metagRoot

F429301

General Info

Members	Datasets	Scaffolds	Average Seq Length
382	225	383	132

Family's Representative Sequence

Representative Sequence	3300028800\|Ga0265338_10334810\|Ga0265338_103348102
Length	150
Sequence	MRLHDLKPRPGAKHRRKRLGQGESFEGGQMPLIRRMPKRGFNNANFTIRYLPVNLESLNRFDDGATVDIKALRDLGLAKGPGNAQRIKILGNGELKKKLVVNAHAFSASAKSKIEGLGGTCTVLVIPGPAPKIPASEKAKKAAAKTPEVK

Samples

	Sample ID	Description	Type	Environment
1	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
2	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
3	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
4	3300003575	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
5	3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
6	3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
7	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
8	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
9	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
10	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
11	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
12	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
13	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
14	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
15	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
16	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
17	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
18	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
19	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
20	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
21	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
22	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
23	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
24	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
25	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
26	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
27	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
28	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
29	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
30	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
31	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
32	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
33	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
34	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
35	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
36	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
37	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
38	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
39	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
40	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
41	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
42	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
43	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
44	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
45	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
46	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
47	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
48	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
49	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
50	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
51	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
52	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
53	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
54	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
55	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
56	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
57	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
58	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
59	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
60	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
61	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
62	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
63	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
64	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
65	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
66	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
67	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
68	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
69	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
70	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
71	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
72	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
73	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
74	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
75	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
76	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
77	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
78	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
109	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
111	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
112	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
113	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
114	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
115	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
116	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
117	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
118	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
119	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
120	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
121	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
122	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
123	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
124	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
125	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
126	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
127	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
128	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
129	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
130	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
131	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
132	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
133	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
134	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
135	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
136	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
137	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
138	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
139	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
140	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
141	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
142	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
143	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
144	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
145	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
146	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
147	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
148	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
149	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
150	3300041461	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT	Metatranscriptome	Rhizoplane
151	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
152	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
153	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
154	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
155	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
156	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
157	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
158	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
159	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
160	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
161	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
162	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
163	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
164	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
165	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
166	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
167	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
168	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
169	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
170	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
171	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
172	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
173	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
174	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
175	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
176	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
177	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
178	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
179	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
180	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
181	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
182	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
183	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
184	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
185	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
186	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
187	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
188	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
189	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
190	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
191	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
192	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
193	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
194	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
195	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
196	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
197	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
198	3300049528	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
199	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
200	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
201	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
202	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
203	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
204	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
205	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
206	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
207	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
208	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
209	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
210	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
211	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
212	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
213	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
214	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
215	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
216	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
217	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
218	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
219	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
220	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
221	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
222	3300059492	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
223	3300059624	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
224	3300059645	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
225	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.91
Metatranscriptomes	2.09
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	1.57
Rhizosphere	97.12
Stem	0
Stem Tuber	0
Unclassified	1.31

