F429150

General Info

Members Datasets Scaffolds Average Seq Length
382 232 339 489

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1001247|JGI25159J45721_10012473
Length 513
Sequence MTAKCVMVLGTTSGAGKSWLTTALCRYYARQGLTVAPFKAQNMSNNARVVSPHAPPLRGSLPPEGANFSWGGPAENWVAQGEIGSAQYFQALAARAVPDVRMNPLLLKPEKDTQSQVVLMGQVNAELSRMEWRGRSASVWPVVSRALDELIANNDVVVMEGAGSPAEINLKASDIVNMRAAQHARANCLLVTDIDRGGAFAHLYGTWAMLDESERQLIKGFVLNKFRGDARLLAPGPQMLQDMTGVPTVATLPMWWQHGLPEEDGVFDDRSVTGSGGSVTRTVAVIAYPRISNLDEFQPLKNVPGVRLKWVRSPAELVDADWVILPGSKHTSGDLAWLRKQGLDEAVAAHAGRGGAVLGICGGLQMLGEALIDPHGIDGNAPGLGLLPVVTVFDEAKTVRHRQAAFTPLQGMWSALSGTEVKGYEIHHGQTAPHSAMAAAGDVAHAVMPEGLAWQNQAGNVLGLYLHGMFEDPRVLQALFGAAVPTLDSVFDGLADYIAEHFAPGVLQGLIAH

