteria 1648
92 Ga0068860_100502984 3300005843 Bacteria 1210
93 Ga0068862_100676003 3300005844 Bacteria 998
94 Ga0068862_101047716 3300005844 Bacteria 809
95 Ga0075432_10003418 3300006058 Bacteria 5376
96 Ga0097621_100182284 3300006237 Bacteria 1815
97 Ga0097621_101270270 3300006237 Bacteria 695
98 Ga0068871_100337075 3300006358 Bacteria 1331
99 Ga0068871_100567059 3300006358 Bacteria 1030
100 Ga0075428_100013761 3300006844 Bacteria 9011
101 Ga0075431_100242050 3300006847 Bacteria 1835
102 Ga0075429_100052575 3300006880 Bacteria 3545
103 Ga0075429_100452454 3300006880 Unclassified 1125
104 Ga0068865_100008331 3300006881 Bacteria 6405
105 Ga0068865_100009005 3300006881 Bacteria 6174
106 Ga0068865_100013764 3300006881 Bacteria 5125
107 Ga0097620_100091290 3300006931 Bacteria 3096
108 Ga0111539_10019661 3300009094 Bacteria 8331
109 Ga0111539_10045728 3300009094 Bacteria 5240
110 Ga0105245_10007990 3300009098 Bacteria 9252
111 Ga0105245_10017256 3300009098 Bacteria 6299
112 Ga0105245_10168619 3300009098 Bacteria 2083
113 Ga0105247_10588314 3300009101 Bacteria 823
114 Ga0114129_10032270 3300009147 Bacteria 7401
115 Ga0114129_10050780 3300009147 Bacteria 5824
116 Ga0114129_10664368 3300009147 Bacteria 1344
117 Ga0114129_11650034 3300009147 Bacteria 783
118 Ga0105243_10003687 3300009148 Bacteria 12317
119 Ga0105243_10015396 3300009148 Bacteria 5783
120 Ga0105243_10018657 3300009148 Bacteria 5256
121 Ga0105243_10535367 3300009148 Bacteria 1116
122 Ga0105241_10124757 3300009174 Bacteria 2078
123 Ga0105241_10991307 3300009174 Unclassified 785
124 Ga0105242_10209658 3300009176 Bacteria 1736
125 Ga0105242_10855847 3300009176 Bacteria 905
126 Ga0105248_10204421 3300009177 Bacteria 2226
127 Ga0105238_10070669 3300009551 Bacteria 3490
128 Ga0105249_10032221 3300009553 Bacteria 4741
129 Ga0105239_10140824 3300010375 Bacteria 2687
130 Ga0105239_10327502 3300010375 Bacteria 1728
131 Ga0105246_10082424 3300011119 Bacteria 2295
132 Ga0105246_10124724 3300011119 Bacteria 1914
133 Ga0105246_10165246 3300011119 Bacteria 1690
134 Ga0105246_10423964 3300011119 Bacteria 1111
135 Ga0157371_10019243 3300013102 Bacteria 5038
136 Ga0157369_11398823 3300013105 Unclassified 712
137 Ga0163162_10273778 3300013306 Bacteria 1820
138 Ga0163162_11019875 3300013306 Bacteria 936
139 Ga0157372_10024238 3300013307 Bacteria 6588
140 Ga0157375_10036091 3300013308 Bacteria 4725
141 Ga0157375_10708219 3300013308 Bacteria 1160
142 Ga0157375_10753070 3300013308 Bacteria 1125
143 Ga0163163_10580237 3300014325 Bacteria 1184
144 Ga0157380_10008803 3300014326 Bacteria 7213
145 Ga0157380_10026582 3300014326 Bacteria 4395
146 Ga0157377_10009560 3300014745 Bacteria 4764
147 Ga0157377_10065471 3300014745 Bacteria 2088
148 Ga0157377_10245370 3300014745 Bacteria 1158
149 Ga0157379_10006973 3300014968 Bacteria 9769
150 Ga0157376_10065501 3300014969 Bacteria 3069
151 Ga0163161_10023265 3300017792 Bacteria 4370
152 Ga0163161_10093661 3300017792 Bacteria 2226
153 Ga0207656_10017406 3300025321 Bacteria 2815
154 Ga0207642_10105257 3300025899 Unclassified 1425