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10128513	3300001979	Unclassified	633
2	JGI24743J22301_10000748	3300001991	Bacteria	4062
3	rootH1_10007007	3300003316	Bacteria	7034
4	rootH1_10007007	3300003323	Bacteria	6457
5	Ga0007409J51694_1182499	3300003575	Bacteria	714
6	Ga0058863_11864930	3300004799	Bacteria	2105
7	Ga0058861_11687878	3300004800	Bacteria	1011
8	Ga0065707_10257723	3300005295	Bacteria	1106
9	Ga0070658_10095577	3300005327	Bacteria	2453
10	Ga0070658_10210604	3300005327	Unclassified	1642
11	Ga0070676_10728661	3300005328	Unclassified	726
12	Ga0070683_100598936	3300005329	Bacteria	1055
13	Ga0070683_101421045	3300005329	Bacteria	667
14	Ga0070690_100136559	3300005330	Bacteria	1661
15	Ga0068869_100621696	3300005334	Bacteria	914
16	Ga0070666_10015396	3300005335	Bacteria	4878
17	Ga0070666_10123770	3300005335	Bacteria	1794
18	Ga0068868_100059106	3300005338	Bacteria	3032
19	Ga0070689_100001047	3300005340	Bacteria	17395
20	Ga0070689_100824514	3300005340	Unclassified	817
21	Ga0070689_101910587	3300005340	Bacteria	542
22	Ga0070691_10118192	3300005341	Bacteria	1332
23	Ga0070687_100100390	3300005343	Bacteria	1619
24	Ga0070668_100620871	3300005347	Bacteria	947
25	Ga0070675_100087513	3300005354	Bacteria	2605
26	Ga0070671_100297462	3300005355	Bacteria	1374
27	Ga0070674_100445735	3300005356	Bacteria	1067
28	Ga0070673_100084154	3300005364	Bacteria	2586
29	Ga0070673_101349037	3300005364	Bacteria	670
30	Ga0070688_100200380	3300005365	Bacteria	1396
31	Ga0070688_100374652	3300005365	Bacteria	1048
32	Ga0070667_100219477	3300005367	Bacteria	1692
33	Ga0070714_100004475	3300005435	Bacteria	10531
34	Ga0070714_100428533	3300005435	Bacteria	1254
35	Ga0070713_101806556	3300005436	Unclassified	593
36	Ga0070711_100794500	3300005439	Unclassified	802
37	Ga0070705_100022698	3300005440	Bacteria	3357
38	Ga0070700_100505664	3300005441	Unclassified	930
39	Ga0070678_100181546	3300005456	Bacteria	1723
40	Ga0070681_10035935	3300005458	Bacteria	4977
41	Ga0070681_10818120	3300005458	Unclassified	849
42	Ga0070685_10359027	3300005466	Bacteria	998
43	Ga0070679_100407706	3300005530	Unclassified	1305
44	Ga0070686_100010098	3300005544	Bacteria	5313
45	Ga0070686_100020934	3300005544	Bacteria	3879
46	Ga0070686_100232529	3300005544	Bacteria	1338
47	Ga0070704_100261119	3300005549	Bacteria	1427
48	Ga0070704_100520608	3300005549	Bacteria	1035
49	Ga0068855_100069868	3300005563	Bacteria	4086
50	Ga0068856_100004352	3300005614	Bacteria	14113
51	Ga0068856_100006825	3300005614	Bacteria	11171
52	Ga0070702_100292498	3300005615	Bacteria	1123
53	Ga0068859_100246035	3300005617	Bacteria	1878
54	Ga0068859_100404555	3300005617	Bacteria	1461
55	Ga0068864_102194094	3300005618	Bacteria	559
56	Ga0068870_10085626	3300005840	Unclassified	1752
57	Ga0068863_100189864	3300005841	Bacteria	1974
58	Ga0068863_100935371	3300005841	Unclassified	868
59	Ga0068858_100377931	3300005842	Bacteria	1359
60	Ga0068858_100444196	3300005842	Unclassified	1249
61	Ga0068860_100049052	3300005843	Bacteria	4024
62	Ga0068862_100404625	3300005844	Bacteria	1277
63	Ga0070712_100370403	3300006175	Bacteria	1177
64	Ga0097621_100008773	3300006237	Bacteria	7304
65	Ga0097621_100957898	3300006237	Unclassified	799
66	Ga0068871_100391710	3300006358	Bacteria	1236
67	Ga0068871_100682155	3300006358	Bacteria	940
68	Ga0075428_100001579	3300006844	Bacteria	24421
69	Ga0075428_100393275	3300006844	Bacteria	1486
70	Ga0075428_100890473	3300006844	Unclassified	944
71	Ga0075430_100377056	3300006846	Bacteria	1171
72	Ga0075430_100399337	3300006846	Bacteria	1135
73	Ga0075430_101021182	3300006846	Bacteria	681
74	Ga0075431_100080459	3300006847	Bacteria	3364
75	Ga0075431_100701985	3300006847	Unclassified	989
76	Ga0075431_101320090	3300006847	Unclassified	682
77	Ga0075429_100072679	3300006880	Bacteria	2995
78	Ga0075429_100113811	3300006880	Bacteria	2365
79	Ga0068865_100507637	3300006881	Bacteria	1006
80	Ga0097620_100246054	3300006931	Bacteria	1878
81	Ga0097620_100404600	3300006931	Bacteria	1461
82	Ga0075435_100290019	3300007076	Bacteria	1398
83	Ga0099795_10471660	3300007788	Bacteria	581
84	Ga0105240_10002989	3300009093	Bacteria	26600
85	Ga0105240_10063083	3300009093	Bacteria	4611
86	Ga0111539_10009658	3300009094	Bacteria	12178
87	Ga0111539_10083379	3300009094	Bacteria	3759
88	Ga0111539_10654806	3300009094	Bacteria	1223
89	Ga0105241_10456917	3300009174	Bacteria	1131
90	Ga0105242_10130315	3300009176	Bacteria	2170
91	Ga0105242_10151642	3300009176	Bacteria	2021
92	Ga0105248_10468696	3300009177	Bacteria	1420
93	Ga0105248_10652845	3300009177	Bacteria	1187
94	Ga0105248_11375302	3300009177	Unclassified	799
95	Ga0105238_10068554	3300009551	Bacteria	3548
96	Ga0105249_10234861	3300009553	Bacteria	1810
97	Ga0105249_11479733	3300009553	Bacteria	751
98	Ga0157370_10119745	3300013104	Bacteria	2458
99	Ga0157370_10994623	3300013104	Bacteria	759
100	Ga0157369_10307894	3300013105	Unclassified	1647
101	Ga0157374_10071814	3300013296	Bacteria	3265
102	Ga0157374_10433969	3300013296	Unclassified	1313
103	Ga0157374_11386287	3300013296	Bacteria	726
104	Ga0157378_10203573	3300013297	Unclassified	1873
105	Ga0157378_10390045	3300013297	Bacteria	1369
106	Ga0157378_11195345	3300013297	Bacteria	800
107	Ga0163162_10267201	3300013306	Bacteria	1842
108	Ga0163162_10396067	3300013306	Bacteria	1513
109	Ga0163162_10640653	3300013306	Bacteria	1187
110	Ga0157372_10240224	3300013307	Bacteria	2102
111	Ga0157375_10000037	3300013308	Bacteria	176523
112	Ga0157375_10236177	3300013308	Bacteria	1987
113	Ga0157375_10378263	3300013308	Bacteria	1583
114	Ga0157375_10652996	3300013308	Unclassified	1208
115	Ga0163163_10000212	3300014325	Bacteria	60199
116	Ga0163163_10028664	3300014325	Bacteria	5350
117	Ga0163163_11908838	3300014325	Bacteria	654
118	Ga0157379_10519342	3300014968	Unclassified	1105
119	Ga0157376_10305189	3300014969	Bacteria	1508
120	Ga0157376_10736359	3300014969	Bacteria	994
121	Ga0213876_10000361	3300021384	Bacteria	38897
122	Ga0207697_10031631	3300025315	Bacteria	2165
123	Ga0207688_10042403	3300025901	Bacteria	2533
124	Ga0207680_10010521	3300025903	Bacteria	4631
125	Ga0207680_10150458	3300025903	Bacteria	1551
126	Ga0207705_10086158	3300025909	Bacteria	2295
127	Ga0207707_10051751	3300025912	Bacteria	3576
