F429238

General Info

Members Datasets Scaffolds Average Seq Length
382 230 374 360

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10241331|Ga0075433_102413312
Length 399
Sequence MFGKIGERINAYRAPGECLARMSLIQFADPVPNQYVQRGAYTAMTTTISLTRTSHPQPKPRDEELSFGRIFTDHMFLMEAVADQGWQNPRIVPYGPLTLDPSAAVFHYSQELFEGLKAYRSPRDTVLLFRPDMNAARLNRSAARLCMPPVDEEMFLTAIKTLVSLERDWVPRAPGTSLYIRPTMIATEPFLGVRPSQTYCFFIILSPVGAYYAEGFSPVKILVEDRYVRAVKGGMGAAKTGGNYAASLAAGEEAHRRGFSQVLWLDGVERQYIEEVGSMNIAFVIDNELVTPPLTGTILEGVTRDTVLQLARDWGMRVAERPISISEVFTAARSGRLRETFGMGTAAVVSPVSELSYQGQSVTISNGQVGPLAQRLFDEISAIQRGLKPDPHGWVVEVD

Samples

Sample ID Description Type Environment
1 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
2 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
3 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
4 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
5 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
6 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
141 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
150 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
151 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
163 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
166 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
221 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
222 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
226 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
230 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 0.79
Isolates 2.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.16
Nodule 0
Rhizoplane 1.05
Rhizosphere 88.22
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1001651 3300003781 Bacteria 13281
2 Ga0055536_1006815 3300003781 Bacteria 5226
3 Ga0055536_1022490 3300003781 Bacteria 1880
4 Ga0055530_10000280 3300003791 Bacteria 46300
5 Ga0055531_10000272 3300003794 Bacteria 53837
6 Ga0055531_10009340 3300003794 Bacteria 5024
7 Ga0055541_1006550 3300003841 Bacteria 1967
8 Ga0070658_10048031 3300005327 Bacteria 3455
9 Ga0070658_10255081 3300005327 Bacteria 1488
10 Ga0070683_100007820 3300005329 Bacteria 9055
11 Ga0070683_100149934 3300005329 Bacteria 2211
12 Ga0070670_100233902 3300005331 Bacteria 1599
13 Ga0068869_100151579 3300005334 Bacteria 1798
14 Ga0070680_100001309 3300005336 Bacteria 18025
15 Ga0070682_100190786 3300005337 Bacteria 1439
16 Ga0068868_100116388 3300005338 Bacteria 2177
17 Ga0070660_100015064 3300005339 Bacteria 5578
18 Ga0070660_100147085 3300005339 Bacteria 1893
19 Ga0070689_100000009 3300005340 Bacteria 238551
20 Ga0070689_100100321 3300005340 Bacteria 2291
21 Ga0070687_100013765 3300005343 Bacteria 3615
22 Ga0070661_100014753 3300005344 Bacteria 5510
23 Ga0070661_100068892 3300005344 Bacteria 2600
24 Ga0070661_100119719 3300005344 Bacteria 1971
25 Ga0070669_100388813 3300005353 Bacteria 1139
26 Ga0070675_100404104 3300005354 Bacteria 1219
27 Ga0070673_100002653 3300005364 Bacteria 10944
28 Ga0070673_100016920 3300005364 Bacteria 5171
29 Ga0070673_100274778 3300005364 Bacteria 1476
30 Ga0070659_100012840 3300005366 Bacteria 6222
31 Ga0070659_100021638 3300005366 Bacteria 4901
32 Ga0070708_100014574 3300005445 Bacteria 6475
33 Ga0070708_100155449 3300005445 Bacteria 2129
34 Ga0070663_100029999 3300005455 Bacteria 3722
35 Ga0070662_100001153 3300005457 Bacteria 16206
36 Ga0070662_100146965 3300005457 Bacteria 1832
37 Ga0070681_10028117 3300005458 Bacteria 5653
38 Ga0070681_10131044 3300005458 Bacteria 2440
39 Ga0070706_100006993 3300005467 Bacteria 10644
40 Ga0070699_100216891 3300005518 Bacteria 1704
41 Ga0070679_100001057 3300005530 Bacteria 24020
42 Ga0070679_100063641 3300005530 Bacteria 3676
43 Ga0070679_100305824 3300005530 Bacteria 1540
44 Ga0070684_100073356 3300005535 Bacteria 3015
45 Ga0070684_100098172 3300005535 Bacteria 2613
46 Ga0068853_100001767 3300005539 Bacteria 15882
47 Ga0068853_100041211 3300005539 Bacteria 3942
48 Ga0068853_100164155 3300005539 Bacteria 2006
49 Ga0070686_100005311 3300005544 Bacteria 7123
50 Ga0068855_100013562 3300005563 Bacteria 9829
51 Ga0068855_100058662 3300005563 Bacteria 4506
52 Ga0070664_100057388 3300005564 Bacteria 3309
53 Ga0070664_100131355 3300005564 Bacteria 2200
54 Ga0068857_100010938 3300005577 Bacteria 7898
55 Ga0068856_100135006 3300005614 Bacteria 2473
56 Ga0068852_100073898 3300005616 Bacteria 3001
57 Ga0068852_100162583 3300005616 Bacteria 2086
58 Ga0068852_100521113 3300005616 Bacteria 1186
59 Ga0068859_100009405 3300005617 Bacteria 9871
60 Ga0068859_100402472 3300005617 Bacteria 1465
61 Ga0068864_100027501 3300005618 Bacteria 4804
62 Ga0068864_100076199 3300005618 Bacteria 2930
63 Ga0068861_100051112 3300005719 Bacteria 3136
64 Ga0068870_10133701 3300005840 Bacteria 1444
65 Ga0068863_100186859 3300005841 Bacteria 1990
66 Ga0068858_100148469 3300005842 Bacteria 2203
67 Ga0068860_100006870 3300005843 Bacteria 11411
68 Ga0068860_100167917 3300005843 Bacteria 2119
69 Ga0068862_100018691 3300005844 Bacteria 5773
70 Ga0081455_10029139 3300005937 Bacteria 5035
71 Ga0081455_10065984 3300005937 Bacteria 3024
72 Ga0081538_10002944 3300005981 Bacteria 16258
73 Ga0081539_10000718 3300005985 Bacteria 66461
74 Ga0081539_10048532 3300005985 Bacteria 2414
75 Ga0075363_100011005 3300006048 Bacteria 4318
76 Ga0075363_100051323 3300006048 Bacteria 2199
77 Ga0075364_10061250 3300006051 Bacteria 2468
78 Ga0075366_10075231 3300006195 Bacteria 2014
79 Ga0075370_10138469 3300006353 Bacteria 1422
80 Ga0075428_100056751 3300006844 Bacteria 4288
81 Ga0075428_100074272 3300006844 Unclassified 3714
82 Ga0075428_100093618 3300006844 Bacteria 3276
83 Ga0075430_100290709 3300006846 Bacteria 1352