155 Ga0207710_10287300 3300025900 Bacteria 829
156 Ga0207688_10006958 3300025901 Bacteria 6154
157 Ga0207688_10011831 3300025901 Bacteria 4748
158 Ga0207688_10043652 3300025901 Bacteria 2497
159 Ga0207680_10901648 3300025903 Unclassified 634
160 Ga0207645_10029489 3300025907 Bacteria 3537
161 Ga0207645_10190391 3300025907 Bacteria 1348
162 Ga0207643_10005158 3300025908 Bacteria 6987
163 Ga0207643_10021081 3300025908 Bacteria 3578
164 Ga0207705_10033799 3300025909 Bacteria 3654
165 Ga0207705_10387141 3300025909 Bacteria 1080
166 Ga0207654_10381624 3300025911 Bacteria 976
167 Ga0207707_10354803 3300025912 Bacteria 1263
168 Ga0207707_10502683 3300025912 Bacteria 1034
169 Ga0207660_10037215 3300025917 Bacteria 3389
170 Ga0207660_10224799 3300025917 Bacteria 1474
171 Ga0207660_10757542 3300025917 Unclassified 792
172 Ga0207662_10007728 3300025918 Bacteria 5856
173 Ga0207657_10003231 3300025919 Bacteria 17441
174 Ga0207657_10030860 3300025919 Bacteria 4858
175 Ga0207649_10013518 3300025920 Bacteria 4557
176 Ga0207652_10055162 3300025921 Bacteria 3417
177 Ga0207681_10629224 3300025923 Bacteria 889
178 Ga0207681_10709050 3300025923 Bacteria 837
179 Ga0207694_10061622 3300025924 Bacteria 2920
180 Ga0207694_10207969 3300025924 Bacteria 1593
181 Ga0207659_10020446 3300025926 Bacteria 4377
182 Ga0207659_10357776 3300025926 Bacteria 1212
183 Ga0207687_10049599 3300025927 Unclassified 2920
184 Ga0207687_10067469 3300025927 Bacteria 2545
185 Ga0207644_10074976 3300025931 Bacteria 2485
186 Ga0207690_10020585 3300025932 Bacteria 4079
187 Ga0207706_10035589 3300025933 Bacteria 4426
188 Ga0207706_10046838 3300025933 Bacteria 3827
189 Ga0207706_10134336 3300025933 Bacteria 2176
190 Ga0207709_10022797 3300025935 Bacteria 3555
191 Ga0207670_10046796 3300025936 Bacteria 2876
192 Ga0207669_10002192 3300025937 Bacteria 8298
193 Ga0207669_10113608 3300025937 Bacteria 1821
194 Ga0207704_10013683 3300025938 Bacteria 4071
195 Ga0207691_10008649 3300025940 Bacteria 9768
196 Ga0207691_10042677 3300025940 Bacteria 4180
197 Ga0207691_10080926 3300025940 Bacteria 2920
198 Ga0207689_10035628 3300025942 Bacteria 4133
199 Ga0207689_10087641 3300025942 Bacteria 2557
200 Ga0207661_10056719 3300025944 Bacteria 3145
201 Ga0207661_10234807 3300025944 Bacteria 1625
202 Ga0207661_10241685 3300025944 Bacteria 1602
203 Ga0207661_11038457 3300025944 Bacteria 755
204 Ga0207679_10420711 3300025945 Bacteria 1179
205 Ga0207679_10512158 3300025945 Bacteria 1072
206 Ga0207679_10733360 3300025945 Bacteria 898
207 Ga0207667_10158851 3300025949 Bacteria 2326
208 Ga0207651_10118243 3300025960 Bacteria 2004
209 Ga0207651_11406970 3300025960 Bacteria 628
210 Ga0207640_10042280 3300025981 Unclassified 2905
211 Ga0207640_10118035 3300025981 Bacteria 1894
212 Ga0207677_10014264 3300026023 Bacteria 4634
213 Ga0207677_10545767 3300026023 Bacteria 1009
214 Ga0207639_10007498 3300026041 Bacteria 7443
215 Ga0207678_10039111 3300026067 Bacteria 4117
216 Ga0207678_10070248 3300026067 Bacteria 3002
217 Ga0207708_10064271 3300026075 Bacteria 2803
218 Ga0207708_10188172 3300026075 Bacteria 1642