128	Ga0207695_10029957	3300025913	Bacteria	6001
129	Ga0207695_10037437	3300025913	Bacteria	5234
130	Ga0207695_10927087	3300025913	Bacteria	750
131	Ga0207693_10456821	3300025915	Unclassified	998
132	Ga0207657_11134874	3300025919	Unclassified	596
133	Ga0207652_10544536	3300025921	Unclassified	1043
134	Ga0207694_10043537	3300025924	Bacteria	3465
135	Ga0207687_10716282	3300025927	Bacteria	850
136	Ga0207700_10969757	3300025928	Unclassified	761
137	Ga0207664_10001982	3300025929	Bacteria	13482
138	Ga0207664_10322643	3300025929	Bacteria	1363
139	Ga0207644_10347232	3300025931	Bacteria	1204
140	Ga0207686_10423964	3300025934	Bacteria	1018
141	Ga0207670_10026107	3300025936	Bacteria	3678
142	Ga0207670_10291120	3300025936	Bacteria	1276
143	Ga0207670_10791938	3300025936	Bacteria	789
144	Ga0207669_10516235	3300025937	Unclassified	959
145	Ga0207704_10416804	3300025938	Bacteria	1064
146	Ga0207665_10391780	3300025939	Bacteria	1056
147	Ga0207711_10947147	3300025941	Unclassified	800
148	Ga0207661_10051419	3300025944	Bacteria	3288
149	Ga0207667_10100965	3300025949	Bacteria	2976
150	Ga0207651_10276024	3300025960	Bacteria	1387
151	Ga0207658_10137117	3300025986	Bacteria	1975
152	Ga0207677_10458291	3300026023	Bacteria	1094
153	Ga0207703_10321077	3300026035	Unclassified	1418
154	Ga0207703_10952115	3300026035	Unclassified	823
155	Ga0207708_10597765	3300026075	Unclassified	934
156	Ga0207702_10001362	3300026078	Bacteria	24381
157	Ga0207702_10003580	3300026078	Bacteria	14118
158	Ga0207641_10024032	3300026088	Bacteria	5022
159	Ga0207641_10356466	3300026088	Bacteria	1395
160	Ga0207641_11326897	3300026088	Bacteria	720
161	Ga0207676_10278886	3300026095	Bacteria	1517
162	Ga0207674_10179878	3300026116	Bacteria	2066
163	Ga0207675_101085632	3300026118	Unclassified	820
164	Ga0207683_10331125	3300026121	Bacteria	1396
165	Ga0207428_10246419	3300027907	Bacteria	1333
166	Ga0268264_10366418	3300028381	Bacteria	1376
167	Ga0265337_1002415	3300028556	Bacteria	8596
168	Ga0265326_10001638	3300028558	Bacteria	7751
169	Ga0265319_1024377	3300028563	Bacteria	2179
170	Ga0265334_10095986	3300028573	Bacteria	1077
171	Ga0265322_10067793	3300028654	Unclassified	1012
172	Ga0265338_10000105	3300028800	Bacteria	156108
173	Ga0265338_10000135	3300028800	Bacteria	135743
174	Ga0265338_10007414	3300028800	Bacteria	13622
175	Ga0265338_10010461	3300028800	Bacteria	10871
176	Ga0265338_10017285	3300028800	Bacteria	7784
177	Ga0265338_10022741	3300028800	Bacteria	6474
178	Ga0265338_10069919	3300028800	Bacteria	3013
179	Ga0265338_10071479	3300028800	Bacteria	2968
180	Ga0265338_10085242	3300028800	Bacteria	2634
181	Ga0265338_10334810	3300028800	Bacteria	1092
182	Ga0265324_10000614	3300029957	Bacteria	24339
183	Ga0265324_10002113	3300029957	Bacteria	10473
184	Ga0265324_10020426	3300029957	Bacteria	2380
185	Ga0265324_10030895	3300029957	Bacteria	1878
186	Ga0265324_10100369	3300029957	Bacteria	984
187	Ga0265332_10086432	3300031238	Bacteria	1328
188	Ga0265320_10253701	3300031240	Bacteria	780
189	Ga0265325_10104178	3300031241	Bacteria	1386
190	Ga0265340_10007372	3300031247	Bacteria	5973
191	Ga0265339_10011597	3300031249	Bacteria	5416
192	Ga0265331_10104293	3300031250	Bacteria	1303
193	Ga0265331_10121343	3300031250	Bacteria	1195
194	Ga0265327_10002213	3300031251	Bacteria	21222
195	Ga0265327_10004484	3300031251	Bacteria	12338
196	Ga0265327_10019720	3300031251	Bacteria	4135
197	Ga0265316_10644914	3300031344	Bacteria	749
198	Ga0265314_10494537	3300031711	Bacteria	645
199	Ga0265342_10095370	3300031712	Bacteria	1701
200	Ga0307413_10990790	3300031824	Bacteria	720
201	Ga0307416_101420661	3300032002	Bacteria	800
202	Ga0373938_0145535	3300034957	Bacteria	627
203	Ga0373926_0004254	3300035083	Unclassified	4680
204	Ga0373951_0048859	3300035091	Bacteria	1037
205	Ga0373923_0271026	3300035111	Bacteria	798
206	Ga0373945_0029895	3300035116	Bacteria	1917
207	Ga0373954_0359311	3300035118	Unclassified	719
208	Ga0373956_0505918	3300035119	Bacteria	576
209	Ga0373943_0203429	3300035170	Bacteria	1097
210	Ga0373955_0728336	3300035172	Bacteria	609
211	Ga0373931_0381994	3300035691	Bacteria	888
212	Ga0373931_0543283	3300035691	Bacteria	754
213	Ga0373931_0898965	3300035691	Bacteria	595
214	Ga0373935_0032404	3300035692	Bacteria	3248
215	Ga0373927_0001357	3300035695	Bacteria	18448
216	Ga0373947_0134420	3300035725	Bacteria	1581
217	Ga0373947_0845120	3300035725	Bacteria	625
218	Ga0373937_0052485	3300036401	Bacteria	3738
219	Ga0373937_0287542	3300036401	Bacteria	1553
220	Ga0373937_0331794	3300036401	Unclassified	1440
221	Ga0373937_1904026	3300036401	Unclassified	541
222	Ga0316584_0043257	3300036712	Bacteria	3359
223	Ga0373925_0005962	3300037068	Bacteria	9028
224	Ga0373925_0022607	3300037068	Bacteria	4589
225	Ga0395899_0000039	3300037312	Bacteria	269620
226	Ga0395898_0000226	3300037466	Bacteria	144727
227	Ga0436364_0785290	3300037853	Bacteria	2181
228	Ga0436365_1383407	3300039437	Bacteria	77328
229	Ga0451793_0091554	3300041452	Bacteria	824
230	Ga0451805_068142	3300041461	Unclassified	903
231	Ga0451807_2359324	3300041486	Bacteria	1165
232	Ga0451835_0921120	3300041492	Bacteria	562
233	Ga0451577_0001340	3300042876	Bacteria	33403
234	Ga0451577_0018671	3300042876	Bacteria	6383
235	Ga0451577_0131160	3300042876	Bacteria	2248
236	Ga0451577_0575049	3300042876	Bacteria	1023
237	Ga0451577_1412934	3300042876	Bacteria	617
238	Ga0466964_0005699	3300044706	Bacteria	4634
239	Ga0453684_0000532	3300044712	Bacteria	145255
240	Ga0453684_0008216	3300044712	Bacteria	18819
241	Ga0453684_0017342	3300044712	Bacteria	11158
242	Ga0453684_0023833	3300044712	Bacteria	8984
243	Ga0453684_0054509	3300044712	Bacteria	5208
244	Ga0453684_0180693	3300044712	Bacteria	2477
245	Ga0453684_0269206	3300044712	Bacteria	1948
246	Ga0453684_0892913	3300044712	Bacteria	952
247	Ga0466971_0000005	3300044719	Bacteria	137073
248	Ga0466957_0059454	3300044842	Bacteria	2343
249	Ga0466959_0690388	3300045049	Bacteria	684
250	Ga0451576_0036193	3300045051	Bacteria	5234
251	Ga0451576_0173056	3300045051	Bacteria	2254
252	Ga0451576_0173886	3300045051	Bacteria	2248
253	Ga0451576_0182561	3300045051	Bacteria	2191
254	Ga0451576_0230720	3300045051	Unclassified	1933
255	Ga0451576_0359641	3300045051	Bacteria	1524