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
8 2643221658 Variovorax sp. Root411 Isolate Unclassified
9 2643221672 Variovorax sp. Root434 Isolate Unclassified
10 2643221683 Variovorax sp. Root473 Isolate Unclassified
11 2738541277 Variovorax sp. GV051 Isolate Unclassified
12 2738541307 Variovorax sp. GV008 Isolate Unclassified
13 2738543019 Variovorax sp. GV040 Isolate Unclassified
14 2818991446 Variovorax sp. 1180 Isolate Unclassified
15 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
16 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
17 2842677519 Variovorax sp. R-72495 Isolate Unclassified
18 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
19 2842733646 Variovorax sp. R-72446 Isolate Unclassified
20 2842747753 Variovorax sp. R-72060 Isolate Unclassified
21 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
22 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
23 2885198086 Variovorax sp. 679 Isolate Unclassified
24 2885211737 Variovorax sp. 553 Isolate Unclassified
25 2899924645 Variovorax sp. 369 Isolate Unclassified
26 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
27 2904456579 Variovorax sp. 2002 Isolate Unclassified
28 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
29 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
30 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
31 2928037797 Variovorax sp. 1126 Isolate Unclassified
32 2928044640 Variovorax sp. 1128 Isolate Unclassified
33 2928051484 Variovorax sp. 1133 Isolate Unclassified
34 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
35 2928070936 Variovorax gossypii 1167 Isolate Unclassified
36 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
37 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
38 2929520902 Variovorax beijingensis 502 Isolate Unclassified
39 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
40 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
41 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
42 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
43 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
44 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
45 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
46 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
47 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
48 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
49 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
50 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
51 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
52 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
53 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
54 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
55 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
56 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
57 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
58 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
59 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
60 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
61 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
62 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
63 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
64 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
65 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
66 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
67 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
68 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
69 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
70 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
71 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
72 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
73 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
74 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
103 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
110 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
111 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
112 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
115 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
116 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
175 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
176 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
177 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
178 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
179 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
180 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
181 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
199 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
214 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
221 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
224 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
225 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
226 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
227 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
228 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
229 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
232 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.22
Metatranscriptomes 0.52
Isolates 11.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 44.5
Nodule 0.79
Rhizoplane 0.79
Rhizosphere 34.29
Stem 0
Stem Tuber 0
Unclassified 19.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10014319 3300001979 Bacteria 2928
2 JGI25155J39150_1000152 3300002704 Bacteria 31050
3 JGI25156J39149_1000025 3300002705 Bacteria 136287
4 JGI25156J39149_1000260 3300002705 Bacteria 36113
5 JGI25154J39366_1000045 3300002738 Bacteria 136302
6 JGI25154J39366_1001047 3300002738 Bacteria 11011
7 JGI25157J39369_1000034 3300002741 Bacteria 136301
8 JGI25157J39369_1000056 3300002741 Bacteria 107681
9 JGI25157J39369_1000100 3300002741 Bacteria 73363
10 JGI25152J39213_1001084 3300002773 Bacteria 12801
11 JGI25150J39212_1005451 3300002774 Bacteria 2713
12 JGI25159J45721_1000218 3300002987 Bacteria 27082
13 JGI25159J45721_1001247 3300002987 Bacteria 10718
14 JGI25151J46595_10001992 3300003187 Bacteria 12801
15 JGI25151J46595_10002875 3300003187 Bacteria 9891
16 JGI25151J46595_10003862 3300003187 Bacteria 8105
17 JGI25151J46595_10023534 3300003187 Bacteria 2535
18 JGI25153J46596_10001751 3300003215 Bacteria 12877
19 JGI25160J50197_1000296 3300003354 Bacteria 35674
20 JGI25161J50226_1000082 3300003374 Bacteria 78461
21 Ga0006562J51391_1060824 3300003578 Bacteria 2170
22 Ga0006562J51391_1099722 3300003578 Bacteria 2130
23 Ga0055539_1000710 3300003752 Bacteria 8492
24 Ga0055539_1002086 3300003752 Bacteria 3260
25 Ga0055533_1000080 3300003756 Bacteria 131291
26 Ga0055525_1002132 3300003759 Bacteria 2282
27 Ga0055535_1000198 3300003761 Bacteria 63889
28 Ga0055535_1000507 3300003761 Bacteria 34514
29 Ga0055542_1000004 3300003762 Bacteria 553532
30 Ga0055529_1000449 3300003763 Bacteria 40616
31 Ga0055526_1002148 3300003771 Bacteria 13523
32 Ga0055526_1002361 3300003771 Bacteria 12811
33 Ga0055526_1002372 3300003771 Bacteria 12760
34 Ga0055537_1000124 3300003773 Bacteria 58656
35 Ga0055537_1000321 3300003773 Bacteria 32655
36 Ga0055537_1001002 3300003773 Bacteria 12789
37 Ga0055524_1000156 3300003775 Bacteria 79669
38 Ga0055524_1001575 3300003775 Bacteria 12811
39 Ga0055524_1004865 3300003775 Bacteria 6110