219 Ga0207708_10412114 3300026075 Bacteria 1119
220 Ga0207702_10233050 3300026078 Bacteria 1722
221 Ga0207702_10740403 3300026078 Bacteria 970
222 Ga0207648_10035189 3300026089 Bacteria 4413
223 Ga0207648_10900900 3300026089 Bacteria 826
224 Ga0207676_10272548 3300026095 Bacteria 1533
225 Ga0207676_10448367 3300026095 Bacteria 1216
226 Ga0207676_10551400 3300026095 Unclassified 1101
227 Ga0207674_10487288 3300026116 Bacteria 1192
228 Ga0207674_10566098 3300026116 Bacteria 1098
229 Ga0207675_100020800 3300026118 Bacteria 6117
230 Ga0207675_100191108 3300026118 Bacteria 1964
231 Ga0207683_10040756 3300026121 Bacteria 4054
232 Ga0207683_10054763 3300026121 Bacteria 3497
233 Ga0207698_10006129 3300026142 Bacteria 7484
234 Ga0207428_10000267 3300027907 Bacteria 70665
235 Ga0207428_10000282 3300027907 Bacteria 68611
236 Ga0207428_10059006 3300027907 Bacteria 3043
237 Ga0268266_10065283 3300028379 Bacteria 3147
238 Ga0268266_10314630 3300028379 Bacteria 1464
239 Ga0268265_10064956 3300028380 Bacteria 2814
240 Ga0268264_10196259 3300028381 Bacteria 1843
241 Ga0268264_10729255 3300028381 Bacteria 986
242 Ga0265323_10022550 3300028653 Unclassified 2406
243 Ga0265316_10628059 3300031344 Bacteria 760
244 Ga0316575_10009612 3300031665 Bacteria 3542
245 Ga0316575_10018204 3300031665 Bacteria 2675
246 Ga0316579_10007543 3300031691 Bacteria 4497
247 Ga0316579_10039879 3300031691 Bacteria 2177
248 Ga0316579_10419180 3300031691 Unclassified 647
249 Ga0316576_10002867 3300031727 Bacteria 9946
250 Ga0316576_10007276 3300031727 Bacteria 6952
251 Ga0316576_10032304 3300031727 Bacteria 3719
252 Ga0316576_10033320 3300031727 Bacteria 3666
253 Ga0316576_10148757 3300031727 Unclassified 1765
254 Ga0316576_10303497 3300031727 Bacteria 1193
255 Ga0316576_10650194 3300031727 Bacteria 767
256 Ga0316578_10111830 3300031728 Bacteria 1640
257 Ga0316578_10143012 3300031728 Bacteria 1441
258 Ga0316577_10001475 3300031733 Bacteria 11146
259 Ga0316577_10006103 3300031733 Bacteria 6353
260 Ga0316577_10007577 3300031733 Bacteria 5790
261 Ga0316577_10023696 3300031733 Bacteria 3408
262 Ga0316577_10045882 3300031733 Unclassified 2442
263 Ga0316577_10153226 3300031733 Bacteria 1299
264 Ga0316583_10001532 3300032133 Bacteria 7750
265 Ga0316585_10034771 3300032137 Bacteria 1594
266 Ga0316585_10219839 3300032137 Unclassified 628
267 Ga0316580_10000564 3300032139 Bacteria 8671
268 Ga0316593_10008530 3300032168 Bacteria 2860
269 Ga0316593_10117324 3300032168 Bacteria 954
270 Ga0316593_10127423 3300032168 Bacteria 917
271 Ga0316592_1004015 3300033524 Bacteria 2706
272 Ga0316596_1000029 3300033541 Bacteria 14292
273 Ga0373951_0138787 3300035091 Bacteria 674
274 Ga0373941_0097915 3300035115 Bacteria 1017
275 Ga0373941_0129368 3300035115 Bacteria 908
276 Ga0373960_0008532 3300035121 Bacteria 2457
277 Ga0373942_0006482 3300035207 Bacteria 2704
278 Ga0373962_0011771 3300035242 Bacteria 2197
279 Ga0316574_0001515 3300035398 Bacteria 11064
280 Ga0316574_0018945 3300035398 Bacteria 4054
281 Ga0316574_0373159 3300035398 Bacteria 901