84 Ga0075431_100069816 3300006847 Unclassified 3625
85 Ga0075433_10178043 3300006852 Bacteria 1892
86 Ga0075433_10241331 3300006852 Bacteria 1604
87 Ga0075434_100005288 3300006871 Bacteria 11739
88 Ga0075429_100043726 3300006880 Unclassified 3898
89 Ga0075436_100098812 3300006914 Bacteria 2032
90 Ga0097620_100009405 3300006931 Bacteria 9871
91 Ga0097620_100402426 3300006931 Bacteria 1465
92 Ga0105240_10000717 3300009093 Bacteria 60700
93 Ga0105247_10207039 3300009101 Bacteria 1321
94 Ga0114129_10006906 3300009147 Bacteria 16149
95 Ga0114129_10055308 3300009147 Bacteria 5562
96 Ga0114129_10253322 3300009147 Bacteria 2362
97 Ga0105241_10075688 3300009174 Bacteria 2623
98 Ga0105242_10296139 3300009176 Bacteria 1475
99 Ga0105248_10304117 3300009177 Bacteria 1796
100 Ga0105237_10000235 3300009545 Bacteria 79122
101 Ga0105238_10016624 3300009551 Bacteria 7451
102 Ga0105239_10156091 3300010375 Bacteria 2548
103 Ga0157373_10014266 3300013100 Bacteria 5828
104 Ga0157371_10015539 3300013102 Bacteria 5709
105 Ga0157370_10011346 3300013104 Bacteria 9330
106 Ga0157370_10117852 3300013104 Bacteria 2480
107 Ga0157374_10140196 3300013296 Bacteria 2347
108 Ga0163162_10085799 3300013306 Bacteria 3226
109 Ga0157372_10003505 3300013307 Bacteria 16907
110 Ga0157372_10200013 3300013307 Bacteria 2314
111 Ga0157380_10065761 3300014326 Bacteria 2915
112 Ga0157376_10241869 3300014969 Bacteria 1682
113 Ga0163161_10059373 3300017792 Bacteria 2781
114 Ga0163161_10113422 3300017792 Bacteria 2029
115 Ga0206353_10162436 3300020082 Bacteria 7705
116 Ga0209566_100070 3300025225 Bacteria 176023
117 Ga0209675_1000075 3300025291 Bacteria 161623
118 Ga0209676_1000081 3300025292 Bacteria 285297
119 Ga0209676_1000949 3300025292 Bacteria 35497
120 Ga0209676_1001591 3300025292 Bacteria 20191
121 Ga0209025_1005730 3300025294 Bacteria 9980
122 Ga0209050_1000017 3300025298 Bacteria 728928
123 Ga0209050_1002078 3300025298 Bacteria 18364
124 Ga0209257_1000206 3300025304 Bacteria 142184
125 Ga0209257_1001063 3300025304 Bacteria 36304
126 Ga0209257_1002115 3300025304 Bacteria 20744
127 Ga0207682_10103042 3300025893 Bacteria 1249
128 Ga0207710_10115829 3300025900 Unclassified 1276
129 Ga0207643_10026057 3300025908 Bacteria 3235
130 Ga0207705_10000468 3300025909 Bacteria 34564
131 Ga0207705_10011069 3300025909 Bacteria 6539
132 Ga0207705_10013742 3300025909 Bacteria 5840
133 Ga0207705_10076260 3300025909 Bacteria 2437
134 Ga0207654_10104191 3300025911 Bacteria 1753
135 Ga0207654_10150429 3300025911 Bacteria 1494
136 Ga0207707_10034360 3300025912 Bacteria 4436
137 Ga0207707_10206609 3300025912 Bacteria 1711
138 Ga0207695_10010779 3300025913 Bacteria 11146
139 Ga0207671_10001281 3300025914 Bacteria 29556
140 Ga0207660_10007162 3300025917 Bacteria 7222
141 Ga0207660_10047369 3300025917 Bacteria 3039
142 Ga0207657_10004843 3300025919 Bacteria 14172
143 Ga0207657_10058289 3300025919 Bacteria 3323
144 Ga0207649_10020484 3300025920 Bacteria 3794
145 Ga0207649_10052321 3300025920 Bacteria 2533
146 Ga0207649_10135603 3300025920 Bacteria 1678
147 Ga0207652_10005175 3300025921 Bacteria 10589
148 Ga0207652_10129235 3300025921 Bacteria 2252
149 Ga0207681_10142464 3300025923 Bacteria 1787
150 Ga0207694_10039690 3300025924 Bacteria 3623
151 Ga0207694_10084106 3300025924 Bacteria 2503
152 Ga0207659_10006985 3300025926 Bacteria 6932
153 Ga0207690_10066662 3300025932 Bacteria 2466
154 Ga0207690_10067875 3300025932 Bacteria 2447
155 Ga0207690_10320720 3300025932 Bacteria 1218
156 Ga0207706_10000554 3300025933 Bacteria 39755
157 Ga0207670_10000010 3300025936 Bacteria 283265
158 Ga0207670_10018879 3300025936 Bacteria 4201
159 Ga0207691_10080285 3300025940 Bacteria 2934
160 Ga0207691_10137973 3300025940 Bacteria 2150
161 Ga0207661_10037558 3300025944 Bacteria 3789
162 Ga0207661_10207710 3300025944 Bacteria 1724
163 Ga0207679_10051375 3300025945 Bacteria 3017
164 Ga0207667_10014001 3300025949 Bacteria 9158
165 Ga0207667_10014872 3300025949 Bacteria 8851
166 Ga0207651_10008904 3300025960 Bacteria 5453
167 Ga0207677_10074843 3300026023 Bacteria 2404
168 Ga0207703_10048305 3300026035 Bacteria 3435
169 Ga0207639_10003573 3300026041 Bacteria 10445
170 Ga0207639_10411575 3300026041 Bacteria 1220
171 Ga0207678_10028777 3300026067 Bacteria 4851
172 Ga0207678_10036273 3300026067 Bacteria 4292
173 Ga0207702_10195131 3300026078 Bacteria 1873
174 Ga0207702_10265180 3300026078 Bacteria 1618
175 Ga0207702_10383989 3300026078 Bacteria 1351
176 Ga0207676_10063649 3300026095 Bacteria 2930
177 Ga0207674_10190090 3300026116 Bacteria 2003
178 Ga0207674_10475961 3300026116 Bacteria 1207
179 Ga0207675_100019540 3300026118 Bacteria 6323
180 Ga0207675_100050877 3300026118 Bacteria 3867
181 Ga0207698_10137525 3300026142 Bacteria 2098
182 Ga0209974_10028405 3300027876 Bacteria 1853
183 Ga0207428_10016978 3300027907 Bacteria 6254
184 Ga0268264_10021568 3300028381 Bacteria 5259
185 Ga0265318_10010659 3300028577 Bacteria 3994
186 Ga0265330_10000214 3300031235 Bacteria 44995
187 Ga0265332_10000244 3300031238 Bacteria 43234
188 Ga0265332_10019928 3300031238 Bacteria 2961
189 Ga0265328_10005680 3300031239 Bacteria 5328
190 Ga0265320_10000036 3300031240 Bacteria 136231
191 Ga0265320_10072970 3300031240 Bacteria 1614
192 Ga0265325_10025725 3300031241 Bacteria 3194
193 Ga0265329_10015860 3300031242 Bacteria 2623
194 Ga0265340_10030795 3300031247 Bacteria 2687
195 Ga0265339_10003813 3300031249 Bacteria 10481
196 Ga0265331_10000205 3300031250 Bacteria 71426
197 Ga0265316_10021332 3300031344 Bacteria 5488
198 Ga0265316_10028087 3300031344 Bacteria 4645
199 Ga0307408_100097622 3300031548 Bacteria 2232