40 Ga0055536_1000570 3300003781 Bacteria 25147
41 Ga0055536_1001439 3300003781 Bacteria 14357
42 Ga0055536_1003704 3300003781 Bacteria 8108
43 Ga0055534_1000117 3300003784 Bacteria 58656
44 Ga0055534_1000961 3300003784 Bacteria 12789
45 Ga0055528_1001705 3300003790 Bacteria 12789
46 Ga0055528_1002333 3300003790 Bacteria 10267
47 Ga0055528_1003137 3300003790 Bacteria 8479
48 Ga0055530_10000338 3300003791 Bacteria 42325
49 Ga0055530_10001450 3300003791 Bacteria 17322
50 Ga0055540_1000033 3300003792 Bacteria 172048
51 Ga0055540_1000950 3300003792 Bacteria 18814
52 Ga0055540_1002405 3300003792 Bacteria 9912
53 Ga0055540_1003326 3300003792 Bacteria 7830
54 Ga0055540_1004605 3300003792 Bacteria 6124
55 Ga0055531_10000556 3300003794 Bacteria 32839
56 Ga0055531_10000702 3300003794 Bacteria 28525
57 Ga0055531_10002296 3300003794 Bacteria 12924
58 Ga0055531_10003432 3300003794 Bacteria 10110
59 Ga0055531_10005034 3300003794 Bacteria 7834
60 Ga0055543_1000983 3300004625 Bacteria 12861
61 Ga0065165_1005782 3300005262 Bacteria 6762
62 Ga0065165_1006573 3300005262 Bacteria 6050
63 Ga0065165_1016336 3300005262 Bacteria 2785
64 Ga0065165_1019670 3300005262 Bacteria 2401
65 Ga0070658_10024518 3300005327 Bacteria 4838
66 Ga0070658_10049037 3300005327 Bacteria 3421
67 Ga0070662_100019069 3300005457 Bacteria 4652
68 Ga0068853_100056816 3300005539 Bacteria 3375
69 Ga0070665_100042322 3300005548 Bacteria 4578
70 Ga0068855_100032894 3300005563 Bacteria 6191
71 Ga0068855_100088386 3300005563 Bacteria 3580
72 Ga0068857_100002192 3300005577 Bacteria 15893
73 Ga0068854_100088160 3300005578 Bacteria 2303
74 Ga0068861_100071380 3300005719 Bacteria 2691
75 Ga0068863_100126888 3300005841 Bacteria 2435
76 Ga0075365_10001430 3300006038 Bacteria 10792
77 Ga0075365_10006005 3300006038 Bacteria 6629
78 Ga0075365_10082551 3300006038 Bacteria 2179
79 Ga0075363_100016270 3300006048 Bacteria 3672
80 Ga0075363_100030716 3300006048 Bacteria 2782
81 Ga0075364_10007713 3300006051 Bacteria 6404
82 Ga0075366_10008517 3300006195 Bacteria 5706
83 Ga0075366_10016340 3300006195 Bacteria 4265
84 Ga0075370_10001817 3300006353 Bacteria 9550
85 Ga0075370_10008614 3300006353 Bacteria 5258
86 Ga0075370_10013471 3300006353 Bacteria 4348
87 Ga0105244_10001326 3300009036 Bacteria 20208
88 Ga0105240_10077662 3300009093 Bacteria 4090
89 Ga0105240_10282392 3300009093 Bacteria 1907
90 Ga0105243_10012034 3300009148 Bacteria 6543
91 Ga0105243_10022200 3300009148 Bacteria 4821
92 Ga0105242_10194161 3300009176 Bacteria 1799
93 Ga0105237_10020228 3300009545 Bacteria 6868
94 Ga0105239_10062473 3300010375 Bacteria 4088
95 Ga0105239_10302835 3300010375 Bacteria 1800
96 Ga0105246_10112398 3300011119 Bacteria 2003
97 Ga0157369_10007777 3300013105 Bacteria 12334
98 Ga0157369_10131013 3300013105 Bacteria 2657
99 Ga0182008_10000088 3300014497 Bacteria 70248
100 Ga0182008_10007282 3300014497 Bacteria 6118
101 Ga0182008_10020986 3300014497 Bacteria 3359
102 Ga0182006_1004385 3300015261 Bacteria 6972
103 Ga0182006_1005441 3300015261 Bacteria 6075
104 Ga0182007_10000996 3300015262 Bacteria 15554
105 Ga0183362_10001 3300015683 Bacteria 2046624
106 Ga0163161_10000188 3300017792 Bacteria 56743
107 Ga0163161_10013515 3300017792 Bacteria 5684
108 Ga0213872_10005989 3300021361 Bacteria 6162
109 Ga0209435_100001 3300025206 Bacteria 1424171
110 Ga0209436_103961 3300025208 Bacteria 3758
111 Ga0209674_100003 3300025226 Bacteria 2196646
112 Ga0209672_100531 3300025228 Bacteria 20822
113 Ga0209147_101524 3300025229 Bacteria 8083
114 Ga0209563_100049 3300025230 Bacteria 358472
115 Ga0209258_100022 3300025242 Bacteria 553584
116 Ga0209258_100189 3300025242 Bacteria 128268
117 Ga0209258_100668 3300025242 Bacteria 24363
118 Ga0207425_1000154 3300025245 Bacteria 58601
119 Ga0207425_1001436 3300025245 Bacteria 9971
120 Ga0207425_1006101 3300025245 Bacteria 3337
121 Ga0209646_1000001 3300025246 Bacteria 3092932
122 Ga0209646_1000124 3300025246 Bacteria 138207
123 Ga0209026_1000003 3300025250 Bacteria 1060571
124 Ga0209026_1000085 3300025250 Bacteria 185778
125 Ga0209677_100228 3300025253 Bacteria 39841
126 Ga0209677_100365 3300025253 Bacteria 27793
127 Ga0209148_1000034 3300025254 Bacteria 553584
128 Ga0209148_1003003 3300025254 Bacteria 5048
129 Ga0209759_1000001 3300025256 Bacteria 2799452
130 Ga0209759_1000068 3300025256 Bacteria 183479
131 Ga0209759_1001077 3300025256 Bacteria 17870
132 Ga0209759_1002179 3300025256 Bacteria 8972
133 Ga0209129_1000023 3300025258 Bacteria 420646
134 Ga0209129_1001302 3300025258 Bacteria 14212
135 Ga0209129_1006868 3300025258 Bacteria 3545
136 Ga0209565_1000004 3300025263 Bacteria 983150
137 Ga0209565_1000114 3300025263 Bacteria 116078
138 Ga0209565_1000125 3300025263 Bacteria 110485
139 Ga0209565_1000341 3300025263 Bacteria 41247
140 Ga0209455_1000092 3300025272 Bacteria 220516
141 Ga0209673_1000192 3300025273 Bacteria 123155
142 Ga0209673_1000572 3300025273 Bacteria 58687
143 Ga0209673_1000583 3300025273 Bacteria 57643
144 Ga0209673_1000824 3300025273 Bacteria 40796
145 Ga0209673_1006681 3300025273 Bacteria 5506
146 Ga0209130_1000041 3300025284 Bacteria 261078
147 Ga0209130_1000069 3300025284 Bacteria 179177
148 Ga0209130_1000431 3300025284 Bacteria 44964
149 Ga0209130_1000479 3300025284 Bacteria 41174
150 Ga0209675_1000029 3300025291 Bacteria 281053
151 Ga0209675_1000427 3300025291 Bacteria 34021
152 Ga0209675_1001230 3300025291 Bacteria 15418
153 Ga0209675_1003531 3300025291 Bacteria 7383
154 Ga0209675_1013919 3300025291 Bacteria 2480
155 Ga0209676_1000005 3300025292 Bacteria 1076001
156 Ga0209676_1000029 3300025292 Bacteria 520536
157 Ga0209676_1000285 3300025292 Bacteria 104459
158 Ga0209676_1000418 3300025292 Bacteria 75214
159 Ga0209676_1000614 3300025292 Bacteria 52075
160 Ga0209676_1009562 3300025292 Bacteria 4169
161 Ga0209025_1000316 3300025294 Bacteria 107447
162 Ga0209025_1000435 3300025294 Bacteria 82663
163 Ga0209025_1000652 3300025294 Bacteria 60620
164 Ga0209025_1001996 3300025294 Bacteria 23371
165 Ga0209025_1005216 3300025294 Bacteria 10722
166 Ga0209025_1013742 3300025294 Bacteria 5057
167 Ga0209025_1014708 3300025294 Bacteria 4786
168 Ga0209564_1000270 3300025295 Bacteria 108503
169 Ga0209564_1000789 3300025295 Bacteria 43729
170 Ga0209564_1001048 3300025295 Bacteria 33826
171 Ga0209564_1002285 3300025295 Bacteria 15623
172 Ga0209758_1000064 3300025297 Bacteria 311812
173 Ga0209758_1006858 3300025297 Bacteria 7965
174 Ga0209050_1000003 3300025298 Bacteria 1609245
175 Ga0209050_1000007 3300025298 Bacteria 1187891
176 Ga0209050_1001291 3300025298 Bacteria 28402
177 Ga0209050_1008926 3300025298 Bacteria 5235
178 Ga0209256_1000001 3300025299 Bacteria 2166974
179 Ga0209256_1000020 3300025299 Bacteria 542402
180 Ga0209256_1000022 3300025299 Bacteria 481843
181 Ga0207426_1000001 3300025302 Bacteria 1341301
182 Ga0207426_1000031 3300025302 Bacteria 460699
183 Ga0207426_1000061 3300025302 Bacteria 362507
184 Ga0209051_1000003 3300025303 Bacteria 1609245
185 Ga0209051_1000009 3300025303 Bacteria 706778
186 Ga0209051_1000327 3300025303 Bacteria 71493
187 Ga0209051_1000363 3300025303 Bacteria 66432
188 Ga0209051_1004144 3300025303 Bacteria 9064
189 Ga0209257_1000011 3300025304 Bacteria 1112630
190 Ga0209257_1000012 3300025304 Bacteria 1111138
191 Ga0209257_1000018 3300025304 Bacteria 836016
192 Ga0209257_1000045 3300025304 Bacteria 484429