282 Ga0373931_0284813 3300035691 Unclassified 1016
283 Ga0316582_0000067 3300036647 Bacteria 26262
284 Ga0316582_0003451 3300036647 Bacteria 7758
285 Ga0316582_0004054 3300036647 Bacteria 7320
286 Ga0316582_0004468 3300036647 Bacteria 7079
287 Ga0316582_0016492 3300036647 Bacteria 4249
288 Ga0316582_0059247 3300036647 Bacteria 2451
289 Ga0316582_0359491 3300036647 Bacteria 1002
290 Ga0316584_0008608 3300036712 Bacteria 7033
291 Ga0316584_0009163 3300036712 Bacteria 6858
292 Ga0316584_0012079 3300036712 Bacteria 6082
293 Ga0316584_0041885 3300036712 Bacteria 3414
294 Ga0316584_0163652 3300036712 Bacteria 1652
295 Ga0316584_0272917 3300036712 Bacteria 1231
296 Ga0316584_0614565 3300036712 Unclassified 752
297 Ga0316581_0002373 3300037588 Bacteria 4496
298 Ga0316581_0002651 3300037588 Bacteria 4321
299 Ga0400484_06610 3300038725 Bacteria 1333
300 Ga0400484_41219 3300038725 Bacteria 1884
301 Ga0400490_42894 3300038726 Bacteria 5942
302 Ga0400483_013101 3300039062 Bacteria 1155
303 Ga0400483_102633 3300039062 Bacteria 3255
304 Ga0400489_12825 3300039093 Unclassified 1090
305 Ga0400489_93214 3300039093 Bacteria 5019
306 Ga0451577_0094175 3300042876 Bacteria 2674
307 Ga0451577_0190570 3300042876 Bacteria 1850
308 Ga0451577_0307297 3300042876 Bacteria 1437
309 Ga0451577_0842650 3300042876 Bacteria 827
310 Ga0453683_0184000 3300044673 Unclassified 1325
311 Ga0453684_0001441 3300044712 Bacteria 67854
312 Ga0453684_0003251 3300044712 Bacteria 37164
313 Ga0453684_0007725 3300044712 Bacteria 19645
314 Ga0453684_0009029 3300044712 Bacteria 17595
315 Ga0453684_0062397 3300044712 Unclassified 4774
316 Ga0453684_0129572 3300044712 Bacteria 3029
317 Ga0453684_0265370 3300044712 Bacteria 1965
318 Ga0453684_0340313 3300044712 Bacteria 1694
319 Ga0453684_0407616 3300044712 Bacteria 1521
320 Ga0453684_0449957 3300044712 Bacteria 1434
321 Ga0453684_0500688 3300044712 Bacteria 1345
322 Ga0453684_0616942 3300044712 Bacteria 1187
323 Ga0451576_0003841 3300045051 Bacteria 20181
324 Ga0451576_0079436 3300045051 Bacteria 3413
325 Ga0451576_0819582 3300045051 Bacteria 977
326 Ga0496101_0009557 3300048904 Bacteria 6377
327 Ga0496101_0453776 3300048904 Bacteria 1011
328 Ga0496104_0103018 3300048907 Bacteria 2734
329 Ga0496105_0128130 3300048908 Unclassified 2093
330 Ga0496106_0120223 3300048909 Bacteria 2053
331 Ga0496110_0199122 3300048913 Bacteria 1819
332 Ga0496111_0039101 3300048914 Bacteria 3400
333 Ga0496114_0081420 3300048917 Bacteria 2735
334 Ga0496114_0508053 3300048917 Bacteria 1066
335 Ga0501031_0244482 3300049568 Bacteria 1166
336 Ga0501032_0085942 3300049569 Bacteria 2091
337 Ga0501036_0227169 3300049572 Bacteria 1567
338 Ga0501037_0172612 3300049573 Bacteria 1536
339 Ga0501038_0171537 3300049574 Bacteria 1756
340 Ga0501039_0093204 3300049575 Bacteria 2347
341 Ga0501039_0190410 3300049575 Unclassified 1613
342 Ga0501039_0489567 3300049575 Bacteria 966
343 Ga0501041_0075804 3300049577 Bacteria 2069
344 Ga0501042_0025646 3300049578 Bacteria 4142
345 Ga0501042_0109696 3300049578 Bacteria 1987
346 Ga0501046_0056725 3300049580 Bacteria 3073