256	Ga0451576_0657598	3300045051	Unclassified	1101
257	Ga0451576_0729607	3300045051	Unclassified	1041
258	Ga0451576_1005904	3300045051	Unclassified	874
259	Ga0466967_0088574	3300045976	Bacteria	2809
260	Ga0495592_0000015	3300046454	Bacteria	145683
261	Ga0495592_0525615	3300046454	Unclassified	731
262	Ga0495629_0070936	3300046459	Bacteria	2431
263	Ga0495629_0967503	3300046459	Bacteria	555
264	Ga0495641_0016861	3300046461	Bacteria	3830
265	Ga0495651_0060453	3300046462	Bacteria	2902
266	Ga0495651_0125409	3300046462	Unclassified	1881
267	Ga0495653_0526468	3300046463	Bacteria	734
268	Ga0495582_0006802	3300046473	Bacteria	6363
269	Ga0495582_0211262	3300046473	Bacteria	1109
270	Ga0495662_0236940	3300046476	Bacteria	899
271	Ga0495664_0171619	3300046477	Bacteria	1315
272	Ga0495618_0001289	3300046514	Bacteria	16917
273	Ga0495618_0564722	3300046514	Bacteria	680
274	Ga0495628_0000722	3300046516	Bacteria	30647
275	Ga0495628_0094980	3300046516	Bacteria	2304
276	Ga0495630_0000076	3300046517	Bacteria	77289
277	Ga0495630_0009669	3300046517	Bacteria	6935
278	Ga0495630_0631558	3300046517	Bacteria	820
279	Ga0495666_0005257	3300046526	Bacteria	6529
280	Ga0495666_0069860	3300046526	Bacteria	1670
281	Ga0495652_0019958	3300046529	Bacteria	5960
282	Ga0495665_0044128	3300046531	Bacteria	2370
283	Ga0495640_0005038	3300046533	Bacteria	10496
284	Ga0495640_0080884	3300046533	Bacteria	2160
285	Ga0495640_0103649	3300046533	Bacteria	1865
286	Ga0495586_0000001	3300046535	Bacteria	231314
287	Ga0495586_0000979	3300046535	Bacteria	16168
288	Ga0495586_0087260	3300046535	Bacteria	1720
289	Ga0495586_0151351	3300046535	Archaea	1305
290	Ga0495621_0348459	3300046539	Unclassified	621
291	Ga0495645_0019740	3300046543	Bacteria	4855
292	Ga0495645_0122263	3300046543	Bacteria	1832
293	Ga0495645_0228346	3300046543	Bacteria	1248
294	Ga0495667_0704399	3300046559	Bacteria	626
295	Ga0495634_0007513	3300046642	Bacteria	8171
296	Ga0495634_0100650	3300046642	Bacteria	1867
297	Ga0495634_0251579	3300046642	Bacteria	1081
298	Ga0495635_0080101	3300046663	Bacteria	2235
299	Ga0495635_0366442	3300046663	Bacteria	960
300	Ga0495599_0002301	3300046678	Bacteria	11109
301	Ga0495599_0498700	3300046678	Bacteria	717
302	Ga0495646_0128418	3300046680	Bacteria	1429
303	Ga0495647_0007682	3300046681	Bacteria	3621
304	Ga0495658_0075050	3300046683	Bacteria	1972
305	Ga0495658_0080901	3300046683	Bacteria	1906
306	Ga0495658_0900739	3300046683	Unclassified	565
307	Ga0495669_0620529	3300046684	Unclassified	526
308	Ga0495613_0134368	3300046689	Bacteria	1770
309	Ga0495613_0225146	3300046689	Bacteria	1315
310	Ga0495624_0052468	3300046690	Bacteria	2577
311	Ga0495581_0314196	3300047315	Bacteria	915
312	Ga0495581_0475221	3300047315	Unclassified	727
313	Ga0495674_0000992	3300047319	Bacteria	27284
314	Ga0495674_0009667	3300047319	Bacteria	9156
315	Ga0495676_0008529	3300047321	Bacteria	9393
316	Ga0495676_0287745	3300047321	Bacteria	1111
317	Ga0495675_0187458	3300047444	Bacteria	1264
318	Ga0495684_0533871	3300047471	Bacteria	801
319	Ga0495684_0822724	3300047471	Bacteria	605
320	Ga0495684_0842262	3300047471	Unclassified	596
321	Ga0495614_0332426	3300048089	Unclassified	706
322	Ga0496106_0096451	3300048909	Bacteria	2288
323	Ga0496107_0029552	3300048910	Bacteria	3900
324	Ga0496115_0002169	3300048918	Bacteria	14046
325	Ga0501312_045279	3300049528	Bacteria	729
326	Ga0501031_0000292	3300049568	Bacteria	28530
327	Ga0501031_0000635	3300049568	Bacteria	20764
328	Ga0501031_0012892	3300049568	Bacteria	5461
329	Ga0501032_0017049	3300049569	Bacteria	5103
330	Ga0501032_0046887	3300049569	Bacteria	2920
331	Ga0501032_0094555	3300049569	Bacteria	1981
332	Ga0501032_0312344	3300049569	Bacteria	1015
333	Ga0501032_0404168	3300049569	Bacteria	877
334	Ga0501033_0000015	3300049570	Bacteria	218502
335	Ga0501033_0009054	3300049570	Bacteria	7681
336	Ga0501033_0029324	3300049570	Bacteria	4135
337	Ga0501033_0042133	3300049570	Bacteria	3404
338	Ga0501034_0146817	3300049571	Bacteria	2335
339	Ga0501034_0700930	3300049571	Bacteria	911
340	Ga0501036_0013849	3300049572	Bacteria	6707
341	Ga0501037_0000295	3300049573	Bacteria	42165
342	Ga0501037_0029331	3300049573	Bacteria	4065
343	Ga0501037_0068544	3300049573	Bacteria	2583
344	Ga0501038_0066434	3300049574	Bacteria	3071
345	Ga0501038_0073690	3300049574	Bacteria	2890
346	Ga0501039_0022279	3300049575	Bacteria	4863
347	Ga0501039_0714426	3300049575	Bacteria	783
348	Ga0501039_1159684	3300049575	Unclassified	598
349	Ga0501043_0069626	3300049579	Bacteria	2763
350	Ga0501046_0210150	3300049580	Bacteria	1445
351	Ga0501046_0682621	3300049580	Bacteria	724
352	Ga0501047_0243754	3300049581	Bacteria	1647
353	Ga0501047_1006068	3300049581	Bacteria	647
354	Ga0501070_0002360	3300049586	Bacteria	16550
355	Ga0501070_0250134	3300049586	Bacteria	1450
356	Ga0501070_1061293	3300049586	Bacteria	626
357	Ga0501073_0374352	3300049589	Bacteria	984
358	Ga0501035_0000004	3300049822	Bacteria	403650
359	Ga0501035_0011308	3300049822	Bacteria	8272
360	Ga0501035_0085393	3300049822	Bacteria	2782
361	Ga0501035_0211676	3300049822	Bacteria	1658
362	Ga0501044_0000427	3300049823	Bacteria	52004
363	Ga0501044_0000740	3300049823	Bacteria	39382
364	Ga0501044_0011226	3300049823	Bacteria	9713
365	Ga0501044_0104812	3300049823	Bacteria	2841
366	nmdc:mga09592_1077206_c1	3300050508	Bacteria	669
367	nmdc:mga0qj67_1149961_c1	3300050509	Bacteria	605
368	nmdc:mga0qj67_914650_c1	3300050509	Bacteria	691
369	nmdc:mga06r32_13339_c1	3300050510	Bacteria	7443
370	nmdc:mga06r32_186518_c1	3300050510	Bacteria	2061
371	nmdc:mga08y16_14664_c1	3300050511	Bacteria	8241
372	nmdc:mga08y16_2184937_c1	3300050511	Bacteria	500
373	nmdc:mga08y16_94250_c1	3300050511	Bacteria	3119
374	nmdc:mga0rr50_288868_c1	3300050513	Unclassified	1370
375	nmdc:mga0rr50_83944_c1	3300050513	Bacteria	2464
376	nmdc:mga0a205_673115_c1	3300050515	Bacteria	885
377	nmdc:mga0a205_779753_c1	3300050515	Bacteria	804
378	Ga0495595_0445173	3300053084	Unclassified	658
379	Ga0495619_0347108	3300053085	Bacteria	1027
380	Ga0587073_0156347	3300059492	Bacteria	649
381	Ga0587109_100508	3300059624	Bacteria	664
382	Ga0587076_126487	3300059645	Bacteria	598
383	Ga0466962_0000007	3300061719	Bacteria	157857