200 Ga0307408_100278160 3300031548 Bacteria 1393
201 Ga0307408_100384646 3300031548 Bacteria 1200
202 Ga0265313_10000327 3300031595 Bacteria 51611
203 Ga0265313_10040744 3300031595 Bacteria 2293
204 Ga0316575_10008319 3300031665 Bacteria 3774
205 Ga0316575_10022864 3300031665 Bacteria 2414
206 Ga0265314_10000296 3300031711 Bacteria 71336
207 Ga0265314_10040504 3300031711 Bacteria 3343
208 Ga0265342_10006564 3300031712 Bacteria 8651
209 Ga0316576_10234903 3300031727 Bacteria 1378
210 Ga0316578_10003296 3300031728 Bacteria 7345
211 Ga0307405_10097650 3300031731 Bacteria 1962
212 Ga0316577_10069007 3300031733 Unclassified 1974
213 Ga0307413_10016583 3300031824 Bacteria 3810
214 Ga0307413_10034441 3300031824 Bacteria 2895
215 Ga0307410_10033174 3300031852 Bacteria 3331
216 Ga0307410_10049278 3300031852 Bacteria 2826
217 Ga0307409_100007989 3300031995 Bacteria 6377
218 Ga0307414_10001305 3300032004 Bacteria 12881
219 Ga0307414_10128252 3300032004 Bacteria 1964
220 Ga0307414_10207083 3300032004 Bacteria 1600
221 Ga0307411_10001149 3300032005 Bacteria 10386
222 Ga0316583_10000270 3300032133 Bacteria 14326
223 Ga0316585_10003267 3300032137 Unclassified 4448
224 Ga0316588_1021219 3300033528 Unclassified 1477
225 Ga0316596_1001113 3300033541 Bacteria 5242
226 Ga0373950_0000013 3300034818 Bacteria 344674
227 Ga0373950_0000014 3300034818 Bacteria 284896
228 Ga0373955_0068349 3300035172 Bacteria 1980
229 Ga0316574_0017023 3300035398 Bacteria 4245
230 Ga0373933_0002451 3300035724 Bacteria 10441
231 Ga0373933_0123457 3300035724 Bacteria 1623
232 Ga0373937_0008667 3300036401 Bacteria 8838
233 Ga0316582_0058776 3300036647 Unclassified 2459
234 Ga0316584_0000366 3300036712 Bacteria 23275
235 Ga0373925_0022039 3300037068 Bacteria 4643
236 Ga0395905_0013426 3300037471 Bacteria 7848
237 Ga0316581_0002933 3300037588 Unclassified 4179
238 Ga0400488_35597 3300038741 Bacteria 5277
239 Ga0439455_0043395 3300042012 Bacteria 1157
240 Ga0450912_000721 3300042116 Bacteria 1771
241 Ga0450908_007549 3300042184 Bacteria 2049
242 Ga0451577_0000033 3300042876 Bacteria 378714
243 Ga0451577_0000040 3300042876 Bacteria 346755
244 Ga0451577_0000074 3300042876 Bacteria 232698
245 Ga0451577_0000193 3300042876 Bacteria 128594
246 Ga0451577_0000516 3300042876 Bacteria 64529
247 Ga0451577_0008612 3300042876 Bacteria 9918
248 Ga0451577_0019530 3300042876 Bacteria 6231
249 Ga0451577_0025329 3300042876 Bacteria 5383
250 Ga0451577_0027778 3300042876 Bacteria 5121
251 Ga0451577_0088392 3300042876 Bacteria 2765
252 Ga0451577_0151933 3300042876 Bacteria 2083
253 Ga0453683_0000220 3300044673 Bacteria 76196
254 Ga0453683_0000270 3300044673 Bacteria 68116
255 Ga0453683_0005192 3300044673 Bacteria 9117
256 Ga0453683_0008439 3300044673 Bacteria 6909
257 Ga0453683_0020245 3300044673 Bacteria 4252
258 Ga0453683_0023810 3300044673 Bacteria 3900
259 Ga0453683_0043575 3300044673 Bacteria 2816
260 Ga0453683_0132389 3300044673 Unclassified 1572
261 Ga0466965_0218431 3300044683 Bacteria 1015
262 Ga0453684_0000109 3300044712 Bacteria 361015
263 Ga0453684_0000179 3300044712 Bacteria 280195
264 Ga0453684_0000184 3300044712 Bacteria 274619
265 Ga0453684_0000482 3300044712 Bacteria 158296
266 Ga0453684_0000909 3300044712 Bacteria 98559
267 Ga0453684_0001270 3300044712 Bacteria 75637
268 Ga0453684_0001333 3300044712 Bacteria 72470
269 Ga0453684_0001604 3300044712 Bacteria 62138
270 Ga0453684_0002757 3300044712 Bacteria 41606
271 Ga0453684_0008616 3300044712 Bacteria 18175
272 Ga0453684_0015731 3300044712 Bacteria 11913
273 Ga0453684_0025086 3300044712 Bacteria 8673
274 Ga0453684_0025370 3300044712 Bacteria 8609
275 Ga0453684_0037314 3300044712 Bacteria 6671
276 Ga0453684_0047418 3300044712 Bacteria 5699
277 Ga0453684_0082581 3300044712 Bacteria 4002
278 Ga0453684_0183813 3300044712 Bacteria 2452
279 Ga0453684_0189986 3300044712 Bacteria 2403
280 Ga0453684_0200633 3300044712 Bacteria 2326
281 Ga0453684_0664649 3300044712 Bacteria 1136
282 Ga0466960_0025917 3300044901 Bacteria 2658
283 Ga0451576_0000469 3300045051 Bacteria 91565
284 Ga0451576_0000500 3300045051 Bacteria 86034
285 Ga0451576_0005041 3300045051 Bacteria 16748
286 Ga0451576_0017444 3300045051 Bacteria 7893
287 Ga0451576_0154040 3300045051 Bacteria 2397
288 Ga0451576_0234254 3300045051 Bacteria 1917
289 Ga0451576_0317711 3300045051 Bacteria 1629
290 Ga0466967_0323164 3300045976 Bacteria 1488
291 Ga0495638_0023773 3300046460 Bacteria 4003
292 Ga0495664_0023470 3300046477 Bacteria 3581
293 Ga0495630_0045313 3300046517 Bacteria 3286
294 Ga0495643_0106910 3300046522 Bacteria 1427
295 Ga0495598_0003844 3300046537 Bacteria 3216
296 Ga0495668_0000076 3300046616 Bacteria 161826
297 Ga0495625_0002357 3300046660 Bacteria 20583
298 Ga0495589_0041680 3300046794 Bacteria 2290
299 Ga0495672_0044104 3300047320 Bacteria 2677
300 Ga0496104_0133381 3300048907 Bacteria 2386
301 Ga0496114_0007566 3300048917 Bacteria 8591
302 Ga0496114_0237447 3300048917 Bacteria 1602
303 Ga0496114_0302934 3300048917 Bacteria 1411
304 Ga0501032_0008942 3300049569 Bacteria 7284
305 Ga0501034_0000345 3300049571 Bacteria 80841
306 Ga0501034_0077342 3300049571 Bacteria 3333
307 Ga0501036_0007600 3300049572 Bacteria 8846
308 Ga0501036_0016269 3300049572 Bacteria 6213
309 Ga0501036_0019122 3300049572 Bacteria 5747
310 Ga0501038_0112960 3300049574 Bacteria 2248
311 Ga0501038_0163516 3300049574 Bacteria 1807
312 Ga0501039_0035760 3300049575 Bacteria 3834
313 Ga0501041_0059659 3300049577 Bacteria 2335
314 Ga0501043_0000507 3300049579 Bacteria 35036
315 Ga0501043_0155027 3300049579 Bacteria 1791
316 Ga0501046_0000531 3300049580 Bacteria 37752
317 Ga0501046_0088107 3300049580 Bacteria 2391