193 Ga0209257_1000502 3300025304 Bacteria 69204
194 Ga0209257_1003803 3300025304 Bacteria 12417
195 Ga0209257_1008800 3300025304 Bacteria 5599
196 Ga0207705_10069629 3300025909 Bacteria 2549
197 Ga0207695_10043409 3300025913 Bacteria 4792
198 Ga0207650_10073178 3300025925 Bacteria 2581
199 Ga0207700_10068986 3300025928 Bacteria 2712
200 Ga0207706_10014657 3300025933 Bacteria 7099
201 Ga0207709_10000529 3300025935 Bacteria 33218
202 Ga0207709_10000794 3300025935 Bacteria 24616
203 Ga0207691_10055621 3300025940 Bacteria 3605
204 Ga0207667_10003340 3300025949 Bacteria 19799
205 Ga0207667_10144082 3300025949 Bacteria 2453
206 Ga0207651_10030389 3300025960 Bacteria 3439
207 Ga0207640_10018467 3300025981 Bacteria 4099
208 Ga0207639_10022086 3300026041 Bacteria 4580
209 Ga0207702_10039838 3300026078 Bacteria 3939
210 Ga0207674_10054256 3300026116 Bacteria 4081
211 Ga0207675_100151558 3300026118 Bacteria 2207
212 Ga0209970_1000261 3300027614 Bacteria 8663
213 Ga0209282_1002851 3300027666 Bacteria 10135
214 Ga0209282_1037315 3300027666 Bacteria 2923
215 Ga0207428_10022652 3300027907 Bacteria 5298
216 Ga0268266_10009257 3300028379 Bacteria 8689
217 Ga0265336_10000006 3300028666 Bacteria 348453
218 Ga0307517_10000805 3300028786 Bacteria 53822
219 Ga0307515_10000028 3300028794 Bacteria 368467
220 Ga0307515_10000702 3300028794 Bacteria 77364
221 Ga0316178_1149122 3300030735 Bacteria 2862
222 Ga0265330_10000247 3300031235 Bacteria 40775
223 Ga0265332_10000002 3300031238 Bacteria 709510
224 Ga0265340_10004829 3300031247 Bacteria 7499
225 Ga0265327_10016966 3300031251 Bacteria 4593
226 Ga0307513_10000012 3300031456 Bacteria 328865
227 Ga0307513_10000514 3300031456 Bacteria 55608
228 Ga0307513_10022422 3300031456 Bacteria 7425
229 Ga0307509_10002654 3300031507 Bacteria 28588
230 Ga0307509_10006788 3300031507 Bacteria 15234
231 Ga0307509_10084250 3300031507 Bacteria 3275
232 Ga0307408_100018642 3300031548 Bacteria 4662
233 Ga0307408_100035800 3300031548 Bacteria 3485
234 Ga0307408_100081801 3300031548 Bacteria 2415
235 Ga0307408_100089859 3300031548 Bacteria 2316
236 Ga0307508_10000078 3300031616 Bacteria 113416
237 Ga0307508_10003819 3300031616 Bacteria 15025
238 Ga0307508_10061494 3300031616 Bacteria 3318
239 Ga0307508_10093005 3300031616 Bacteria 2605
240 Ga0307514_10000983 3300031649 Bacteria 42321
241 Ga0307514_10062248 3300031649 Bacteria 2839
242 Ga0307514_10099375 3300031649 Bacteria 2094
243 Ga0265314_10000012 3300031711 Bacteria 415184
244 Ga0307516_10001786 3300031730 Bacteria 29553
245 Ga0307405_10031429 3300031731 Bacteria 3126
246 Ga0307414_10083918 3300032004 Bacteria 2341
247 Ga0307510_10030353 3300033180 Bacteria 6128
248 Ga0373934_0033619 3300035086 Bacteria 2013
249 Ga0373932_0006308 3300035112 Bacteria 2803
250 Ga0373931_0016147 3300035691 Bacteria 3671
251 Ga0395899_0033598 3300037312 Bacteria 3851
252 Ga0395900_0146351 3300037418 Bacteria 2415
253 Ga0395898_0009633 3300037466 Bacteria 10141
254 Ga0395898_0075769 3300037466 Bacteria 3249
255 Ga0395901_0015996 3300038443 Bacteria 7644
256 Ga0395901_0107983 3300038443 Bacteria 2921
257 Ga0395901_0140605 3300038443 Bacteria 2537
258 Ga0436361_0624839 3300039447 Bacteria 27823
259 Ga0439465_0003195 3300041413 Bacteria 5342
260 Ga0439445_0002011 3300042004 Bacteria 4489
261 Ga0439449_0000488 3300042007 Bacteria 14867
262 Ga0439449_0017923 3300042007 Bacteria 2657
263 Ga0439449_0041298 3300042007 Bacteria 1714
264 Ga0439452_002047 3300042010 Bacteria 7666
265 Ga0450911_000241 3300042115 Bacteria 20702
266 Ga0450920_003011 3300042122 Bacteria 2904
267 Ga0450918_001332 3300042531 Bacteria 4961
268 Ga0450918_006411 3300042531 Bacteria 2100
269 Ga0450893_0001676 3300042532 Bacteria 3408
270 Ga0451577_0000257 3300042876 Bacteria 104746
271 Ga0453683_0004287 3300044673 Bacteria 10174
272 Ga0466965_0035973 3300044683 Bacteria 2428
273 Ga0466965_0064771 3300044683 Bacteria 1830
274 Ga0466961_0084305 3300044693 Bacteria 2010
275 Ga0453684_0001024 3300044712 Bacteria 89721
276 Ga0466970_0008328 3300044765 Bacteria 5216
277 Ga0466970_0095060 3300044765 Bacteria 1620
278 Ga0451576_0000798 3300045051 Bacteria 61660
279 Ga0451576_0018903 3300045051 Bacteria 7532
280 Ga0451576_0117894 3300045051 Bacteria 2764
281 Ga0495627_006515 3300046453 Bacteria 4572
282 Ga0495650_0026277 3300046471 Bacteria 2711
283 Ga0495583_0001495 3300046506 Bacteria 23341
284 Ga0495606_0005658 3300046507 Bacteria 11845
285 Ga0495631_0001641 3300046518 Bacteria 13312
286 Ga0495637_0007080 3300046520 Bacteria 5585
287 Ga0495643_0021994 3300046522 Bacteria 3647
288 Ga0495656_0000088 3300046615 Bacteria 40432
289 Ga0495625_0001807 3300046660 Bacteria 24546
290 Ga0495625_0056113 3300046660 Bacteria 2805
291 Ga0495670_0060103 3300046691 Bacteria 1909
292 Ga0495671_0015826 3300046692 Bacteria 4037
293 Ga0495649_0003033 3300046694 Bacteria 11525
294 Ga0495589_0022780 3300046794 Bacteria 3194
295 Ga0495660_0055075 3300046810 Bacteria 2154
296 Ga0495686_0008817 3300047472 Bacteria 7344
297 Ga0495614_0019390 3300048089 Bacteria 2942
298 Ga0496116_0025126 3300048919 Bacteria 4387
299 Ga0496117_0060456 3300048920 Bacteria 2610
300 Ga0496118_0012621 3300048921 Bacteria 8084
301 Ga0496118_0027154 3300048921 Bacteria 4852
302 Ga0496121_0001731 3300048924 Bacteria 35624
303 Ga0496121_0122883 3300048924 Bacteria 1957
304 Ga0496122_0003061 3300048925 Bacteria 22565
305 Ga0496123_0000600 3300048926 Bacteria 61187
306 Ga0496123_0046882 3300048926 Bacteria 2926
307 Ga0496124_0106203 3300048927 Bacteria 2267
308 Ga0496125_0008502 3300048928 Bacteria 10735
309 Ga0496125_0012193 3300048928 Bacteria 8553
310 Ga0496125_0021265 3300048928 Bacteria 6059
311 Ga0496125_0082059 3300048928 Bacteria 2459
312 Ga0501262_001345 3300049759 Bacteria 2750
313 nmdc:mga03683_1517_c1 3300050489 Bacteria 6918
314 nmdc:mga03n38_39363_c1 3300050490 Bacteria 2050
315 nmdc:mga00v17_8727_c1 3300050491 Bacteria 5458
316 nmdc:mga0yw44_35748_c1 3300050492 Bacteria 2922
317 nmdc:mga0yw44_75776_c1 3300050492 Bacteria 2098
318 nmdc:mga0k408_18673_c1 3300050493 Bacteria 3873
319 nmdc:mga07m45_18721_c1 3300050496 Bacteria 3745
320 nmdc:mga07m45_37770_c1 3300050496 Bacteria 2694
321 nmdc:mga07m45_4964_c1 3300050496 Bacteria 6564
322 nmdc:mga07m45_7661_c1 3300050496 Bacteria 5523
323 Ga0500610_0005653 3300053079 Bacteria 5155
324 Ga0500610_0008605 3300053079 Bacteria 4458
325 Ga0500635_0000105 3300053080 Bacteria 50250
326 Ga0500643_028220 3300053087 Bacteria 1738
327 Ga0500651_0000259 3300053093 Bacteria 31610
328 Ga0500650_0081655 3300053098 Bacteria 1512
329 Ga0500571_000563 3300053110 Bacteria 15366
330 Ga0500593_001670 3300053117 Bacteria 7999
331 Ga0500594_0006263 3300053118 Bacteria 2670
332 Ga0500608_023883 3300053122 Bacteria 2849
333 Ga0500658_0000792 3300053134 Bacteria 13101
334 Ga0500658_0000795 3300053134 Bacteria 13078
335 Ga0500559_0006015 3300053136 Bacteria 5509
336 Ga0500636_0051668 3300053177 Bacteria 2416
337 Ga0500645_000228 3300053730 Bacteria 42875
338 Ga0500645_000878 3300053730 Bacteria 17506
339 Ga0500645_003176 3300053730 Bacteria 6830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053098 Ga0500650_0081655 Ga0500650_0081655_56_1387 437
2 3300005563 Ga0068855_100088386 Ga0068855_1000883861 452
3 3300010375 Ga0105239_10302835 Ga0105239_103028351 452
4 3300044683 Ga0466965_0064771 Ga0466965_0064771_30_1523 452