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300013104	Ga0157370_10119745	Ga0157370_101197452	111
2	3300047444	Ga0495675_0187458	Ga0495675_0187458_491_985	113
3	3300014325	Ga0163163_11908838	Ga0163163_119088382	118
4	3300041461	Ga0451805_068142	Ga0451805_068142_149_622	118
5	3300005458	Ga0070681_10035935	Ga0070681_100359355	120
6	3300005563	Ga0068855_100069868	Ga0068855_1000698685	120
7	3300025912	Ga0207707_10051751	Ga0207707_100517515	120
8	3300025913	Ga0207695_10927087	Ga0207695_109270872	120
9	3300025949	Ga0207667_10100965	Ga0207667_101009654	120
10	3300004800	Ga0058861_11687878	Ga0058861_116878781	121
11	3300005329	Ga0070683_100598936	Ga0070683_1005989362	121
12	3300005334	Ga0068869_100621696	Ga0068869_1006216961	121
13	3300013104	Ga0157370_10994623	Ga0157370_109946231	121
14	3300025944	Ga0207661_10051419	Ga0207661_100514192	121
15	3300035170	Ga0373943_0203429	Ga0373943_0203429_434_880	121
16	3300049571	Ga0501034_0146817	Ga0501034_0146817_1217_1777	121
17	3300005330	Ga0070690_100136559	Ga0070690_1001365593	122
18	3300005335	Ga0070666_10123770	Ga0070666_101237702	122
19	3300005338	Ga0068868_100059106	Ga0068868_1000591066	122
20	3300005355	Ga0070671_100297462	Ga0070671_1002974622	122
21	3300005367	Ga0070667_100219477	Ga0070667_1002194772	122
22	3300005617	Ga0068859_100404555	Ga0068859_1004045552	122
23	3300005843	Ga0068860_100049052	Ga0068860_1000490526	122
24	3300006358	Ga0068871_100391710	Ga0068871_1003917103	122
25	3300006881	Ga0068865_100507637	Ga0068865_1005076372	122
26	3300006931	Ga0097620_100404600	Ga0097620_1004046002	122
27	3300007076	Ga0075435_100290019	Ga0075435_1002900192	122
28	3300009176	Ga0105242_10130315	Ga0105242_101303152	122
29	3300013306	Ga0163162_10396067	Ga0163162_103960673	122
30	3300013308	Ga0157375_10378263	Ga0157375_103782633	122
31	3300021384	Ga0213876_10000361	Ga0213876_100003617	122
32	3300025903	Ga0207680_10150458	Ga0207680_101504582	122
33	3300025931	Ga0207644_10347232	Ga0207644_103472322	122
34	3300025986	Ga0207658_10137117	Ga0207658_101371172	122
35	3300026023	Ga0207677_10458291	Ga0207677_104582911	122
36	3300028381	Ga0268264_10366418	Ga0268264_103664182	122
37	3300036401	Ga0373937_0331794	Ga0373937_0331794_782_1234	122
38	3300037853	Ga0436364_0785290	Ga0436364_0785290_969_1415	122
39	3300039437	Ga0436365_1383407	Ga0436365_1383407_25277_25723	122
40	3300046454	Ga0495592_0525615	Ga0495592_0525615_181_633	122
41	3300050513	nmdc:mga0rr50_83944_c1	nmdc:mga0rr50_83944_c1_887_1375	122
42	3300005544	Ga0070686_100010098	Ga0070686_1000100981	123
43	3300005347	Ga0070668_100620871	Ga0070668_1006208712	124
44	3300005354	Ga0070675_100087513	Ga0070675_1000875133	124
45	3300005356	Ga0070674_100445735	Ga0070674_1004457352	124
46	3300005364	Ga0070673_100084154	Ga0070673_1000841543	124
47	3300005456	Ga0070678_100181546	Ga0070678_1001815462	124
48	3300006847	Ga0075431_101320090	Ga0075431_1013200901	124
49	3300025960	Ga0207651_10276024	Ga0207651_102760242	124
50	3300026121	Ga0207683_10331125	Ga0207683_103311252	124
51	3300050511	nmdc:mga08y16_2184937_c1	nmdc:mga08y16_2184937_c1_10_465	124
52	3300005340	Ga0070689_100001047	Ga0070689_10000104714	125
53	3300005365	Ga0070688_100200380	Ga0070688_1002003802	125
54	3300005466	Ga0070685_10359027	Ga0070685_103590272	125
55	3300006844	Ga0075428_100890473	Ga0075428_1008904732	125
56	3300006847	Ga0075431_100701985	Ga0075431_1007019852	125
57	3300006880	Ga0075429_100072679	Ga0075429_1000726792	125
58	3300009094	Ga0111539_10654806	Ga0111539_106548062	125
59	3300025936	Ga0207670_10026107	Ga0207670_100261074	125
60	3300044712	Ga0453684_0008216	Ga0453684_0008216_12320_12778	125
61	3300003575	Ga0007409J51694_1182499	Ga0007409J51694_11824992	126
62	3300005615	Ga0070702_100292498	Ga0070702_1002924982	126
63	3300009176	Ga0105242_10151642	Ga0105242_101516422	126
64	3300013306	Ga0163162_10267201	Ga0163162_102672014	126
65	3300013307	Ga0157372_10240224	Ga0157372_102402242	126
66	3300013308	Ga0157375_10236177	Ga0157375_102361772	126
67	3300025919	Ga0207657_11134874	Ga0207657_111348741	126
68	3300025934	Ga0207686_10423964	Ga0207686_104239642	126
69	3300005328	Ga0070676_10728661	Ga0070676_107286611	127
70	3300005617	Ga0068859_100246035	Ga0068859_1002460352	127
71	3300005842	Ga0068858_100377931	Ga0068858_1003779311	127
72	3300006358	Ga0068871_100682155	Ga0068871_1006821552	127
73	3300006931	Ga0097620_100246054	Ga0097620_1002460542	127
74	3300014968	Ga0157379_10519342	Ga0157379_105193422	127
75	3300026035	Ga0207703_10952115	Ga0207703_109521152	127
76	3300042876	Ga0451577_0018671	Ga0451577_0018671_5204_5671	127
77	3300044712	Ga0453684_0054509	Ga0453684_0054509_3669_4136	127
78	3300044712	Ga0453684_0892913	Ga0453684_0892913_201_668	127
79	3300049570	Ga0501033_0009054	Ga0501033_0009054_1168_1635	127
80	3300049586	Ga0501070_0250134	Ga0501070_0250134_185_652	127
81	3300049589	Ga0501073_0374352	Ga0501073_0374352_97_564	127
82	3300005295	Ga0065707_10257723	Ga0065707_102577232	128
83	3300005327	Ga0070658_10210604	Ga0070658_102106042	128
84	3300005329	Ga0070683_101421045	Ga0070683_1014210451	128
85	3300005335	Ga0070666_10015396	Ga0070666_1001539610	128
86	3300005341	Ga0070691_10118192	Ga0070691_101181921	128
87	3300005364	Ga0070673_101349037	Ga0070673_1013490371	128
88	3300005436	Ga0070713_101806556	Ga0070713_1018065561	128
89	3300005458	Ga0070681_10818120	Ga0070681_108181201	128
90	3300005530	Ga0070679_100407706	Ga0070679_1004077062	128
91	3300005544	Ga0070686_100232529	Ga0070686_1002325292	128
92	3300005549	Ga0070704_100520608	Ga0070704_1005206082	128
93	3300005614	Ga0068856_100006825	Ga0068856_1000068259	128
94	3300005618	Ga0068864_102194094	Ga0068864_1021940941	128
95	3300006844	Ga0075428_100393275	Ga0075428_1003932752	128
96	3300009093	Ga0105240_10063083	Ga0105240_100630831	128
97	3300009551	Ga0105238_10068554	Ga0105238_100685542	128
98	3300013296	Ga0157374_10433969	Ga0157374_104339692	128
99	3300013296	Ga0157374_11386287	Ga0157374_113862872	128
100	3300013306	Ga0163162_10640653	Ga0163162_106406532	128
101	3300013308	Ga0157375_10000037	Ga0157375_10000037112	128
102	3300014969	Ga0157376_10736359	Ga0157376_107363592	128
103	3300025903	Ga0207680_10010521	Ga0207680_100105212	128
104	3300025913	Ga0207695_10029957	Ga0207695_100299576	128
105	3300025921	Ga0207652_10544536	Ga0207652_105445362	128
106	3300025924	Ga0207694_10043537	Ga0207694_100435372	128
107	3300026078	Ga0207702_10001362	Ga0207702_1000136214	128
108	3300026118	Ga0207675_101085632	Ga0207675_1010856321	128
109	3300028800	Ga0265338_10000135	Ga0265338_1000013529	128
110	3300028800	Ga0265338_10071479	Ga0265338_100714792	128
111	3300028800	Ga0265338_10085242	Ga0265338_100852423	128
112	3300029957	Ga0265324_10000614	Ga0265324_100006141	128
113	3300029957	Ga0265324_10030895	Ga0265324_100308952	128
114	3300031251	Ga0265327_10002213	Ga0265327_1000221313	128
115	3300031251	Ga0265327_10019720	Ga0265327_100197204	128
116	3300031824	Ga0307413_10990790	Ga0307413_109907902	128
117	3300032002	Ga0307416_101420661	Ga0307416_1014206612	128
118	3300035091	Ga0373951_0048859	Ga0373951_0048859_238_717	128
119	3300036712	Ga0316584_0043257	Ga0316584_0043257_1870_2352	128
120	3300041452	Ga0451793_0091554	Ga0451793_0091554_17_490	128
121	3300041486	Ga0451807_2359324	Ga0451807_2359324_237_710	128
122	3300041492	Ga0451835_0921120	Ga0451835_0921120_37_510	128
123	3300044712	Ga0453684_0180693	Ga0453684_0180693_1150_1620	128
124	3300044712	Ga0453684_0269206	Ga0453684_0269206_233_709	128
125	3300046459	Ga0495629_0070936	Ga0495629_0070936_998_1510	128
126	3300046461	Ga0495641_0016861	Ga0495641_0016861_1907_2377	128
127	3300046473	Ga0495582_0006802	Ga0495582_0006802_2874_3386	128
128	3300046473	Ga0495582_0211262	Ga0495582_0211262_447_917	128
129	3300046514	Ga0495618_0564722	Ga0495618_0564722_56_568	128
130	3300046517	Ga0495630_0000076	Ga0495630_0000076_35086_35598	128
131	3300046526	Ga0495666_0005257	Ga0495666_0005257_1757_2269	128