318 Ga0501046_0093795 3300049580 Bacteria 2307
319 Ga0501047_0000002 3300049581 Bacteria 553775
320 Ga0501047_0177300 3300049581 Bacteria 1998
321 Ga0501048_0003426 3300049582 Bacteria 12046
322 Ga0501048_0056533 3300049582 Bacteria 2784
323 Ga0501067_0000007 3300049583 Bacteria 126276
324 Ga0501067_0032929 3300049583 Bacteria 2876
325 Ga0501068_0001993 3300049584 Bacteria 10876
326 Ga0501068_0048685 3300049584 Bacteria 2560
327 Ga0501069_0114752 3300049585 Bacteria 1536
328 Ga0501070_0000151 3300049586 Bacteria 63686
329 Ga0501070_0019975 3300049586 Bacteria 5616
330 Ga0501072_0000098 3300049588 Bacteria 64914
331 Ga0501073_0000171 3300049589 Bacteria 42329
332 Ga0501073_0000195 3300049589 Bacteria 40113
333 Ga0501073_0014414 3300049589 Bacteria 5744
334 Ga0501073_0014818 3300049589 Bacteria 5658
335 Ga0501074_0001032 3300049590 Bacteria 18072
336 Ga0501074_0047070 3300049590 Unclassified 3118
337 Ga0501074_0172347 3300049590 Bacteria 1544
338 Ga0501079_0000197 3300049741 Bacteria 34947
339 Ga0501079_0175469 3300049741 Unclassified 1671
340 Ga0501080_0002108 3300049742 Bacteria 17262
341 Ga0501080_0006293 3300049742 Bacteria 10656
342 Ga0501080_0008247 3300049742 Bacteria 9436
343 Ga0501081_0016884 3300049743 Bacteria 4824
344 Ga0501083_0003713 3300049744 Bacteria 10727
345 Ga0501083_0013367 3300049744 Bacteria 5738
346 Ga0501035_0044019 3300049822 Bacteria 4021
347 Ga0501045_0118463 3300049824 Bacteria 1965
348 nmdc:mga00v17_56563_c1 3300050491 Bacteria 2399
349 nmdc:mga0k408_12538_c1 3300050493 Bacteria 4636
350 nmdc:mga06z11_93274_c1 3300050494 Bacteria 1639
351 nmdc:mga04h51_8011_c1 3300050495 Bacteria 2813
352 nmdc:mga05p37_10703_c1 3300050507 Bacteria 10889
353 nmdc:mga09592_21502_c1 3300050508 Bacteria 5315
354 nmdc:mga06r32_100779_c1 3300050510 Unclassified 2833
355 nmdc:mga06r32_199705_c1 3300050510 Bacteria 1987
356 nmdc:mga06r32_320291_c1 3300050510 Unclassified 1536
357 nmdc:mga06r32_39599_c1 3300050510 Bacteria 4473
358 nmdc:mga08y16_72166_c1 3300050511 Bacteria 3598
359 nmdc:mga08y16_97358_c1 3300050511 Bacteria 3064
360 nmdc:mga0n895_573223_c1 3300050512 Unclassified 1133
361 nmdc:mga08x19_294889_c1 3300050514 Unclassified 1126
362 Ga0495601_0158020 3300053077 Bacteria 1481
363 Ga0500643_000004 3300053087 Bacteria 857484
364 Ga0500651_0219767 3300053093 Bacteria 1115
365 Ga0500641_0000690 3300053096 Bacteria 12210
366 Ga0500555_000387 3300053103 Bacteria 18508
367 Ga0500568_0001059 3300053139 Bacteria 18723
368 Ga0500616_0000204 3300053153 Bacteria 96997
369 Ga0500627_0000003 3300053158 Bacteria 178186
370 Ga0500645_000365 3300053730 Bacteria 32071
371 Ga0501084_0000025 3300054114 Bacteria 133611
372 Ga0501084_0020050 3300054114 Bacteria 5575
373 Ga0501082_0074622 3300060353 Bacteria 2921
374 Ga0501082_0263278 3300060353 Bacteria 1500

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049590 Ga0501074_0047070 Ga0501074_0047070_2087_3064 313
2 3300050510 nmdc:mga06r32_199705_c1 nmdc:mga06r32_199705_c1_407_1390 313
3 3300050510 nmdc:mga06r32_320291_c1 nmdc:mga06r32_320291_c1_239_1213 313
4 3300044683 Ga0466965_0218431 Ga0466965_0218431_14_1003 314
5 iso_pu_bacteria 8046991243 8046996770 321
6 3300053093 Ga0500651_0219767 Ga0500651_0219767_72_1079 323
7 3300044712 Ga0453684_0189986 Ga0453684_0189986_1078_2136 325
8 3300048907 Ga0496104_0133381 Ga0496104_0133381_846_1901 325
9 3300005445 Ga0070708_100155449 Ga0070708_1001554492 327
10 3300009147 Ga0114129_10253322 Ga0114129_102533222 328
11 3300042876 Ga0451577_0027778 Ga0451577_0027778_2251_3312 328
12 3300005564 Ga0070664_100131355 Ga0070664_1001313552 329
13 3300006051 Ga0075364_10061250 Ga0075364_100612503 329
14 3300049572 Ga0501036_0019122 Ga0501036_0019122_2267_3325 329
15 3300049577 Ga0501041_0059659 Ga0501041_0059659_66_1124 329
16 3300049580 Ga0501046_0088107 Ga0501046_0088107_390_1448 329
17 3300049582 Ga0501048_0056533 Ga0501048_0056533_157_1215 329
18 3300049741 Ga0501079_0175469 Ga0501079_0175469_560_1618 329
19 3300005618 Ga0068864_100076199 Ga0068864_1000761992 332
20 3300026095 Ga0207676_10063649 Ga0207676_100636492 332
21 3300049824 Ga0501045_0118463 Ga0501045_0118463_278_1336 332
22 3300005445 Ga0070708_100014574 Ga0070708_1000145743 333
23 3300005467 Ga0070706_100006993 Ga0070706_1000069936 333
24 3300005518 Ga0070699_100216891 Ga0070699_1002168912 333
25 3300005985 Ga0081539_10048532 Ga0081539_100485323 333
26 3300006048 Ga0075363_100011005 Ga0075363_1000110053 333
27 3300006353 Ga0075370_10138469 Ga0075370_101384691 333
28 3300026118 Ga0207675_100019540 Ga0207675_1000195402 333
29 3300050491 nmdc:mga00v17_56563_c1 nmdc:mga00v17_56563_c1_1099_2169 333
30 3300050494 nmdc:mga06z11_93274_c1 nmdc:mga06z11_93274_c1_310_1380 333
31 3300050495 nmdc:mga04h51_8011_c1 nmdc:mga04h51_8011_c1_399_1469 333
32 3300005937 Ga0081455_10029139 Ga0081455_100291393 334
33 3300005937 Ga0081455_10065984 Ga0081455_100659843 334
34 3300017792 Ga0163161_10113422 Ga0163161_101134221 334
35 3300025940 Ga0207691_10080285 Ga0207691_100802854 334
36 3300046794 Ga0495589_0041680 Ga0495589_0041680_1104_2147 334
37 3300049744 Ga0501083_0013367 Ga0501083_0013367_1086_2126 334
38 3300054114 Ga0501084_0020050 Ga0501084_0020050_911_1951 334
39 3300060353 Ga0501082_0263278 Ga0501082_0263278_390_1430 334
40 3300006048 Ga0075363_100051323 Ga0075363_1000513234 335
41 3300006195 Ga0075366_10075231 Ga0075366_100752311 335
42 3300042184 Ga0450908_007549 Ga0450908_007549_735_1805 335
43 3300050493 nmdc:mga0k408_12538_c1 nmdc:mga0k408_12538_c1_2654_3724 335
44 3300005364 Ga0070673_100274778 Ga0070673_1002747781 336
45 3300009176 Ga0105242_10296139 Ga0105242_102961392 336