347 Ga0501048_0209385 3300049582 Bacteria 1383
348 Ga0501068_0043839 3300049584 Bacteria 2692
349 Ga0501068_0646864 3300049584 Unclassified 690
350 Ga0501069_0027601 3300049585 Bacteria 3111
351 Ga0501070_0047918 3300049586 Bacteria 3551
352 Ga0501071_0005542 3300049587 Bacteria 8128
353 Ga0501072_0008257 3300049588 Bacteria 7909
354 Ga0501072_0031911 3300049588 Bacteria 4123
355 Ga0501072_0473475 3300049588 Unclassified 991
356 Ga0501074_0098252 3300049590 Bacteria 2096
357 Ga0501074_0323720 3300049590 Bacteria 1095
358 Ga0501075_0130633 3300049591 Bacteria 1913
359 Ga0501076_0013104 3300049592 Bacteria 6208
360 Ga0501077_0002983 3300049593 Bacteria 10152
361 Ga0501077_0023400 3300049593 Bacteria 3917
362 Ga0501079_0026819 3300049741 Bacteria 4417
363 Ga0501079_0103322 3300049741 Bacteria 2210
364 Ga0501079_0165850 3300049741 Unclassified 1723
365 Ga0501080_0045843 3300049742 Bacteria 4071
366 Ga0501080_0150491 3300049742 Bacteria 2151
367 Ga0501081_0017265 3300049743 Bacteria 4774
368 Ga0501081_0571959 3300049743 Bacteria 845
369 Ga0501035_0196356 3300049822 Bacteria 1733
370 Ga0501045_0015833 3300049824 Bacteria 5348
371 Ga0501045_0059296 3300049824 Bacteria 2804
372 Ga0501045_0742712 3300049824 Bacteria 723
373 nmdc:mga05p37_130001_c1 3300050507 Bacteria 3090
374 nmdc:mga05p37_182398_c1 3300050507 Bacteria 2553
375 nmdc:mga09592_439352_c1 3300050508 Unclassified 1126
376 nmdc:mga09592_70735_c1 3300050508 Bacteria 2961
377 nmdc:mga06r32_254567_c1 3300050510 Bacteria 1743
378 nmdc:mga08y16_40516_c1 3300050511 Bacteria 4883
379 nmdc:mga08y16_47413_c1 3300050511 Bacteria 4497
380 nmdc:mga08y16_75966_c1 3300050511 Bacteria 3502
381 Ga0501084_0017659 3300054114 Bacteria 5935
382 Ga0530510_0094283 3300061734 Unclassified 2186
383 Ga0453683_0058161
384 SwRhRL3b_contig_3242688
385 SwRhRL2b_contig_1665239
386 SwRhRL2b_contig_463731
387 JGI24743J22301_10002671
388 JGI24738J21930_10008145
389 Ga0065704_10071041
390 Ga0065707_10001018
391 Ga0070658_10055548
392 Ga0070683_100007662
393 Ga0070683_100896392
394 Ga0070683_101413547
395 Ga0070670_100220310
396 Ga0070677_10064908
397 Ga0068869_100056054
398 Ga0070680_101140960
399 Ga0070682_100001845
400 Ga0068868_100009554
401 Ga0068868_100089934
402 Ga0068868_100391630
403 Ga0070660_100025665
404 Ga0070660_100053516
405 Ga0070660_100454101
406 Ga0070691_10005845
407 Ga0070691_10084881
408 Ga0070687_100013032
409 Ga0070687_100312488
410 Ga0070661_100015784
411 Ga0070661_100090472
412 Ga0070692_10008375
413 Ga0070668_100049706
414 Ga0070669_101209542
415 Ga0070675_100046113
416 Ga0070671_100092467
417 Ga0070671_100172693
418 Ga0070674_100018790
419 Ga0070674_100036097
420 Ga0070673_100002924
421 Ga0070673_101102597
422 Ga0070688_100006684
423 Ga0070659_100013955
424 Ga0070659_100018713
425 Ga0070667_100179109
426 Ga0070701_10007194
427 Ga0070701_10036003
428 Ga0070705_100065098
429 Ga0070700_100103681
430 Ga0070663_100013026
431 Ga0070663_100130476
432 Ga0070662_100029909
433 Ga0070681_10107604
434 Ga0070681_10924896
435 Ga0068867_100041776