5 3300044693 Ga0466961_0084305 Ga0466961_0084305_233_1726 452
6 3300044765 Ga0466970_0008328 Ga0466970_0008328_2738_4231 452
7 3300053087 Ga0500643_028220 Ga0500643_028220_208_1686 452
8 3300044765 Ga0466970_0095060 Ga0466970_0095060_58_1575 454
9 3300031730 Ga0307516_10001786 Ga0307516_100017867 456
10 3300009148 Ga0105243_10022200 Ga0105243_100222002 457
11 3300025935 Ga0207709_10000529 Ga0207709_1000052914 457
12 3300025928 Ga0207700_10068986 Ga0207700_100689863 465
13 3300042010 Ga0439452_002047 Ga0439452_002047_1990_3420 466
14 3300046471 Ga0495650_0026277 Ga0495650_0026277_1042_2532 468
15 3300028786 Ga0307517_10000805 Ga0307517_1000080524 469
16 iso_pu_bacteria 2513020051 2513231016 469
17 iso_pu_bacteria 2599185214 2599624460 469
18 iso_pu_bacteria 2599185226 2599672678 469
19 iso_pu_bacteria 2599185227 2599683678 469
20 iso_pu_bacteria 2599185229 2599694287 469
21 iso_pu_bacteria 2643221628 2644159482 469
22 iso_pu_bacteria 2643221658 2644328030 469
23 iso_pu_bacteria 2643221672 2644398663 469
24 iso_pu_bacteria 2643221683 2644468540 469
25 iso_pu_bacteria 2738541277 2738720239 469
26 iso_pu_bacteria 2738543019 2739279438 469
27 iso_pu_bacteria 2818991446 2819595874 469
28 iso_pu_bacteria 2838054893 2838057036 469
29 iso_pu_bacteria 2885192300 2885192814 469
30 iso_pu_bacteria 2928084124 2928084917 469
31 iso_pu_bacteria 2945984333 2945985305 469
32 3300005841 Ga0068863_100126888 Ga0068863_1001268882 470
33 3300031456 Ga0307513_10022422 Ga0307513_100224228 470
34 3300031649 Ga0307514_10062248 Ga0307514_100622482 470
35 3300035112 Ga0373932_0006308 Ga0373932_0006308_903_2351 470
36 3300031507 Ga0307509_10002654 Ga0307509_1000265412 471
37 3300031507 Ga0307509_10006788 Ga0307509_100067889 471
38 3300031507 Ga0307509_10084250 Ga0307509_100842502 471
39 3300031616 Ga0307508_10000078 Ga0307508_1000007810 471
40 3300031616 Ga0307508_10003819 Ga0307508_100038196 471
41 3300031616 Ga0307508_10061494 Ga0307508_100614942 471
42 3300031616 Ga0307508_10093005 Ga0307508_100930052 471
43 3300033180 Ga0307510_10030353 Ga0307510_100303535 471
44 3300045051 Ga0451576_0117894 Ga0451576_0117894_34_1452 472
45 3300002705 JGI25156J39149_1000260 JGI25156J39149_100026016 473
46 3300002738 JGI25154J39366_1001047 JGI25154J39366_100104711 473
47 3300002741 JGI25157J39369_1000056 JGI25157J39369_100005682 473
48 3300002741 JGI25157J39369_1000100 JGI25157J39369_100010044 473
49 3300002987 JGI25159J45721_1000218 JGI25159J45721_100021814 473
50 3300003187 JGI25151J46595_10002875 JGI25151J46595_100028755 473
51 3300003354 JGI25160J50197_1000296 JGI25160J50197_100029623 473
52 3300003374 JGI25161J50226_1000082 JGI25161J50226_10000828 473
53 3300003752 Ga0055539_1000710 Ga0055539_10007105 473
54 3300003752 Ga0055539_1002086 Ga0055539_10020862 473
55 3300003756 Ga0055533_1000080 Ga0055533_100008080 473
56 3300003759 Ga0055525_1002132 Ga0055525_10021323 473
57 3300003761 Ga0055535_1000198 Ga0055535_100019826 473
58 3300003763 Ga0055529_1000449 Ga0055529_100044925 473
59 3300003773 Ga0055537_1000124 Ga0055537_100012422 473
60 3300003781 Ga0055536_1003704 Ga0055536_10037047 473
61 3300003784 Ga0055534_1000117 Ga0055534_100011739 473
62 3300003790 Ga0055528_1002333 Ga0055528_100233312 473
63 3300003792 Ga0055540_1000950 Ga0055540_10009502 473
64 3300003792 Ga0055540_1003326 Ga0055540_10033266 473
65 3300003794 Ga0055531_10000702 Ga0055531_100007026 473
66 3300003794 Ga0055531_10005034 Ga0055531_100050346 473
67 3300005327 Ga0070658_10024518 Ga0070658_100245183 473
68 3300005327 Ga0070658_10049037 Ga0070658_100490374 473
69 3300005457 Ga0070662_100019069 Ga0070662_1000190693 473
70 3300005548 Ga0070665_100042322 Ga0070665_1000423223 473
71 3300005563 Ga0068855_100032894 Ga0068855_1000328945 473
72 3300005577 Ga0068857_100002192 Ga0068857_10000219211 473
73 3300005578 Ga0068854_100088160 Ga0068854_1000881603 473
74 3300005719 Ga0068861_100071380 Ga0068861_1000713802 473
75 3300006195 Ga0075366_10008517 Ga0075366_100085175 473
76 3300006353 Ga0075370_10001817 Ga0075370_100018173 473
77 3300006353 Ga0075370_10008614 Ga0075370_100086142 473
78 3300009093 Ga0105240_10077662 Ga0105240_100776622 473
79 3300009093 Ga0105240_10282392 Ga0105240_102823921 473
80 3300009176 Ga0105242_10194161 Ga0105242_101941612 473
81 3300009545 Ga0105237_10020228 Ga0105237_100202283 473
82 3300010375 Ga0105239_10062473 Ga0105239_100624734 473
83 3300011119 Ga0105246_10112398 Ga0105246_101123982 473
84 3300013105 Ga0157369_10007777 Ga0157369_100077773 473
85 3300013105 Ga0157369_10131013 Ga0157369_101310133 473
86 3300014497 Ga0182008_10020986 Ga0182008_100209864 473
87 3300017792 Ga0163161_10000188 Ga0163161_1000018847 473
88 3300017792 Ga0163161_10013515 Ga0163161_100135154 473
89 3300025226 Ga0209674_100003 Ga0209674_1000031815 473
90 3300025230 Ga0209563_100049 Ga0209563_100049277 473
91 3300025242 Ga0209258_100189 Ga0209258_10018999 473
92 3300025242 Ga0209258_100668 Ga0209258_10066813 473
93 3300025246 Ga0209646_1000124 Ga0209646_100012427 473
94 3300025250 Ga0209026_1000085 Ga0209026_100008527 473
95 3300025253 Ga0209677_100228 Ga0209677_10022824 473
96 3300025253 Ga0209677_100365 Ga0209677_10036515 473
97 3300025254 Ga0209148_1003003 Ga0209148_10030033 473
98 3300025256 Ga0209759_1000068 Ga0209759_100006825 473
99 3300025256 Ga0209759_1001077 Ga0209759_100107717 473
100 3300025256 Ga0209759_1002179 Ga0209759_10021798 473
101 3300025258 Ga0209129_1006868 Ga0209129_10068684 473
102 3300025263 Ga0209565_1000114 Ga0209565_100011483 473
103 3300025272 Ga0209455_1000092 Ga0209455_100009297 473
104 3300025273 Ga0209673_1000572 Ga0209673_100057238 473
105 3300025291 Ga0209675_1000029 Ga0209675_1000029248 473
106 3300025291 Ga0209675_1003531 Ga0209675_10035315 473
107 3300025292 Ga0209676_1000418 Ga0209676_100041864 473
108 3300025292 Ga0209676_1000614 Ga0209676_10006144 473
109 3300025294 Ga0209025_1000435 Ga0209025_10004355 473
110 3300025294 Ga0209025_1014708 Ga0209025_10147082 473
111 3300025298 Ga0209050_1001291 Ga0209050_10012914 473
112 3300025303 Ga0209051_1000327 Ga0209051_100032727 473
113 3300025303 Ga0209051_1004144 Ga0209051_10041444 473
114 3300025304 Ga0209257_1000012 Ga0209257_10000121000 473
115 3300025304 Ga0209257_1000045 Ga0209257_1000045406 473
116 3300025304 Ga0209257_1000502 Ga0209257_100050263 473
117 3300025304 Ga0209257_1008800 Ga0209257_10088004 473
118 3300025909 Ga0207705_10069629 Ga0207705_100696292 473
119 3300025913 Ga0207695_10043409 Ga0207695_100434095 473
120 3300025933 Ga0207706_10014657 Ga0207706_100146577 473
121 3300025935 Ga0207709_10000794 Ga0207709_1000079421 473
122 3300025949 Ga0207667_10003340 Ga0207667_100033404 473
123 3300025949 Ga0207667_10144082 Ga0207667_101440823 473
124 3300025960 Ga0207651_10030389 Ga0207651_100303892 473
125 3300025981 Ga0207640_10018467 Ga0207640_100184671 473
126 3300026116 Ga0207674_10054256 Ga0207674_100542562 473
127 3300026118 Ga0207675_100151558 Ga0207675_1001515583 473
128 3300027666 Ga0209282_1002851 Ga0209282_10028516 473
129 3300027666 Ga0209282_1037315 Ga0209282_10373152 473
130 3300028379 Ga0268266_10009257 Ga0268266_100092573 473
131 3300028666 Ga0265336_10000006 Ga0265336_10000006278 473
132 3300031456 Ga0307513_10000012 Ga0307513_10000012264 473
133 3300031548 Ga0307408_100035800 Ga0307408_1000358002 473
134 3300035086 Ga0373934_0033619 Ga0373934_0033619_279_1769 473