46 3300025893 Ga0207682_10103042 Ga0207682_101030421 336
47 3300025926 Ga0207659_10006985 Ga0207659_100069857 336
48 3300053103 Ga0500555_000387 Ga0500555_000387_17421_18491 336
49 3300053730 Ga0500645_000365 Ga0500645_000365_30597_31667 336
50 3300005535 Ga0070684_100098172 Ga0070684_1000981723 339
51 3300025944 Ga0207661_10037558 Ga0207661_100375582 339
52 3300044712 Ga0453684_0015731 Ga0453684_0015731_1690_2742 339
53 3300044712 Ga0453684_0025370 Ga0453684_0025370_2427_3479 339
54 3300009093 Ga0105240_10000717 Ga0105240_1000071722 340
55 3300025913 Ga0207695_10010779 Ga0207695_100107791 340
56 3300037471 Ga0395905_0013426 Ga0395905_0013426_4464_5537 340
57 3300042876 Ga0451577_0088392 Ga0451577_0088392_421_1479 340
58 3300042876 Ga0451577_0151933 Ga0451577_0151933_652_1773 340
59 3300044673 Ga0453683_0023810 Ga0453683_0023810_1056_2177 340
60 3300044712 Ga0453684_0001604 Ga0453684_0001604_1212_2270 340
61 3300044712 Ga0453684_0002757 Ga0453684_0002757_15219_16277 340
62 3300044712 Ga0453684_0664649 Ga0453684_0664649_63_1121 340
63 3300045051 Ga0451576_0017444 Ga0451576_0017444_6118_7239 340
64 3300045051 Ga0451576_0234254 Ga0451576_0234254_785_1843 340
65 3300045051 Ga0451576_0317711 Ga0451576_0317711_453_1511 340
66 iso_pu_bacteria 2857460504 2857460711 340
67 3300005981 Ga0081538_10002944 Ga0081538_100029449 341
68 3300031241 Ga0265325_10025725 Ga0265325_100257253 341
69 3300031548 Ga0307408_100278160 Ga0307408_1002781602 341
70 3300031595 Ga0265313_10040744 Ga0265313_100407442 341
71 3300034818 Ga0373950_0000013 Ga0373950_0000013_246151_247227 341
72 3300044673 Ga0453683_0020245 Ga0453683_0020245_2995_4056 341
73 3300049571 Ga0501034_0000345 Ga0501034_0000345_43953_45026 341
74 3300049572 Ga0501036_0016269 Ga0501036_0016269_3999_5072 341
75 3300049574 Ga0501038_0163516 Ga0501038_0163516_199_1272 341
76 3300049579 Ga0501043_0000507 Ga0501043_0000507_26694_27767 341
77 3300049580 Ga0501046_0000531 Ga0501046_0000531_33185_34258 341
78 3300049581 Ga0501047_0000002 Ga0501047_0000002_117480_118553 341
79 3300049582 Ga0501048_0003426 Ga0501048_0003426_3799_4872 341
80 3300049584 Ga0501068_0001993 Ga0501068_0001993_3951_5024 341
81 3300049585 Ga0501069_0114752 Ga0501069_0114752_272_1345 341
82 3300049586 Ga0501070_0019975 Ga0501070_0019975_2060_3133 341
83 3300049588 Ga0501072_0000098 Ga0501072_0000098_6680_7753 341
84 3300049589 Ga0501073_0000171 Ga0501073_0000171_3104_4192 341
85 3300049589 Ga0501073_0014414 Ga0501073_0014414_2188_3261 341
86 3300049590 Ga0501074_0001032 Ga0501074_0001032_11125_12198 341
87 3300049590 Ga0501074_0172347 Ga0501074_0172347_379_1467 341
88 3300049741 Ga0501079_0000197 Ga0501079_0000197_30088_31161 341
89 3300049742 Ga0501080_0002108 Ga0501080_0002108_3788_4861 341
90 3300054114 Ga0501084_0000025 Ga0501084_0000025_15059_16132 341
91 3300005331 Ga0070670_100233902 Ga0070670_1002339022 342
92 3300005334 Ga0068869_100151579 Ga0068869_1001515792 342
93 3300005337 Ga0070682_100190786 Ga0070682_1001907861 342
94 3300005338 Ga0068868_100116388 Ga0068868_1001163881 342
95 3300005340 Ga0070689_100100321 Ga0070689_1001003213 342
96 3300005343 Ga0070687_100013765 Ga0070687_1000137653 342
97 3300005364 Ga0070673_100002653 Ga0070673_1000026539 342
98 3300005544 Ga0070686_100005311 Ga0070686_1000053119 342
99 3300005618 Ga0068864_100027501 Ga0068864_1000275014 342
100 3300005840 Ga0068870_10133701 Ga0068870_101337012 342
101 3300005841 Ga0068863_100186859 Ga0068863_1001868592 342
102 3300005844 Ga0068862_100018691 Ga0068862_1000186912 342
103 3300006844 Ga0075428_100093618 Ga0075428_1000936184 342
104 3300009177 Ga0105248_10304117 Ga0105248_103041171 342
105 3300013296 Ga0157374_10140196 Ga0157374_101401963 342
106 3300014969 Ga0157376_10241869 Ga0157376_102418691 342
107 3300025908 Ga0207643_10026057 Ga0207643_100260572 342
108 3300025914 Ga0207671_10001281 Ga0207671_1000128123 342
109 3300025936 Ga0207670_10018879 Ga0207670_100188795 342
110 3300025945 Ga0207679_10051375 Ga0207679_100513753 342
111 3300025960 Ga0207651_10008904 Ga0207651_100089044 342
112 3300026023 Ga0207677_10074843 Ga0207677_100748433 342
113 3300026067 Ga0207678_10028777 Ga0207678_100287773 342
114 3300026116 Ga0207674_10190090 Ga0207674_101900902 342
115 3300028577 Ga0265318_10010659 Ga0265318_100106592 342
116 3300031235 Ga0265330_10000214 Ga0265330_1000021417 342
117 3300031238 Ga0265332_10000244 Ga0265332_1000024416 342
118 3300031239 Ga0265328_10005680 Ga0265328_100056807 342
119 3300031240 Ga0265320_10000036 Ga0265320_1000003671 342
120 3300031240 Ga0265320_10072970 Ga0265320_100729702 342
121 3300031242 Ga0265329_10015860 Ga0265329_100158602 342
122 3300031247 Ga0265340_10030795 Ga0265340_100307953 342
123 3300031250 Ga0265331_10000205 Ga0265331_1000020546 342
124 3300031344 Ga0265316_10021332 Ga0265316_100213321 342
125 3300031595 Ga0265313_10000327 Ga0265313_1000032718 342
126 3300031665 Ga0316575_10008319 Ga0316575_100083192 342
127 3300031711 Ga0265314_10000296 Ga0265314_1000029645 342
128 3300031712 Ga0265342_10006564 Ga0265342_100065646 342
129 3300031727 Ga0316576_10234903 Ga0316576_102349031 342
130 3300031728 Ga0316578_10003296 Ga0316578_100032966 342
131 3300031733 Ga0316577_10069007 Ga0316577_100690071 342
132 3300032133 Ga0316583_10000270 Ga0316583_1000027012 342
133 3300032137 Ga0316585_10003267 Ga0316585_100032676 342
134 3300033528 Ga0316588_1021219 Ga0316588_10212192 342
135 3300033541 Ga0316596_1001113 Ga0316596_10011132 342
136 3300035724 Ga0373933_0123457 Ga0373933_0123457_415_1488 342
137 3300036647 Ga0316582_0058776 Ga0316582_0058776_319_1395 342
138 3300036712 Ga0316584_0000366 Ga0316584_0000366_19437_20513 342