132	3300046531	Ga0495665_0044128	Ga0495665_0044128_1252_1764	128
133	3300046533	Ga0495640_0080884	Ga0495640_0080884_947_1459	128
134	3300046533	Ga0495640_0103649	Ga0495640_0103649_256_726	128
135	3300046535	Ga0495586_0000001	Ga0495586_0000001_35085_35597	128
136	3300046535	Ga0495586_0087260	Ga0495586_0087260_1234_1704	128
137	3300046642	Ga0495634_0007513	Ga0495634_0007513_1151_1663	128
138	3300046642	Ga0495634_0100650	Ga0495634_0100650_1335_1805	128
139	3300046642	Ga0495634_0251579	Ga0495634_0251579_149_619	128
140	3300046681	Ga0495647_0007682	Ga0495647_0007682_1045_1515	128
141	3300046683	Ga0495658_0075050	Ga0495658_0075050_834_1346	128
142	3300046689	Ga0495613_0134368	Ga0495613_0134368_951_1463	128
143	3300046689	Ga0495613_0225146	Ga0495613_0225146_428_898	128
144	3300047315	Ga0495581_0314196	Ga0495581_0314196_194_706	128
145	3300047319	Ga0495674_0009667	Ga0495674_0009667_7212_7724	128
146	3300047321	Ga0495676_0008529	Ga0495676_0008529_4536_5048	128
147	3300047321	Ga0495676_0287745	Ga0495676_0287745_495_965	128
148	3300048918	Ga0496115_0002169	Ga0496115_0002169_9545_10018	128
149	3300049528	Ga0501312_045279	Ga0501312_045279_89_556	128
150	3300049568	Ga0501031_0000292	Ga0501031_0000292_7322_7795	128
151	3300049568	Ga0501031_0012892	Ga0501031_0012892_3709_4182	128
152	3300049569	Ga0501032_0017049	Ga0501032_0017049_3611_4084	128
153	3300049569	Ga0501032_0094555	Ga0501032_0094555_1206_1679	128
154	3300049569	Ga0501032_0404168	Ga0501032_0404168_341_811	128
155	3300049570	Ga0501033_0029324	Ga0501033_0029324_1342_1815	128
156	3300049570	Ga0501033_0042133	Ga0501033_0042133_164_637	128
157	3300049573	Ga0501037_0029331	Ga0501037_0029331_468_941	128
158	3300049573	Ga0501037_0068544	Ga0501037_0068544_783_1256	128
159	3300049575	Ga0501039_0714426	Ga0501039_0714426_236_709	128
160	3300049575	Ga0501039_1159684	Ga0501039_1159684_36_509	128
161	3300049580	Ga0501046_0210150	Ga0501046_0210150_378_851	128
162	3300049580	Ga0501046_0682621	Ga0501046_0682621_94_567	128
163	3300049581	Ga0501047_0243754	Ga0501047_0243754_241_714	128
164	3300049581	Ga0501047_1006068	Ga0501047_1006068_81_554	128
165	3300049586	Ga0501070_1061293	Ga0501070_1061293_80_553	128
166	3300049822	Ga0501035_0011308	Ga0501035_0011308_2463_2936	128
167	3300049822	Ga0501035_0085393	Ga0501035_0085393_2229_2702	128
168	3300049822	Ga0501035_0211676	Ga0501035_0211676_881_1354	128
169	3300049823	Ga0501044_0000427	Ga0501044_0000427_20462_20935	128
170	3300049823	Ga0501044_0011226	Ga0501044_0011226_1507_1980	128
171	3300049823	Ga0501044_0104812	Ga0501044_0104812_1584_2057	128
172	3300053085	Ga0495619_0347108	Ga0495619_0347108_509_979	128
173	3300059624	Ga0587109_100508	Ga0587109_100508_51_527	128
174	3300059645	Ga0587076_126487	Ga0587076_126487_93_569	128
175	3300004799	Ga0058863_11864930	Ga0058863_118649302	129
176	3300005327	Ga0070658_10095577	Ga0070658_100955774	129
177	3300005340	Ga0070689_100824514	Ga0070689_1008245142	129
178	3300005340	Ga0070689_101910587	Ga0070689_1019105871	129
179	3300005343	Ga0070687_100100390	Ga0070687_1001003902	129
180	3300005365	Ga0070688_100374652	Ga0070688_1003746522	129
181	3300005435	Ga0070714_100004475	Ga0070714_10000447513	129
182	3300005435	Ga0070714_100428533	Ga0070714_1004285332	129
183	3300005439	Ga0070711_100794500	Ga0070711_1007945001	129
184	3300005440	Ga0070705_100022698	Ga0070705_1000226984	129
185	3300005441	Ga0070700_100505664	Ga0070700_1005056642	129
186	3300005544	Ga0070686_100020934	Ga0070686_1000209342	129
187	3300005549	Ga0070704_100261119	Ga0070704_1002611192	129
188	3300005840	Ga0068870_10085626	Ga0068870_100856262	129
189	3300005841	Ga0068863_100189864	Ga0068863_1001898642	129
190	3300005841	Ga0068863_100935371	Ga0068863_1009353712	129
191	3300005842	Ga0068858_100444196	Ga0068858_1004441962	129
192	3300005844	Ga0068862_100404625	Ga0068862_1004046252	129
193	3300006175	Ga0070712_100370403	Ga0070712_1003704031	129
194	3300006237	Ga0097621_100008773	Ga0097621_10000877314	129
195	3300006237	Ga0097621_100957898	Ga0097621_1009578982	129
196	3300006844	Ga0075428_100001579	Ga0075428_1000015793	129
197	3300006846	Ga0075430_100377056	Ga0075430_1003770561	129
198	3300006846	Ga0075430_100399337	Ga0075430_1003993371	129
199	3300006846	Ga0075430_101021182	Ga0075430_1010211821	129
200	3300006847	Ga0075431_100080459	Ga0075431_1000804592	129
201	3300006880	Ga0075429_100113811	Ga0075429_1001138113	129
202	3300007788	Ga0099795_10471660	Ga0099795_104716601	129
203	3300009093	Ga0105240_10002989	Ga0105240_1000298916	129
204	3300009094	Ga0111539_10009658	Ga0111539_1000965814	129
205	3300009094	Ga0111539_10083379	Ga0111539_100833796	129
206	3300009174	Ga0105241_10456917	Ga0105241_104569172	129
207	3300009177	Ga0105248_10468696	Ga0105248_104686962	129
208	3300009177	Ga0105248_10652845	Ga0105248_106528452	129
209	3300009177	Ga0105248_11375302	Ga0105248_113753022	129
210	3300009553	Ga0105249_10234861	Ga0105249_102348612	129
211	3300009553	Ga0105249_11479733	Ga0105249_114797332	129
212	3300013105	Ga0157369_10307894	Ga0157369_103078942	129
213	3300013296	Ga0157374_10071814	Ga0157374_100718142	129
214	3300013297	Ga0157378_10203573	Ga0157378_102035732	129
215	3300013297	Ga0157378_10390045	Ga0157378_103900452	129
216	3300013308	Ga0157375_10652996	Ga0157375_106529962	129
217	3300014325	Ga0163163_10000212	Ga0163163_1000021253	129
218	3300014325	Ga0163163_10028664	Ga0163163_100286643	129
219	3300014969	Ga0157376_10305189	Ga0157376_103051892	129
220	3300025909	Ga0207705_10086158	Ga0207705_100861584	129
221	3300025913	Ga0207695_10037437	Ga0207695_100374373	129
222	3300025915	Ga0207693_10456821	Ga0207693_104568212	129
223	3300025927	Ga0207687_10716282	Ga0207687_107162822	129
224	3300025928	Ga0207700_10969757	Ga0207700_109697572	129
225	3300025929	Ga0207664_10001982	Ga0207664_100019828	129
226	3300025929	Ga0207664_10322643	Ga0207664_103226432	129
227	3300025936	Ga0207670_10291120	Ga0207670_102911202	129
228	3300025936	Ga0207670_10791938	Ga0207670_107919382	129
229	3300025937	Ga0207669_10516235	Ga0207669_105162352	129
230	3300025938	Ga0207704_10416804	Ga0207704_104168042	129
231	3300025939	Ga0207665_10391780	Ga0207665_103917802	129
232	3300025941	Ga0207711_10947147	Ga0207711_109471472	129
233	3300026035	Ga0207703_10321077	Ga0207703_103210772	129
234	3300026075	Ga0207708_10597765	Ga0207708_105977652	129
235	3300026088	Ga0207641_10024032	Ga0207641_100240324	129
236	3300026088	Ga0207641_10356466	Ga0207641_103564662	129
237	3300026088	Ga0207641_11326897	Ga0207641_113268971	129
238	3300026095	Ga0207676_10278886	Ga0207676_102788862	129
239	3300026116	Ga0207674_10179878	Ga0207674_101798782	129
240	3300027907	Ga0207428_10246419	Ga0207428_102464192	129
241	3300028556	Ga0265337_1002415	Ga0265337_10024152	129
242	3300028558	Ga0265326_10001638	Ga0265326_100016385	129
243	3300028563	Ga0265319_1024377	Ga0265319_10243772	129
244	3300028573	Ga0265334_10095986	Ga0265334_100959862	129
245	3300028654	Ga0265322_10067793	Ga0265322_100677932	129
246	3300028800	Ga0265338_10000105	Ga0265338_1000010533	129
247	3300028800	Ga0265338_10007414	Ga0265338_100074146	129
248	3300028800	Ga0265338_10010461	Ga0265338_100104617	129
249	3300028800	Ga0265338_10017285	Ga0265338_100172859	129
250	3300028800	Ga0265338_10022741	Ga0265338_100227417	129
251	3300028800	Ga0265338_10069919	Ga0265338_100699194	129
252	3300028800	Ga0265338_10334810	Ga0265338_103348102	129
253	3300029957	Ga0265324_10002113	Ga0265324_1000211311	129
254	3300029957	Ga0265324_10020426	Ga0265324_100204262	129
255	3300029957	Ga0265324_10100369	Ga0265324_101003691	129
256	3300031238	Ga0265332_10086432	Ga0265332_100864322	129
257	3300031240	Ga0265320_10253701	Ga0265320_102537011	129
258	3300031241	Ga0265325_10104178	Ga0265325_101041781	129
259	3300031247	Ga0265340_10007372	Ga0265340_100073728	129
260	3300031249	Ga0265339_10011597	Ga0265339_100115976	129
261	3300031250	Ga0265331_10104293	Ga0265331_101042932	129