436 Ga0068867_100448136
437 Ga0068867_100812279
438 Ga0070685_10009202
439 Ga0070685_10231828
440 Ga0070698_100563338
441 Ga0070699_100096308
442 Ga0070679_100023692
443 Ga0070679_100129965
444 Ga0070684_100124243
445 Ga0070684_100234106
446 Ga0070684_100483700
447 Ga0068853_100016847
448 Ga0068853_100377368
449 Ga0070672_100006371
450 Ga0070672_100016997
451 Ga0070672_100059494
452 Ga0070672_100784294
453 Ga0070695_100097221
454 Ga0070693_100169053
455 Ga0070704_100112229
456 Ga0068855_100137042
457 Ga0068855_100955167
458 Ga0068855_101487137
459 Ga0070664_100011604
460 Ga0070664_100317305
461 Ga0068857_100077660
462 Ga0068854_100032051
463 Ga0068856_100289823
464 Ga0070702_100057843
465 Ga0070702_100183607
466 Ga0068852_100016036
467 Ga0068852_100221509
468 Ga0068859_100091288
469 Ga0068861_100037361
470 Ga0068851_10008473
471 Ga0068870_10079792
472 Ga0068858_100403731
473 Ga0068860_100273937
474 Ga0068860_100502984
475 Ga0068862_100676003
476 Ga0068862_101047716
477 Ga0075432_10003418
478 Ga0097621_100182284
479 Ga0097621_101270270
480 Ga0068871_100337075
481 Ga0068871_100567059
482 Ga0075428_100013761
483 Ga0075431_100242050
484 Ga0075429_100052575
485 Ga0075429_100452454
486 Ga0068865_100008331
487 Ga0068865_100009005
488 Ga0068865_100013764
489 Ga0097620_100091290
490 Ga0111539_10019661
491 Ga0111539_10045728
492 Ga0105245_10007990
493 Ga0105245_10017256
494 Ga0105245_10168619
495 Ga0105247_10588314
496 Ga0114129_10032270
497 Ga0114129_10050780
498 Ga0114129_10664368
499 Ga0114129_11650034
500 Ga0105243_10003687
501 Ga0105243_10015396
502 Ga0105243_10018657
503 Ga0105243_10535367
504 Ga0105241_10124757
505 Ga0105241_10991307
506 Ga0105242_10209658
507 Ga0105242_10855847
508 Ga0105248_10204421
509 Ga0105238_10070669
510 Ga0105249_10032221
511 Ga0105239_10140824
512 Ga0105239_10327502
513 Ga0105246_10082424
514 Ga0105246_10124724
515 Ga0105246_10165246
516 Ga0105246_10423964
517 Ga0157371_10019243
518 Ga0157369_11398823
519 Ga0163162_10273778
520 Ga0163162_11019875
521 Ga0157372_10024238
522 Ga0157375_10036091
523 Ga0157375_10708219
524 Ga0157375_10753070
525 Ga0163163_10580237
526 Ga0157380_10008803
527 Ga0157380_10026582
528 Ga0157377_10009560
529 Ga0157377_10065471
530 Ga0157377_10245370
531 Ga0157379_10006973
532 Ga0157376_10065501
533 Ga0163161_10023265
534 Ga0163161_10093661
535 Ga0207656_10017406
536 Ga0207642_10105257
537 Ga0207710_10287300
538 Ga0207688_10006958
539 Ga0207688_10011831
540 Ga0207688_10043652
541 Ga0207680_10901648
542 Ga0207645_10029489
543 Ga0207645_10190391
544 Ga0207643_10005158
545 Ga0207643_10021081
546 Ga0207705_10033799
547 Ga0207705_10387141
548 Ga0207654_10381624
549 Ga0207707_10354803
550 Ga0207707_10502683
551 Ga0207660_10037215
552 Ga0207660_10224799
553 Ga0207660_10757542
554 Ga0207662_10007728
555 Ga0207657_10003231
556 Ga0207657_10030860
557 Ga0207649_10013518
558 Ga0207652_10055162
559 Ga0207681_10629224
560 Ga0207681_10709050
561 Ga0207694_10061622
562 Ga0207694_10207969
563 Ga0207659_10020446
564 Ga0207659_10357776
565 Ga0207687_10049599
566 Ga0207687_10067469