139 3300037068 Ga0373925_0022039 Ga0373925_0022039_769_1848 342
140 3300037588 Ga0316581_0002933 Ga0316581_0002933_2206_3282 342
141 3300038741 Ga0400488_35597 Ga0400488_35597_3794_4858 342
142 3300042876 Ga0451577_0000040 Ga0451577_0000040_125636_126706 342
143 3300042876 Ga0451577_0008612 Ga0451577_0008612_6390_7451 342
144 3300042876 Ga0451577_0025329 Ga0451577_0025329_1228_2289 342
145 3300044673 Ga0453683_0000270 Ga0453683_0000270_58032_59093 342
146 3300044673 Ga0453683_0005192 Ga0453683_0005192_2024_3085 342
147 3300044673 Ga0453683_0008439 Ga0453683_0008439_2828_3889 342
148 3300044673 Ga0453683_0132389 Ga0453683_0132389_382_1443 342
149 3300044712 Ga0453684_0000179 Ga0453684_0000179_220024_221094 342
150 3300044712 Ga0453684_0000909 Ga0453684_0000909_69252_70313 342
151 3300044712 Ga0453684_0008616 Ga0453684_0008616_12220_13281 342
152 3300044712 Ga0453684_0025086 Ga0453684_0025086_3099_4160 342
153 3300045051 Ga0451576_0005041 Ga0451576_0005041_3212_4273 342
154 3300046477 Ga0495664_0023470 Ga0495664_0023470_894_1979 342
155 3300046517 Ga0495630_0045313 Ga0495630_0045313_1658_2743 342
156 3300048917 Ga0496114_0007566 Ga0496114_0007566_3618_4691 342
157 3300048917 Ga0496114_0237447 Ga0496114_0237447_227_1312 342
158 3300053077 Ga0495601_0158020 Ga0495601_0158020_234_1307 342
159 3300003841 Ga0055541_1006550 Ga0055541_10065502 343
160 3300005340 Ga0070689_100000009 Ga0070689_100000009124 343
161 3300005353 Ga0070669_100388813 Ga0070669_1003888131 343
162 3300005364 Ga0070673_100016920 Ga0070673_1000169207 343
163 3300005458 Ga0070681_10131044 Ga0070681_101310442 343
164 3300005530 Ga0070679_100001057 Ga0070679_10000105716 343
165 3300005539 Ga0068853_100041211 Ga0068853_1000412114 343
166 3300005563 Ga0068855_100058662 Ga0068855_1000586623 343
167 3300005614 Ga0068856_100135006 Ga0068856_1001350062 343
168 3300005616 Ga0068852_100073898 Ga0068852_1000738982 343
169 3300005616 Ga0068852_100162583 Ga0068852_1001625832 343
170 3300005617 Ga0068859_100009405 Ga0068859_1000094058 343
171 3300005617 Ga0068859_100402472 Ga0068859_1004024722 343
172 3300005719 Ga0068861_100051112 Ga0068861_1000511121 343
173 3300005842 Ga0068858_100148469 Ga0068858_1001484693 343
174 3300005843 Ga0068860_100006870 Ga0068860_1000068702 343
175 3300005843 Ga0068860_100167917 Ga0068860_1001679173 343
176 3300005985 Ga0081539_10000718 Ga0081539_1000071828 343
177 3300006844 Ga0075428_100056751 Ga0075428_1000567515 343
178 3300006844 Ga0075428_100074272 Ga0075428_1000742723 343
179 3300006846 Ga0075430_100290709 Ga0075430_1002907092 343
180 3300006847 Ga0075431_100069816 Ga0075431_1000698165 343
181 3300006852 Ga0075433_10178043 Ga0075433_101780433 343
182 3300006852 Ga0075433_10241331 Ga0075433_102413312 343
183 3300006871 Ga0075434_100005288 Ga0075434_10000528814 343
184 3300006880 Ga0075429_100043726 Ga0075429_1000437265 343
185 3300006914 Ga0075436_100098812 Ga0075436_1000988122 343
186 3300006931 Ga0097620_100009405 Ga0097620_1000094058 343
187 3300006931 Ga0097620_100402426 Ga0097620_1004024262 343
188 3300009101 Ga0105247_10207039 Ga0105247_102070391 343
189 3300009147 Ga0114129_10006906 Ga0114129_100069068 343
190 3300009147 Ga0114129_10055308 Ga0114129_100553081 343
191 3300009545 Ga0105237_10000235 Ga0105237_1000023520 343
192 3300009551 Ga0105238_10016624 Ga0105238_100166249 343
193 3300013306 Ga0163162_10085799 Ga0163162_100857992 343
194 3300014326 Ga0157380_10065761 Ga0157380_100657614 343
195 3300017792 Ga0163161_10059373 Ga0163161_100593732 343
196 3300025225 Ga0209566_100070 Ga0209566_10007050 343
197 3300025900 Ga0207710_10115829 Ga0207710_101158291 343
198 3300025909 Ga0207705_10011069 Ga0207705_100110697 343
199 3300025911 Ga0207654_10150429 Ga0207654_101504291 343
200 3300025912 Ga0207707_10206609 Ga0207707_102066092 343
201 3300025917 Ga0207660_10007162 Ga0207660_100071629 343
202 3300025921 Ga0207652_10005175 Ga0207652_100051757 343
203 3300025923 Ga0207681_10142464 Ga0207681_101424642 343
204 3300025924 Ga0207694_10039690 Ga0207694_100396903 343
205 3300025924 Ga0207694_10084106 Ga0207694_100841062 343
206 3300025932 Ga0207690_10066662 Ga0207690_100666623 343
207 3300025936 Ga0207670_10000010 Ga0207670_10000010167 343
208 3300025940 Ga0207691_10137973 Ga0207691_101379733 343
209 3300025949 Ga0207667_10014001 Ga0207667_100140013 343
210 3300026035 Ga0207703_10048305 Ga0207703_100483054 343
211 3300026041 Ga0207639_10003573 Ga0207639_1000357310 343
212 3300026078 Ga0207702_10195131 Ga0207702_101951311 343
213 3300026078 Ga0207702_10265180 Ga0207702_102651802 343
214 3300026116 Ga0207674_10475961 Ga0207674_104759611 343
215 3300026118 Ga0207675_100050877 Ga0207675_1000508771 343
216 3300026142 Ga0207698_10137525 Ga0207698_101375251 343
217 3300027876 Ga0209974_10028405 Ga0209974_100284053 343
218 3300027907 Ga0207428_10016978 Ga0207428_100169784 343
219 3300028381 Ga0268264_10021568 Ga0268264_100215682 343
220 3300031238 Ga0265332_10019928 Ga0265332_100199283 343
221 3300031249 Ga0265339_10003813 Ga0265339_100038136 343
222 3300031344 Ga0265316_10028087 Ga0265316_100280872 343
223 3300031548 Ga0307408_100384646 Ga0307408_1003846461 343
224 3300031665 Ga0316575_10022864 Ga0316575_100228642 343
225 3300031711 Ga0265314_10040504 Ga0265314_100405043 343
226 3300031824 Ga0307413_10016583 Ga0307413_100165833 343
227 3300031852 Ga0307410_10033174 Ga0307410_100331742 343
228 3300031995 Ga0307409_100007989 Ga0307409_1000079895 343
229 3300032005 Ga0307411_10001149 Ga0307411_100011492 343
230 3300034818 Ga0373950_0000014 Ga0373950_0000014_121697_122767 343
231 3300035172 Ga0373955_0068349 Ga0373955_0068349_506_1573 343