262	3300031250	Ga0265331_10121343	Ga0265331_101213432	129
263	3300031251	Ga0265327_10004484	Ga0265327_1000448411	129
264	3300031344	Ga0265316_10644914	Ga0265316_106449142	129
265	3300031711	Ga0265314_10494537	Ga0265314_104945371	129
266	3300031712	Ga0265342_10095370	Ga0265342_100953703	129
267	3300034957	Ga0373938_0145535	Ga0373938_0145535_34_504	129
268	3300035083	Ga0373926_0004254	Ga0373926_0004254_160_633	129
269	3300035111	Ga0373923_0271026	Ga0373923_0271026_173_676	129
270	3300035116	Ga0373945_0029895	Ga0373945_0029895_584_1057	129
271	3300035118	Ga0373954_0359311	Ga0373954_0359311_106_615	129
272	3300035119	Ga0373956_0505918	Ga0373956_0505918_40_543	129
273	3300035172	Ga0373955_0728336	Ga0373955_0728336_64_567	129
274	3300035691	Ga0373931_0381994	Ga0373931_0381994_219_716	129
275	3300035691	Ga0373931_0543283	Ga0373931_0543283_40_537	129
276	3300035691	Ga0373931_0898965	Ga0373931_0898965_38_526	129
277	3300035692	Ga0373935_0032404	Ga0373935_0032404_2098_2571	129
278	3300035695	Ga0373927_0001357	Ga0373927_0001357_377_850	129
279	3300035725	Ga0373947_0134420	Ga0373947_0134420_900_1373	129
280	3300035725	Ga0373947_0845120	Ga0373947_0845120_16_510	129
281	3300036401	Ga0373937_0052485	Ga0373937_0052485_1242_1745	129
282	3300036401	Ga0373937_0287542	Ga0373937_0287542_689_1162	129
283	3300036401	Ga0373937_1904026	Ga0373937_1904026_24_497	129
284	3300037068	Ga0373925_0005962	Ga0373925_0005962_6807_7280	129
285	3300037068	Ga0373925_0022607	Ga0373925_0022607_373_846	129
286	3300042876	Ga0451577_0001340	Ga0451577_0001340_15958_16449	129
287	3300042876	Ga0451577_0131160	Ga0451577_0131160_1624_2139	129
288	3300042876	Ga0451577_0575049	Ga0451577_0575049_76_549	129
289	3300042876	Ga0451577_1412934	Ga0451577_1412934_21_497	129
290	3300044712	Ga0453684_0000532	Ga0453684_0000532_33872_34351	129
291	3300044712	Ga0453684_0017342	Ga0453684_0017342_640_1131	129
292	3300044712	Ga0453684_0023833	Ga0453684_0023833_1220_1693	129
293	3300045049	Ga0466959_0690388	Ga0466959_0690388_163_654	129
294	3300045051	Ga0451576_0036193	Ga0451576_0036193_2170_2643	129
295	3300045051	Ga0451576_0173056	Ga0451576_0173056_1084_1557	129
296	3300045051	Ga0451576_0173886	Ga0451576_0173886_1247_1720	129
297	3300045051	Ga0451576_0182561	Ga0451576_0182561_526_1005	129
298	3300045051	Ga0451576_0230720	Ga0451576_0230720_424_897	129
299	3300045051	Ga0451576_0359641	Ga0451576_0359641_877_1347	129
300	3300045051	Ga0451576_0657598	Ga0451576_0657598_420_896	129
301	3300045051	Ga0451576_0729607	Ga0451576_0729607_250_723	129
302	3300046454	Ga0495592_0000015	Ga0495592_0000015_90179_90652	129
303	3300046459	Ga0495629_0967503	Ga0495629_0967503_59_532	129
304	3300046462	Ga0495651_0060453	Ga0495651_0060453_2060_2545	129
305	3300046462	Ga0495651_0125409	Ga0495651_0125409_903_1412	129
306	3300046463	Ga0495653_0526468	Ga0495653_0526468_81_554	129
307	3300046476	Ga0495662_0236940	Ga0495662_0236940_75_548	129
308	3300046477	Ga0495664_0171619	Ga0495664_0171619_256_729	129
309	3300046514	Ga0495618_0001289	Ga0495618_0001289_9925_10398	129
310	3300046516	Ga0495628_0000722	Ga0495628_0000722_26703_27176	129
311	3300046516	Ga0495628_0094980	Ga0495628_0094980_957_1430	129
312	3300046517	Ga0495630_0009669	Ga0495630_0009669_3722_4195	129
313	3300046517	Ga0495630_0631558	Ga0495630_0631558_57_554	129
314	3300046526	Ga0495666_0069860	Ga0495666_0069860_54_527	129
315	3300046529	Ga0495652_0019958	Ga0495652_0019958_2453_2926	129
316	3300046533	Ga0495640_0005038	Ga0495640_0005038_9054_9527	129
317	3300046535	Ga0495586_0000979	Ga0495586_0000979_7707_8180	129
318	3300046535	Ga0495586_0151351	Ga0495586_0151351_662_1150	129
319	3300046539	Ga0495621_0348459	Ga0495621_0348459_35_508	129
320	3300046543	Ga0495645_0019740	Ga0495645_0019740_4228_4701	129
321	3300046543	Ga0495645_0122263	Ga0495645_0122263_770_1243	129
322	3300046543	Ga0495645_0228346	Ga0495645_0228346_52_525	129
323	3300046559	Ga0495667_0704399	Ga0495667_0704399_72_557	129
324	3300046663	Ga0495635_0080101	Ga0495635_0080101_855_1343	129
325	3300046663	Ga0495635_0366442	Ga0495635_0366442_35_508	129
326	3300046678	Ga0495599_0002301	Ga0495599_0002301_9051_9524	129
327	3300046678	Ga0495599_0498700	Ga0495599_0498700_70_543	129
328	3300046680	Ga0495646_0128418	Ga0495646_0128418_41_514	129
329	3300046683	Ga0495658_0080901	Ga0495658_0080901_659_1129	129
330	3300046683	Ga0495658_0900739	Ga0495658_0900739_14_487	129
331	3300046684	Ga0495669_0620529	Ga0495669_0620529_12_485	129
332	3300046690	Ga0495624_0052468	Ga0495624_0052468_1421_1897	129
333	3300047315	Ga0495581_0475221	Ga0495581_0475221_103_576	129
334	3300047319	Ga0495674_0000992	Ga0495674_0000992_22266_22739	129
335	3300047471	Ga0495684_0533871	Ga0495684_0533871_85_579	129
336	3300047471	Ga0495684_0822724	Ga0495684_0822724_32_526	129
337	3300047471	Ga0495684_0842262	Ga0495684_0842262_112_585	129
338	3300048089	Ga0495614_0332426	Ga0495614_0332426_77_550	129
339	3300048909	Ga0496106_0096451	Ga0496106_0096451_1394_1876	129
340	3300048910	Ga0496107_0029552	Ga0496107_0029552_1794_2276	129
341	3300049571	Ga0501034_0700930	Ga0501034_0700930_371_841	129
342	3300050508	nmdc:mga09592_1077206_c1	nmdc:mga09592_1077206_c1_22_492	129
343	3300050509	nmdc:mga0qj67_1149961_c1	nmdc:mga0qj67_1149961_c1_43_513	129
344	3300050509	nmdc:mga0qj67_914650_c1	nmdc:mga0qj67_914650_c1_196_666	129
345	3300050510	nmdc:mga06r32_13339_c1	nmdc:mga06r32_13339_c1_4957_5511	129
346	3300050510	nmdc:mga06r32_186518_c1	nmdc:mga06r32_186518_c1_1273_1743	129
347	3300050511	nmdc:mga08y16_14664_c1	nmdc:mga08y16_14664_c1_7118_7588	129
348	3300050511	nmdc:mga08y16_94250_c1	nmdc:mga08y16_94250_c1_1599_2195	129
349	3300050513	nmdc:mga0rr50_288868_c1	nmdc:mga0rr50_288868_c1_852_1331	129
350	3300050515	nmdc:mga0a205_673115_c1	nmdc:mga0a205_673115_c1_333_806	129
351	3300050515	nmdc:mga0a205_779753_c1	nmdc:mga0a205_779753_c1_172_642	129
352	3300053084	Ga0495595_0445173	Ga0495595_0445173_76_585	129
353	3300001991	JGI24743J22301_10000748	JGI24743J22301_100007484	130
354	3300013297	Ga0157378_11195345	Ga0157378_111953451	130
355	3300025315	Ga0207697_10031631	Ga0207697_100316312	130
356	3300025901	Ga0207688_10042403	Ga0207688_100424031	130
357	3300044706	Ga0466964_0005699	Ga0466964_0005699_3630_4106	130
358	3300044719	Ga0466971_0000005	Ga0466971_0000005_56109_56585	130
359	3300045051	Ga0451576_1005904	Ga0451576_1005904_162_785	130
360	3300045976	Ga0466967_0088574	Ga0466967_0088574_776_1252	130
361	3300049568	Ga0501031_0000635	Ga0501031_0000635_5328_5795	130
362	3300049569	Ga0501032_0046887	Ga0501032_0046887_649_1125	130
363	3300049569	Ga0501032_0312344	Ga0501032_0312344_160_627	130
364	3300049570	Ga0501033_0000015	Ga0501033_0000015_60175_60651	130
365	3300049572	Ga0501036_0013849	Ga0501036_0013849_2604_3071	130
366	3300049573	Ga0501037_0000295	Ga0501037_0000295_32459_32926	130
367	3300049574	Ga0501038_0066434	Ga0501038_0066434_28_495	130
368	3300049574	Ga0501038_0073690	Ga0501038_0073690_1237_1713	130
369	3300049575	Ga0501039_0022279	Ga0501039_0022279_2069_2536	130
370	3300049579	Ga0501043_0069626	Ga0501043_0069626_1671_2138	130
371	3300049586	Ga0501070_0002360	Ga0501070_0002360_15373_15840	130
372	3300049822	Ga0501035_0000004	Ga0501035_0000004_15385_15852	130
373	3300049823	Ga0501044_0000740	Ga0501044_0000740_6529_6996	130
374	3300061719	Ga0466962_0000007	Ga0466962_0000007_143965_144441	130
375	3300001979	JGI24740J21852_10128513	JGI24740J21852_101285131	131
376	3300003323	rootH1_10007007	rootH1_100070073	131
377	3300005614	Ga0068856_100004352	Ga0068856_10000435225	131
378	3300026078	Ga0207702_10003580	Ga0207702_1000358023	131
379	3300037312	Ga0395899_0000039	Ga0395899_0000039_171153_171620	131
380	3300037466	Ga0395898_0000226	Ga0395898_0000226_97736_98203	131
381	3300044842	Ga0466957_0059454	Ga0466957_0059454_1597_2064	131
382	3300059492	Ga0587073_0156347	Ga0587073_0156347_13_480	131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