567 Ga0207644_10074976
568 Ga0207690_10020585
569 Ga0207706_10035589
570 Ga0207706_10046838
571 Ga0207706_10134336
572 Ga0207709_10022797
573 Ga0207670_10046796
574 Ga0207669_10002192
575 Ga0207669_10113608
576 Ga0207704_10013683
577 Ga0207691_10008649
578 Ga0207691_10042677
579 Ga0207691_10080926
580 Ga0207689_10035628
581 Ga0207689_10087641
582 Ga0207661_10056719
583 Ga0207661_10234807
584 Ga0207661_10241685
585 Ga0207661_11038457
586 Ga0207679_10420711
587 Ga0207679_10512158
588 Ga0207679_10733360
589 Ga0207667_10158851
590 Ga0207651_10118243
591 Ga0207651_11406970
592 Ga0207640_10042280
593 Ga0207640_10118035
594 Ga0207677_10014264
595 Ga0207677_10545767
596 Ga0207639_10007498
597 Ga0207678_10039111
598 Ga0207678_10070248
599 Ga0207708_10064271
600 Ga0207708_10188172
601 Ga0207708_10412114
602 Ga0207702_10233050
603 Ga0207702_10740403
604 Ga0207648_10035189
605 Ga0207648_10900900
606 Ga0207676_10272548
607 Ga0207676_10448367
608 Ga0207676_10551400
609 Ga0207674_10487288
610 Ga0207674_10566098
611 Ga0207675_100020800
612 Ga0207675_100191108
613 Ga0207683_10040756
614 Ga0207683_10054763
615 Ga0207698_10006129
616 Ga0207428_10000267
617 Ga0207428_10000282
618 Ga0207428_10059006
619 Ga0268266_10065283
620 Ga0268266_10314630
621 Ga0268265_10064956
622 Ga0268264_10196259
623 Ga0268264_10729255
624 Ga0265323_10022550
625 Ga0265316_10628059
626 Ga0316575_10009612
627 Ga0316575_10018204
628 Ga0316579_10007543
629 Ga0316579_10039879
630 Ga0316579_10419180
631 Ga0316576_10002867
632 Ga0316576_10007276
633 Ga0316576_10032304
634 Ga0316576_10033320
635 Ga0316576_10148757
636 Ga0316576_10303497
637 Ga0316576_10650194
638 Ga0316578_10111830
639 Ga0316578_10143012
640 Ga0316577_10001475
641 Ga0316577_10006103
642 Ga0316577_10007577
643 Ga0316577_10023696
644 Ga0316577_10045882
645 Ga0316577_10153226
646 Ga0316583_10001532
647 Ga0316585_10034771
648 Ga0316585_10219839
649 Ga0316580_10000564
650 Ga0316593_10008530
651 Ga0316593_10117324
652 Ga0316593_10127423
653 Ga0316592_1004015
654 Ga0316596_1000029
655 Ga0373951_0138787
656 Ga0373941_0097915
657 Ga0373941_0129368
658 Ga0373960_0008532
659 Ga0373942_0006482
660 Ga0373962_0011771
661 Ga0316574_0001515
662 Ga0316574_0018945
663 Ga0316574_0373159
664 Ga0373931_0284813
665 Ga0316582_0000067
666 Ga0316582_0003451
667 Ga0316582_0004054
668 Ga0316582_0004468
669 Ga0316582_0016492
670 Ga0316582_0059247
671 Ga0316582_0359491
672 Ga0316584_0008608
673 Ga0316584_0009163
674 Ga0316584_0012079
675 Ga0316584_0041885
676 Ga0316584_0163652
677 Ga0316584_0272917
678 Ga0316584_0614565
679 Ga0316581_0002373
680 Ga0316581_0002651
681 Ga0400484_06610
682 Ga0400484_41219
683 Ga0400490_42894
684 Ga0400483_013101
685 Ga0400483_102633
686 Ga0400489_12825
687 Ga0400489_93214
688 Ga0451577_0094175
689 Ga0451577_0190570
690 Ga0451577_0307297
691 Ga0451577_0842650
692 Ga0453683_0184000
693 Ga0453684_0001441
694 Ga0453684_0003251
695 Ga0453684_0007725
696 Ga0453684_0009029
697 Ga0453684_0062397
698 Ga0453684_0129572
699 Ga0453684_0265370
700 Ga0453684_0340313
701 Ga0453684_0407616