232 3300035398 Ga0316574_0017023 Ga0316574_0017023_3073_4215 343
233 3300035724 Ga0373933_0002451 Ga0373933_0002451_6338_7405 343
234 3300036401 Ga0373937_0008667 Ga0373937_0008667_2371_3438 343
235 3300042012 Ga0439455_0043395 Ga0439455_0043395_47_1117 343
236 3300042876 Ga0451577_0000033 Ga0451577_0000033_109130_110200 343
237 3300042876 Ga0451577_0000074 Ga0451577_0000074_146781_147866 343
238 3300042876 Ga0451577_0000193 Ga0451577_0000193_48637_49710 343
239 3300042876 Ga0451577_0000516 Ga0451577_0000516_42769_43842 343
240 3300042876 Ga0451577_0019530 Ga0451577_0019530_1729_2802 343
241 3300044673 Ga0453683_0000220 Ga0453683_0000220_39536_40651 343
242 3300044673 Ga0453683_0043575 Ga0453683_0043575_20_1093 343
243 3300044712 Ga0453684_0000109 Ga0453684_0000109_251886_252956 343
244 3300044712 Ga0453684_0000482 Ga0453684_0000482_10431_11516 343
245 3300044712 Ga0453684_0001270 Ga0453684_0001270_53855_54928 343
246 3300044712 Ga0453684_0001333 Ga0453684_0001333_22994_24067 343
247 3300044712 Ga0453684_0037314 Ga0453684_0037314_440_1513 343
248 3300044712 Ga0453684_0047418 Ga0453684_0047418_4174_5259 343
249 3300044712 Ga0453684_0082581 Ga0453684_0082581_115_1188 343
250 3300044712 Ga0453684_0183813 Ga0453684_0183813_1041_2114 343
251 3300044712 Ga0453684_0200633 Ga0453684_0200633_865_1941 343
252 3300044901 Ga0466960_0025917 Ga0466960_0025917_1161_2252 343
253 3300045051 Ga0451576_0000469 Ga0451576_0000469_69783_70856 343
254 3300045051 Ga0451576_0000500 Ga0451576_0000500_73208_74272 343
255 3300045051 Ga0451576_0154040 Ga0451576_0154040_775_1848 343
256 3300045976 Ga0466967_0323164 Ga0466967_0323164_52_1185 343
257 3300046460 Ga0495638_0023773 Ga0495638_0023773_563_1636 343
258 3300047320 Ga0495672_0044104 Ga0495672_0044104_675_1748 343
259 3300048917 Ga0496114_0302934 Ga0496114_0302934_143_1219 343
260 3300049571 Ga0501034_0077342 Ga0501034_0077342_752_1867 343
261 3300049583 Ga0501067_0000007 Ga0501067_0000007_85888_86958 343
262 3300049583 Ga0501067_0032929 Ga0501067_0032929_1755_2825 343
263 3300049584 Ga0501068_0048685 Ga0501068_0048685_415_1494 343
264 3300049586 Ga0501070_0000151 Ga0501070_0000151_23886_24962 343
265 3300049589 Ga0501073_0000195 Ga0501073_0000195_30843_31913 343
266 3300049589 Ga0501073_0014818 Ga0501073_0014818_2818_3894 343
267 3300049742 Ga0501080_0006293 Ga0501080_0006293_9163_10239 343
268 3300049742 Ga0501080_0008247 Ga0501080_0008247_1921_3000 343
269 3300049743 Ga0501081_0016884 Ga0501081_0016884_2680_3756 343
270 3300049744 Ga0501083_0003713 Ga0501083_0003713_1867_2943 343
271 3300050507 nmdc:mga05p37_10703_c1 nmdc:mga05p37_10703_c1_6554_7624 343
272 3300050508 nmdc:mga09592_21502_c1 nmdc:mga09592_21502_c1_1440_2510 343
273 3300050510 nmdc:mga06r32_100779_c1 nmdc:mga06r32_100779_c1_1274_2344 343
274 3300050510 nmdc:mga06r32_39599_c1 nmdc:mga06r32_39599_c1_2975_4084 343
275 3300050511 nmdc:mga08y16_72166_c1 nmdc:mga08y16_72166_c1_482_1561 343
276 3300050511 nmdc:mga08y16_97358_c1 nmdc:mga08y16_97358_c1_1014_2084 343
277 3300050512 nmdc:mga0n895_573223_c1 nmdc:mga0n895_573223_c1_25_1095 343
278 3300050514 nmdc:mga08x19_294889_c1 nmdc:mga08x19_294889_c1_30_1100 343
279 3300053096 Ga0500641_0000690 Ga0500641_0000690_7850_8923 343
280 3300053153 Ga0500616_0000204 Ga0500616_0000204_21600_22670 343
281 3300060353 Ga0501082_0074622 Ga0501082_0074622_1748_2824 343
282 3300044712 Ga0453684_0000184 Ga0453684_0000184_68468_69589 344
283 iso_pu_bacteria 2643221560 2643821035 346
284 iso_pu_bacteria 2643221563 2643834207 346
285 iso_pu_bacteria 2643221608 2644055132 346
286 iso_pu_bacteria 2852653556 2852654443 346
287 iso_pu_bacteria 2852680915 2852684359 346
288 3300046522 Ga0495643_0106910 Ga0495643_0106910_183_1283 349
289 iso_pu_bacteria 8002317523 8002318411 349
290 3300003781 Ga0055536_1001651 Ga0055536_100165112 350
291 3300003781 Ga0055536_1006815 Ga0055536_10068155 350
292 3300003781 Ga0055536_1022490 Ga0055536_10224902 350
293 3300003791 Ga0055530_10000280 Ga0055530_1000028021 350
294 3300003794 Ga0055531_10000272 Ga0055531_1000027222 350
295 3300003794 Ga0055531_10009340 Ga0055531_100093401 350
296 3300005327 Ga0070658_10048031 Ga0070658_100480311 350
297 3300005327 Ga0070658_10255081 Ga0070658_102550811 350
298 3300005329 Ga0070683_100007820 Ga0070683_1000078204 350
299 3300005329 Ga0070683_100149934 Ga0070683_1001499342 350
300 3300005336 Ga0070680_100001309 Ga0070680_10000130915 350
301 3300005339 Ga0070660_100015064 Ga0070660_1000150641 350
302 3300005339 Ga0070660_100147085 Ga0070660_1001470851 350
303 3300005344 Ga0070661_100014753 Ga0070661_1000147531 350
304 3300005344 Ga0070661_100068892 Ga0070661_1000688922 350
305 3300005344 Ga0070661_100119719 Ga0070661_1001197191 350
306 3300005354 Ga0070675_100404104 Ga0070675_1004041041 350
307 3300005366 Ga0070659_100012840 Ga0070659_1000128404 350
308 3300005366 Ga0070659_100021638 Ga0070659_1000216384 350
309 3300005455 Ga0070663_100029999 Ga0070663_1000299992 350
310 3300005457 Ga0070662_100001153 Ga0070662_10000115315 350
311 3300005457 Ga0070662_100146965 Ga0070662_1001469652 350
312 3300005458 Ga0070681_10028117 Ga0070681_100281171 350
313 3300005530 Ga0070679_100063641 Ga0070679_1000636413 350
314 3300005530 Ga0070679_100305824 Ga0070679_1003058241 350
315 3300005535 Ga0070684_100073356 Ga0070684_1000733563 350
316 3300005539 Ga0068853_100001767 Ga0068853_10000176715 350
317 3300005539 Ga0068853_100164155 Ga0068853_1001641552 350
318 3300005563 Ga0068855_100013562 Ga0068855_1000135621 350
319 3300005564 Ga0070664_100057388 Ga0070664_1000573883 350
320 3300005577 Ga0068857_100010938 Ga0068857_1000109382 350