8

122

0.87 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1p90-assembly1.cif.gz_A	the three-dimensional structure of the core domain of nafy from azotobacter vinelandii determined at 1.8 resolution	0.8975	100	123
6th6-assembly1.cif.gz_BR	cryo-em structure of t. kodakarensis 70s ribosome	0.8679	53	123
4v6u-assembly1.cif.gz_BP	promiscuous behavior of proteins in archaeal ribosomes revealed by cryo-em: implications for evolution of eukaryotic ribosomes	0.8375	54	123
6hix-assembly1.cif.gz_AP	cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit	0.8151	48	121
1w2b-assembly1.cif.gz_N	trigger factor ribosome binding domain in complex with 50s	0.8065	53	122

ID	Description	Score	Start	End	Superfamily
af_P0A0F8_66_146_3.100.10.10	Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2;	0.9686	48	124	3.100.10.10
5v7qL01	Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2;	0.9284	53	121	3.100.10.10
af_Q10PV6_148_224_3.100.10.10	Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2;	0.9184	53	122	3.100.10.10
af_A0A0R0I064_101_171_3.100.10.10	Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2;	0.9172	62	123	3.100.10.10
af_A0A0G2K9B4_85_176_3.100.10.10	Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2;	0.9168	47	124	3.100.10.10

ID	Description	Score	Start	End	GO Terms
AF-A0A351AEJ9-F1-model_v4	50S ribosomal protein L15	0.9882	48	124	GO:0003735 GO:0006412 GO:0022625
AF-S2TBB5-F1-model_v4	50S ribosomal protein L15	0.9744	51	124	GO:0003735 GO:0006412 GO:0022625
AF-A0A2C9ZT39-F1-model_v4	deleted	0.9727	53	124
AF-A0A4V1QUN6-F1-model_v4	50S ribosomal protein L15	0.969	51	127	GO:0003735 GO:0005840 GO:0006412 GO:0016020 GO:0030313 GO:1990904
AF-A0A0X8B1C0-F1-model_v4	50S ribosomal protein L15	0.9665	55	124	GO:0003735 GO:0005840 GO:0006412 GO:1990904

Feature Viewer

pLDDT	pTM	Quality
80.68	0.59	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F429301

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

8

122

0.87

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map