702 Ga0453684_0449957
703 Ga0453684_0500688
704 Ga0453684_0616942
705 Ga0451576_0003841
706 Ga0451576_0079436
707 Ga0451576_0819582
708 Ga0496101_0009557
709 Ga0496101_0453776
710 Ga0496104_0103018
711 Ga0496105_0128130
712 Ga0496106_0120223
713 Ga0496110_0199122
714 Ga0496111_0039101
715 Ga0496114_0081420
716 Ga0496114_0508053
717 Ga0501031_0244482
718 Ga0501032_0085942
719 Ga0501036_0227169
720 Ga0501037_0172612
721 Ga0501038_0171537
722 Ga0501039_0093204
723 Ga0501039_0190410
724 Ga0501039_0489567
725 Ga0501041_0075804
726 Ga0501042_0025646
727 Ga0501042_0109696
728 Ga0501046_0056725
729 Ga0501048_0209385
730 Ga0501068_0043839
731 Ga0501068_0646864
732 Ga0501069_0027601
733 Ga0501070_0047918
734 Ga0501071_0005542
735 Ga0501072_0008257
736 Ga0501072_0031911
737 Ga0501072_0473475
738 Ga0501074_0098252
739 Ga0501074_0323720
740 Ga0501075_0130633
741 Ga0501076_0013104
742 Ga0501077_0002983
743 Ga0501077_0023400
744 Ga0501079_0026819
745 Ga0501079_0103322
746 Ga0501079_0165850
747 Ga0501080_0045843
748 Ga0501080_0150491
749 Ga0501081_0017265
750 Ga0501081_0571959
751 Ga0501035_0196356
752 Ga0501045_0015833
753 Ga0501045_0059296
754 Ga0501045_0742712
755 nmdc:mga05p37_130001_c1
756 nmdc:mga05p37_182398_c1
757 nmdc:mga09592_439352_c1
758 nmdc:mga09592_70735_c1
759 nmdc:mga06r32_254567_c1
760 nmdc:mga08y16_40516_c1
761 nmdc:mga08y16_47413_c1
762 nmdc:mga08y16_75966_c1
763 Ga0501084_0017659
764 Ga0530510_0094283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

69

196

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
2w4e-assembly1.cif.gz_B structure of an n-terminally truncated nudix hydrolase dr2204 from deinococcus radiodurans 0.9212 48 187
2w4e-assembly1.cif.gz_A structure of an n-terminally truncated nudix hydrolase dr2204 from deinococcus radiodurans 0.9075 48 187
2w4e-assembly1.cif.gz_B structure of an n-terminally truncated nudix hydrolase dr2204 from deinococcus radiodurans 0.9014 48 187
2w4e-assembly1.cif.gz_A structure of an n-terminally truncated nudix hydrolase dr2204 from deinococcus radiodurans 0.8642 48 187
5c7q-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.8472 8 185
ID Description Score Start End Superfamily
2w4eB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9212 48 187 3.90.79.10
2w4eB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9014 48 187 3.90.79.10
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.846 8 185 3.90.79.10
af_Q9VB64_40_211_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8411 47 162 3.90.79.10
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8246 8 185 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A3D5B7F4-F1-model_v4 NUDIX hydrolase 0.9842 6 180 GO:0005829
GO:0006753
GO:0016787
GO:0019693
AF-A0A3N5KRF9-F1-model_v4 NUDIX hydrolase 0.9718 6 185 GO:0016787
AF-A0A7C5QMZ4-F1-model_v4 NUDIX hydrolase 0.9701 39 180 GO:0016787
AF-A0A2N2P171-F1-model_v4 NUDIX hydrolase 0.9628 6 193 GO:0005829
GO:0006753
GO:0016787
GO:0019693
AF-A0A3D5B7F4-F1-model_v4 NUDIX hydrolase 0.9625 6 180 GO:0005829
GO:0006753
GO:0016787
GO:0019693

Map