321 3300005616 Ga0068852_100521113 Ga0068852_1005211131 350
322 3300009174 Ga0105241_10075688 Ga0105241_100756881 350
323 3300010375 Ga0105239_10156091 Ga0105239_101560912 350
324 3300013100 Ga0157373_10014266 Ga0157373_100142664 350
325 3300013102 Ga0157371_10015539 Ga0157371_100155392 350
326 3300013104 Ga0157370_10011346 Ga0157370_100113466 350
327 3300013104 Ga0157370_10117852 Ga0157370_101178521 350
328 3300013307 Ga0157372_10003505 Ga0157372_1000350513 350
329 3300013307 Ga0157372_10200013 Ga0157372_102000132 350
330 3300020082 Ga0206353_10162436 Ga0206353_101624363 350
331 3300025291 Ga0209675_1000075 Ga0209675_100007547 350
332 3300025292 Ga0209676_1000081 Ga0209676_100008190 350
333 3300025292 Ga0209676_1000949 Ga0209676_100094935 350
334 3300025292 Ga0209676_1001591 Ga0209676_100159120 350
335 3300025294 Ga0209025_1005730 Ga0209025_10057304 350
336 3300025298 Ga0209050_1000017 Ga0209050_1000017187 350
337 3300025298 Ga0209050_1002078 Ga0209050_100207813 350
338 3300025304 Ga0209257_1000206 Ga0209257_10002062 350
339 3300025304 Ga0209257_1001063 Ga0209257_100106315 350
340 3300025304 Ga0209257_1002115 Ga0209257_10021152 350
341 3300025909 Ga0207705_10000468 Ga0207705_1000046815 350
342 3300025909 Ga0207705_10013742 Ga0207705_100137422 350
343 3300025909 Ga0207705_10076260 Ga0207705_100762602 350
344 3300025911 Ga0207654_10104191 Ga0207654_101041912 350
345 3300025912 Ga0207707_10034360 Ga0207707_100343602 350
346 3300025917 Ga0207660_10047369 Ga0207660_100473693 350
347 3300025919 Ga0207657_10004843 Ga0207657_100048431 350
348 3300025919 Ga0207657_10058289 Ga0207657_100582893 350
349 3300025920 Ga0207649_10020484 Ga0207649_100204844 350
350 3300025920 Ga0207649_10052321 Ga0207649_100523213 350
351 3300025920 Ga0207649_10135603 Ga0207649_101356031 350
352 3300025921 Ga0207652_10129235 Ga0207652_101292351 350
353 3300025932 Ga0207690_10067875 Ga0207690_100678753 350
354 3300025932 Ga0207690_10320720 Ga0207690_103207201 350
355 3300025933 Ga0207706_10000554 Ga0207706_1000055412 350
356 3300025944 Ga0207661_10207710 Ga0207661_102077101 350
357 3300025949 Ga0207667_10014872 Ga0207667_100148727 350
358 3300026041 Ga0207639_10411575 Ga0207639_104115751 350
359 3300026067 Ga0207678_10036273 Ga0207678_100362733 350
360 3300026078 Ga0207702_10383989 Ga0207702_103839891 350
361 3300031548 Ga0307408_100097622 Ga0307408_1000976222 350
362 3300031731 Ga0307405_10097650 Ga0307405_100976503 350
363 3300031824 Ga0307413_10034441 Ga0307413_100344412 350
364 3300031852 Ga0307410_10049278 Ga0307410_100492783 350
365 3300032004 Ga0307414_10001305 Ga0307414_100013053 350
366 3300032004 Ga0307414_10128252 Ga0307414_101282522 350
367 3300032004 Ga0307414_10207083 Ga0307414_102070831 350
368 3300042116 Ga0450912_000721 Ga0450912_000721_413_1516 350
369 3300046537 Ga0495598_0003844 Ga0495598_0003844_202_1311 350
370 3300046616 Ga0495668_0000076 Ga0495668_0000076_19569_20654 350
371 3300046660 Ga0495625_0002357 Ga0495625_0002357_11045_12130 350
372 3300049569 Ga0501032_0008942 Ga0501032_0008942_5511_6596 350
373 3300049572 Ga0501036_0007600 Ga0501036_0007600_5204_6289 350
374 3300049574 Ga0501038_0112960 Ga0501038_0112960_148_1233 350
375 3300049575 Ga0501039_0035760 Ga0501039_0035760_663_1748 350
376 3300049579 Ga0501043_0155027 Ga0501043_0155027_33_1118 350
377 3300049580 Ga0501046_0093795 Ga0501046_0093795_216_1301 350
378 3300049581 Ga0501047_0177300 Ga0501047_0177300_97_1182 350
379 3300049822 Ga0501035_0044019 Ga0501035_0044019_2500_3585 350
380 3300053087 Ga0500643_000004 Ga0500643_000004_576683_577810 350
381 3300053139 Ga0500568_0001059 Ga0500568_0001059_12921_14006 350
382 3300053158 Ga0500627_0000003 Ga0500627_0000003_169937_171022 350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

111

355

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ht5-assembly1.cif.gz_A-2 crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis 0.9636 32 349
3jz6-assembly1.cif.gz_B crystal structure of mycobacterium smegmatis branched chain aminotransferase in complex with pyridoxal-5'-phosphate at 1.9 angstrom. 0.9619 5 349
5u3f-assembly1.cif.gz_B structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative 0.9497 32 349
3jz6-assembly1.cif.gz_B crystal structure of mycobacterium smegmatis branched chain aminotransferase in complex with pyridoxal-5'-phosphate at 1.9 angstrom. 0.9458 5 349
5u3f-assembly1.cif.gz_A structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative 0.9435 35 349
ID Description Score Start End Superfamily
5u3fA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9785 35 170 3.30.470.10
3jz6B01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9761 5 174 3.30.470.10
af_P9WQ75_8_180_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9707 6 177 3.90.180.10
af_P9WQ75_8_180_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9598 6 177 3.90.180.10
5u3fA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9509 35 170 3.30.470.10
ID Description Score Start End GO Terms
AF-A0A352WS16-F1-model_v4 Branched chain amino acid aminotransferase 0.9806 42 161 GO:0004084
GO:0009081
AF-A0A1S6XGX8-F1-model_v4 deleted 0.9784 5 164
AF-A0A520JI11-F1-model_v4 Branched-chain-amino-acid aminotransferase (EC 2.6.1.42) 0.9764 1 294 GO:0009097
GO:0009098
GO:0009099
GO:0052655
GO:0052656
AF-A0A845RU54-F1-model_v4 Branched-chain-amino-acid aminotransferase (EC 2.6.1.42) 0.9735 38 348 GO:0004084
GO:0009097
GO:0009098
GO:0009099
AF-A0A3D4QT90-F1-model_v4 Branched chain amino acid aminotransferase 0.9724 41 239 GO:0004084
GO:0008652
GO:0009082

Feature Viewer

pLDDT pTM Quality
91.85 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map