135 3300035691 Ga0373931_0016147 Ga0373931_0016147_1264_2751 473
136 3300037466 Ga0395898_0075769 Ga0395898_0075769_601_2091 473
137 3300038443 Ga0395901_0015996 Ga0395901_0015996_4263_5753 473
138 3300041413 Ga0439465_0003195 Ga0439465_0003195_3646_5076 473
139 3300042004 Ga0439445_0002011 Ga0439445_0002011_1951_3381 473
140 3300042007 Ga0439449_0041298 Ga0439449_0041298_45_1475 473
141 3300042122 Ga0450920_003011 Ga0450920_003011_172_1593 473
142 3300042531 Ga0450918_001332 Ga0450918_001332_2619_4040 473
143 3300042876 Ga0451577_0000257 Ga0451577_0000257_52636_54117 473
144 3300044673 Ga0453683_0004287 Ga0453683_0004287_5700_7151 473
145 3300044712 Ga0453684_0001024 Ga0453684_0001024_50610_52091 473
146 3300045051 Ga0451576_0000798 Ga0451576_0000798_36083_37564 473
147 3300045051 Ga0451576_0018903 Ga0451576_0018903_3322_4773 473
148 3300046453 Ga0495627_006515 Ga0495627_006515_1723_3144 473
149 3300046506 Ga0495583_0001495 Ga0495583_0001495_4407_5897 473
150 3300046507 Ga0495606_0005658 Ga0495606_0005658_6315_7805 473
151 3300046520 Ga0495637_0007080 Ga0495637_0007080_1250_2671 473
152 3300046522 Ga0495643_0021994 Ga0495643_0021994_1599_3071 473
153 3300046660 Ga0495625_0001807 Ga0495625_0001807_20378_21799 473
154 3300046692 Ga0495671_0015826 Ga0495671_0015826_2186_3607 473
155 3300046694 Ga0495649_0003033 Ga0495649_0003033_5210_6700 473
156 3300046794 Ga0495589_0022780 Ga0495589_0022780_1574_3064 473
157 3300046810 Ga0495660_0055075 Ga0495660_0055075_376_1881 473
158 3300047472 Ga0495686_0008817 Ga0495686_0008817_1432_2922 473
159 3300048920 Ga0496117_0060456 Ga0496117_0060456_789_2210 473
160 3300048924 Ga0496121_0122883 Ga0496121_0122883_144_1565 473
161 3300048927 Ga0496124_0106203 Ga0496124_0106203_821_2251 473
162 3300048928 Ga0496125_0012193 Ga0496125_0012193_4878_6299 473
163 3300049759 Ga0501262_001345 Ga0501262_001345_96_1517 473
164 3300050490 nmdc:mga03n38_39363_c1 nmdc:mga03n38_39363_c1_489_1910 473
165 3300050493 nmdc:mga0k408_18673_c1 nmdc:mga0k408_18673_c1_1625_3046 473
166 3300050496 nmdc:mga07m45_18721_c1 nmdc:mga07m45_18721_c1_604_2025 473
167 3300050496 nmdc:mga07m45_4964_c1 nmdc:mga07m45_4964_c1_3926_5416 473
168 3300053079 Ga0500610_0005653 Ga0500610_0005653_1010_2431 473
169 3300053079 Ga0500610_0008605 Ga0500610_0008605_2725_4146 473
170 3300053080 Ga0500635_0000105 Ga0500635_0000105_30463_31953 473
171 3300053177 Ga0500636_0051668 Ga0500636_0051668_607_2097 473
172 iso_pu_bacteria 2842718218 2842720229 474
173 iso_pu_bacteria 2881101125 2881102719 474
174 iso_pu_bacteria 2919704043 2919704669 474
175 3300006038 Ga0075365_10006005 Ga0075365_100060052 475
176 3300050492 nmdc:mga0yw44_75776_c1 nmdc:mga0yw44_75776_c1_587_2026 475
177 iso_pu_bacteria 2511231002 2511246043 475
178 iso_pu_bacteria 2842677519 2842678840 475
179 iso_pu_bacteria 2842747753 2842751426 475
180 iso_pu_bacteria 2904449895 2904454545 475
181 iso_pu_bacteria 2904456579 2904461012 475
182 iso_pu_bacteria 2919462493 2919465891 475
183 iso_pu_bacteria 2929520902 2929526896 475
184 iso_pu_bacteria 2945945610 2945948303 475
185 iso_pu_bacteria 2945972063 2945977054 475
186 iso_pu_bacteria 2954767861 2954772429 475
187 iso_pu_bacteria 2842733646 2842735479 477
188 3300027614 Ga0209970_1000261 Ga0209970_10002614 478
189 3300042007 Ga0439449_0000488 Ga0439449_0000488_4936_6393 478
190 3300050491 nmdc:mga00v17_8727_c1 nmdc:mga00v17_8727_c1_2915_4432 478
191 3300002704 JGI25155J39150_1000152 JGI25155J39150_10001528 479
192 3300002705 JGI25156J39149_1000025 JGI25156J39149_10000258 479
193 3300002738 JGI25154J39366_1000045 JGI25154J39366_10000458 479
194 3300002741 JGI25157J39369_1000034 JGI25157J39369_10000348 479
195 3300002987 JGI25159J45721_1001247 JGI25159J45721_10012473 479
196 3300003187 JGI25151J46595_10023534 JGI25151J46595_100235341 479
197 3300003578 Ga0006562J51391_1060824 Ga0006562J51391_10608241 479
198 3300003771 Ga0055526_1002148 Ga0055526_100214810 479
199 3300003773 Ga0055537_1000321 Ga0055537_10003216 479
200 3300003775 Ga0055524_1000156 Ga0055524_10001566 479
201 3300003781 Ga0055536_1000570 Ga0055536_10005709 479
202 3300003790 Ga0055528_1003137 Ga0055528_10031376 479
203 3300003791 Ga0055530_10000338 Ga0055530_100003388 479
204 3300003792 Ga0055540_1000033 Ga0055540_100003375 479
205 3300003792 Ga0055540_1004605 Ga0055540_10046055 479
206 3300003794 Ga0055531_10000556 Ga0055531_1000055612 479
207 3300005262 Ga0065165_1005782 Ga0065165_10057825 479
208 3300005262 Ga0065165_1016336 Ga0065165_10163362 479
209 3300005262 Ga0065165_1019670 Ga0065165_10196702 479
210 3300006038 Ga0075365_10001430 Ga0075365_100014302 479
211 3300006048 Ga0075363_100030716 Ga0075363_1000307162 479
212 3300006051 Ga0075364_10007713 Ga0075364_100077137 479
213 3300025206 Ga0209435_100001 Ga0209435_100001973 479
214 3300025245 Ga0207425_1001436 Ga0207425_10014366 479
215 3300025246 Ga0209646_1000001 Ga0209646_10000011342 479
216 3300025250 Ga0209026_1000003 Ga0209026_1000003973 479
217 3300025256 Ga0209759_1000001 Ga0209759_1000001973 479
218 3300025263 Ga0209565_1000004 Ga0209565_1000004894 479
219 3300025263 Ga0209565_1000341 Ga0209565_100034111 479
220 3300025273 Ga0209673_1000824 Ga0209673_10008246 479
221 3300025284 Ga0209130_1000041 Ga0209130_10000418 479
222 3300025284 Ga0209130_1000431 Ga0209130_100043114 479
223 3300025291 Ga0209675_1001230 Ga0209675_10012307 479
224 3300025291 Ga0209675_1013919 Ga0209675_10139192 479
225 3300025292 Ga0209676_1000029 Ga0209676_100002910 479
226 3300025294 Ga0209025_1001996 Ga0209025_10019968 479
227 3300025294 Ga0209025_1005216 Ga0209025_10052166 479
228 3300025295 Ga0209564_1000789 Ga0209564_100078915 479
229 3300025295 Ga0209564_1001048 Ga0209564_10010487 479
230 3300025297 Ga0209758_1006858 Ga0209758_10068582 479
231 3300025298 Ga0209050_1000003 Ga0209050_100000372 479
232 3300025298 Ga0209050_1008926 Ga0209050_10089264 479
233 3300025299 Ga0209256_1000001 Ga0209256_100000174 479
234 3300025302 Ga0207426_1000061 Ga0207426_1000061233 479
235 3300025303 Ga0209051_1000003 Ga0209051_100000372 479
236 3300025303 Ga0209051_1000363 Ga0209051_100036323 479
237 3300025304 Ga0209257_1000018 Ga0209257_100001872 479
238 3300028794 Ga0307515_10000702 Ga0307515_1000070238 479
239 3300030735 Ga0316178_1149122 Ga0316178_11491222 479
240 3300031456 Ga0307513_10000514 Ga0307513_1000051432 479
241 3300031548 Ga0307408_100081801 Ga0307408_1000818012 479
242 3300031548 Ga0307408_100089859 Ga0307408_1000898592 479
243 3300031649 Ga0307514_10000983 Ga0307514_1000098330 479
244 3300031649 Ga0307514_10099375 Ga0307514_100993752 479
245 3300031731 Ga0307405_10031429 Ga0307405_100314292 479
246 3300032004 Ga0307414_10083918 Ga0307414_100839182 479
247 3300053117 Ga0500593_001670 Ga0500593_001670_2317_3771 479
248 3300053730 Ga0500645_000228 Ga0500645_000228_35823_37292 479
249 3300053730 Ga0500645_000878 Ga0500645_000878_13920_15389 479
250 3300053730 Ga0500645_003176 Ga0500645_003176_1995_3449 479
251 3300025925 Ga0207650_10073178 Ga0207650_100731782 480
252 3300027907 Ga0207428_10022652 Ga0207428_100226526 481
253 3300048928 Ga0496125_0021265 Ga0496125_0021265_2199_3734 481
254 3300021361 Ga0213872_10005989 Ga0213872_100059893 482
255 3300039447 Ga0436361_0624839 Ga0436361_0624839_21528_23012 482
256 3300050496 nmdc:mga07m45_37770_c1 nmdc:mga07m45_37770_c1_114_1571 482
257 iso_pu_bacteria 2738541307 2738881779 482
258 iso_pu_bacteria 2831265667 2831266977 482
259 iso_pu_bacteria 2885198086 2885198965 482
260 iso_pu_bacteria 2885211737 2885212772 482
261 iso_pu_bacteria 2899924645 2899925222 482
262 iso_pu_bacteria 2928037797 2928038655 482
263 iso_pu_bacteria 2928044640 2928045740 482
264 iso_pu_bacteria 2928051484 2928053357 482
265 iso_pu_bacteria 2928064002 2928066962 482
266 iso_pu_bacteria 2928070936 2928071140 482
267 iso_pu_bacteria 2945909444 2945912380 482
268 3300006038 Ga0075365_10082551 Ga0075365_100825512 483
269 3300050492 nmdc:mga0yw44_35748_c1 nmdc:mga0yw44_35748_c1_216_1667 483
270 3300042115 Ga0450911_000241 Ga0450911_000241_8637_10121 484
271 3300048924 Ga0496121_0001731 Ga0496121_0001731_8085_9566 484
272 3300048928 Ga0496125_0008502 Ga0496125_0008502_825_2306 484
273 3300048928 Ga0496125_0082059 Ga0496125_0082059_336_1820 484
274 3300006048 Ga0075363_100016270 Ga0075363_1000162702 486
275 3300006195 Ga0075366_10016340 Ga0075366_100163404 486
276 3300015683 Ga0183362_10001 Ga0183362_100011454 486
277 3300025273 Ga0209673_1006681 Ga0209673_10066815 486
278 3300025940 Ga0207691_10055621 Ga0207691_100556213 486
279 3300028794 Ga0307515_10000028 Ga0307515_10000028334 486
280 3300031548 Ga0307408_100018642 Ga0307408_1000186422 486
281 3300042007 Ga0439449_0017923 Ga0439449_0017923_528_1997 486
282 3300042531 Ga0450918_006411 Ga0450918_006411_369_1838 486
283 3300042532 Ga0450893_0001676 Ga0450893_0001676_341_1810 486
284 3300044683 Ga0466965_0035973 Ga0466965_0035973_547_2016 486
285 3300046615 Ga0495656_0000088 Ga0495656_0000088_31143_32612 486
286 3300046691 Ga0495670_0060103 Ga0495670_0060103_108_1577 486
287 3300050489 nmdc:mga03683_1517_c1 nmdc:mga03683_1517_c1_5167_6636 486
288 3300031235 Ga0265330_10000247 Ga0265330_1000024717 487
289 3300031238 Ga0265332_10000002 Ga0265332_1000000246 487
290 3300031247 Ga0265340_10004829 Ga0265340_100048294 487
291 3300031251 Ga0265327_10016966 Ga0265327_100169664 487
292 3300031711 Ga0265314_10000012 Ga0265314_10000012339 487
293 3300048925 Ga0496122_0003061 Ga0496122_0003061_8658_10169 487
294 3300048926 Ga0496123_0000600 Ga0496123_0000600_47257_48768 487
295 iso_pu_bacteria 2904541872 2904544619 487
296 iso_pu_bacteria 2929160207 2929163709 487
297 3300014497 Ga0182008_10000088 Ga0182008_1000008833 488
298 3300053122 Ga0500608_023883 Ga0500608_023883_704_2221 488
299 3300053136 Ga0500559_0006015 Ga0500559_0006015_266_1840 488
300 3300038443 Ga0395901_0140605 Ga0395901_0140605_277_1746 489
301 3300037312 Ga0395899_0033598 Ga0395899_0033598_700_2172 490
302 3300037418 Ga0395900_0146351 Ga0395900_0146351_631_2103 490
303 3300037466 Ga0395898_0009633 Ga0395898_0009633_5715_7187 490
304 3300038443 Ga0395901_0107983 Ga0395901_0107983_565_2037 490
305 3300003761 Ga0055535_1000507 Ga0055535_10005076 494
306 3300003762 Ga0055542_1000004 Ga0055542_100000481 494
307 3300006353 Ga0075370_10013471 Ga0075370_100134714 494
308 3300009036 Ga0105244_10001326 Ga0105244_100013264 494
309 3300009148 Ga0105243_10012034 Ga0105243_100120344 494
310 3300014497 Ga0182008_10007282 Ga0182008_100072824 494
311 3300015261 Ga0182006_1004385 Ga0182006_10043855 494
312 3300015262 Ga0182007_10000996 Ga0182007_100009964 494
313 3300025228 Ga0209672_100531 Ga0209672_1005313 494
314 3300025229 Ga0209147_101524 Ga0209147_1015242 494
315 3300025242 Ga0209258_100022 Ga0209258_10002281 494
316 3300025254 Ga0209148_1000034 Ga0209148_100003481 494
317 3300026078 Ga0207702_10039838 Ga0207702_100398383 494
318 3300048919 Ga0496116_0025126 Ga0496116_0025126_2637_4121 494
319 3300048921 Ga0496118_0012621 Ga0496118_0012621_258_1742 494
320 3300050496 nmdc:mga07m45_7661_c1 nmdc:mga07m45_7661_c1_1554_3038 494
321 3300005539 Ga0068853_100056816 Ga0068853_1000568162 496
322 3300026041 Ga0207639_10022086 Ga0207639_100220863 496
323 3300048089 Ga0495614_0019390 Ga0495614_0019390_249_1775 499
324 3300053093 Ga0500651_0000259 Ga0500651_0000259_29183_30709 499
325 3300053110 Ga0500571_000563 Ga0500571_000563_11396_12922 499
326 3300053134 Ga0500658_0000795 Ga0500658_0000795_2134_3660 499
327 3300002773 JGI25152J39213_1001084 JGI25152J39213_10010844 502
328 3300002774 JGI25150J39212_1005451 JGI25150J39212_10054512 502
329 3300003187 JGI25151J46595_10001992 JGI25151J46595_100019924 502
330 3300003187 JGI25151J46595_10003862 JGI25151J46595_100038624 502
331 3300003215 JGI25153J46596_10001751 JGI25153J46596_100017519 502
332 3300003578 Ga0006562J51391_1099722 Ga0006562J51391_10997222 502
333 3300003771 Ga0055526_1002361 Ga0055526_10023614 502
334 3300003771 Ga0055526_1002372 Ga0055526_10023724 502
335 3300003773 Ga0055537_1001002 Ga0055537_10010024 502
336 3300003775 Ga0055524_1001575 Ga0055524_10015754 502
337 3300003775 Ga0055524_1004865 Ga0055524_10048654 502
338 3300003781 Ga0055536_1001439 Ga0055536_100143912 502
339 3300003784 Ga0055534_1000961 Ga0055534_10009619 502
340 3300003790 Ga0055528_1001705 Ga0055528_10017054 502
341 3300003791 Ga0055530_10001450 Ga0055530_100014504 502
342 3300003792 Ga0055540_1002405 Ga0055540_10024054 502
343 3300003794 Ga0055531_10002296 Ga0055531_100022964 502
344 3300003794 Ga0055531_10003432 Ga0055531_100034324 502
345 3300004625 Ga0055543_1000983 Ga0055543_10009839 502
346 3300005262 Ga0065165_1006573 Ga0065165_10065735 502
347 3300015261 Ga0182006_1005441 Ga0182006_10054413 502
348 3300025208 Ga0209436_103961 Ga0209436_1039611 502
349 3300025245 Ga0207425_1000154 Ga0207425_100015444 502
350 3300025245 Ga0207425_1006101 Ga0207425_10061013 502
351 3300025258 Ga0209129_1000023 Ga0209129_1000023160 502
352 3300025258 Ga0209129_1001302 Ga0209129_100130211 502
353 3300025263 Ga0209565_1000125 Ga0209565_100012544 502
354 3300025273 Ga0209673_1000192 Ga0209673_100019249 502
355 3300025273 Ga0209673_1000583 Ga0209673_100058344 502
356 3300025284 Ga0209130_1000069 Ga0209130_1000069163 502
357 3300025284 Ga0209130_1000479 Ga0209130_100047936 502
358 3300025291 Ga0209675_1000427 Ga0209675_10004275 502
359 3300025292 Ga0209676_1000005 Ga0209676_1000005642 502
360 3300025292 Ga0209676_1000285 Ga0209676_100028549 502
361 3300025292 Ga0209676_1009562 Ga0209676_10095623 502
362 3300025294 Ga0209025_1000316 Ga0209025_1000316103 502
363 3300025294 Ga0209025_1000652 Ga0209025_100065257 502
364 3300025294 Ga0209025_1013742 Ga0209025_10137423 502
365 3300025295 Ga0209564_1000270 Ga0209564_100027054 502
366 3300025295 Ga0209564_1002285 Ga0209564_100228514 502
367 3300025297 Ga0209758_1000064 Ga0209758_100006461 502
368 3300025298 Ga0209050_1000007 Ga0209050_1000007455 502
369 3300025299 Ga0209256_1000020 Ga0209256_1000020432 502
370 3300025299 Ga0209256_1000022 Ga0209256_10000224 502
371 3300025302 Ga0207426_1000001 Ga0207426_10000011067 502
372 3300025302 Ga0207426_1000031 Ga0207426_1000031160 502
373 3300025303 Ga0209051_1000009 Ga0209051_1000009642 502
374 3300025304 Ga0209257_1000011 Ga0209257_1000011616 502
375 3300025304 Ga0209257_1003803 Ga0209257_10038034 502
376 3300046518 Ga0495631_0001641 Ga0495631_0001641_2633_4240 502
377 3300046660 Ga0495625_0056113 Ga0495625_0056113_184_1791 502
378 3300048926 Ga0496123_0046882 Ga0496123_0046882_858_2465 502
379 3300053118 Ga0500594_0006263 Ga0500594_0006263_283_1899 502
380 3300053134 Ga0500658_0000792 Ga0500658_0000792_2079_3686 502
381 3300048921 Ga0496118_0027154 Ga0496118_0027154_34_1548 504
382 3300001979 JGI24740J21852_10014319 JGI24740J21852_100143192 506

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

6

258

0.94

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

282

475

0.92

PF13500

AAA_26

AAA domain

85

259

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a82-assembly1.cif.gz_A dethiobiotin synthetase from escherichia coli, complex with substrates atp and diaminopelargonic acid 0.7652 30 255
5gq1-assembly1.cif.gz_F crystal structure of 2c helicase from enterovirus 71 (ev71) 0.764 29 62
1dts-assembly1.cif.gz_A-2 crystal structure of an atp dependent carboxylase, dethiobiotin synthase, at 1.65 angstroms resolution 0.7549 30 256
3l4e-assembly1.cif.gz_A 1.5a crystal structure of a putative peptidase e protein from listeria monocytogenes egd-e 0.7539 272 384
1dae-assembly1.cif.gz_A dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid 0.7508 30 254
ID Description Score Start End Superfamily
af_Q57908_3_246_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.958 31 264 3.40.50.300
af_P9WP95_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9344 32 263 3.40.50.300
af_Q57908_3_246_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.916 31 264 3.40.50.300
af_P9WP95_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9043 32 263 3.40.50.300
af_P9WP95_251_442_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8607 275 479 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7X6DED3-F1-model_v4 CobB/CobQ-like glutamine amidotransferase domain-containing protein 0.9843 278 475 GO:0003824
GO:0006541
GO:0009236
AF-A0A2T7SRX1-F1-model_v4 Cobyric acid synthase 0.9783 28 506 GO:0003824
GO:0006541
GO:0009236
GO:0015420
AF-A0A2M7FSP3-F1-model_v4 Cobyric acid synthase CobQ 0.9765 28 158 GO:0009236
AF-A0A382IBL4-F1-model_v4 CobQ/CobB/MinD/ParA nucleotide binding domain-containing protein 0.9581 37 124 GO:0009236
AF-A0A2J1DV17-F1-model_v4 Cobyric acid synthase CobQ 0.9576 30 161 GO:0009236

Feature Viewer

pLDDT pTM Quality
87.2 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map