F429056
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 381 | 256 | 372 | 387 |
Family's Representative Sequence
| Representative Sequence | 3300046689|Ga0495613_0017475|Ga0495613_0017475_3175_4560 |
| Length | 451 |
| Sequence | MHHALRLSKRFVAIAAVSLLAIGTTAAVATSASGHRTHHRGPSSKSHGDHHVSFHNGGLSITSSPFGNLPMGVPNIPDGGAAVTKYTLSNKRGMTVSILDYGGIIQSLDVPDNRGHEANVTLGFANIDGYTNAAYLKSNPYFGAIIGRYGNRIANGKFSIPAQNGFPASGPFTVDINNGANTLHGGFTGYDKEMWKATPVPPSHGSVGLTLTGIRSGTAGEGCNPALNQGVGSPPNTCTTGYPGNLKVSVTFTLNNQNQLSFHYVATTDAPTVVNLTNHSYWNLSGEGSGTINDHLLQINANSFTPVDSGLIPTGVIQPVAGTPFDFTRFHAIGERLRGNDQQLVFGRGYDHNFVLNNPHPGNVAARLFDPASGRLLTILTDQPGLQFYSGNFLDGTLYGTSGRQYRQGDGLALETQHFPDSPNHANFPSTELDPGQTYDSTTVYGFSTVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 2 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 3 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 4 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 5 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 6 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 7 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 8 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 9 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 71 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 76 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 132 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 135 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 137 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 138 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 139 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 141 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 142 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 143 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 144 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 145 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 147 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 148 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 149 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 152 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 153 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 154 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 155 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 156 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 157 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 158 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 159 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 160 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 161 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 162 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 163 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 164 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 165 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 166 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 167 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 202 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 203 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 204 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 209 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 210 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 213 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 214 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 215 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 216 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 217 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 218 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 219 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 246 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 247 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 248 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 249 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 250 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 251 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 252 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.33 |
| Metatranscriptomes | 1.31 |
| Isolates | 2.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.91 |
| Nodule | 0 |
| Rhizoplane | 6.82 |
| Rhizosphere | 72.44 |
| Stem | 0 |
| Stem Tuber | 0.26 |
| Unclassified | 6.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5yngRDRAFT_c003252 | 3300000043 | Bacteria | 1617 |
| 2 | JGI24735J21928_10000175 | 3300002067 | Bacteria | 22763 |
| 3 | JGI25162J39368_1000734 | 3300002737 | Bacteria | 22511 |
| 4 | rootH2_10000615 | 3300003320 | Bacteria | 129558 |
| 5 | rootH2_10015052 | 3300003320 | Bacteria | 12751 |
| 6 | rootH1_10176214 | 3300003323 | Bacteria | 1611 |
| 7 | JGI25407J50210_10003719 | 3300003373 | Bacteria | 3677 |
| 8 | Ga0055533_1002649 | 3300003756 | Bacteria | 3972 |
| 9 | Ga0055542_1001209 | 3300003762 | Bacteria | 14546 |
| 10 | Ga0055537_1005315 | 3300003773 | Bacteria | 3479 |
| 11 | Ga0055524_1000598 | 3300003775 | Bacteria | 26071 |
| 12 | Ga0055524_1023577 | 3300003775 | Bacteria | 1978 |
| 13 | Ga0055524_1023601 | 3300003775 | Bacteria | 1976 |
| 14 | Ga0055524_1025179 | 3300003775 | Bacteria | 1869 |
| 15 | Ga0055536_1005909 | 3300003781 | Bacteria | 5860 |
| 16 | Ga0055530_10000131 | 3300003791 | Bacteria | 65535 |
| 17 | Ga0055530_10001374 | 3300003791 | Bacteria | 18030 |
| 18 | Ga0055530_10014649 | 3300003791 | Bacteria | 2600 |
| 19 | Ga0055531_10000617 | 3300003794 | Bacteria | 30689 |
| 20 | Ga0055531_10002141 | 3300003794 | Bacteria | 13509 |
| 21 | Ga0055531_10006000 | 3300003794 | Bacteria | 6974 |
| 22 | Ga0055531_10007825 | 3300003794 | Bacteria | 5753 |
| 23 | Ga0055531_10009889 | 3300003794 | Bacteria | 4823 |
| 24 | Ga0070658_10000001 | 3300005327 | Bacteria | 856789 |
| 25 | Ga0070658_10000615 | 3300005327 | Bacteria | 30801 |
| 26 | Ga0070658_10023990 | 3300005327 | Bacteria | 4895 |
| 27 | Ga0070676_10034696 | 3300005328 | Bacteria | 2897 |
| 28 | Ga0070666_10000023 | 3300005335 | Bacteria | 161603 |
| 29 | Ga0068868_100023728 | 3300005338 | Bacteria | 4645 |
| 30 | Ga0068868_100054916 | 3300005338 | Bacteria | 3141 |
| 31 | Ga0070660_100003803 | 3300005339 | Bacteria | 10426 |
| 32 | Ga0070660_100034163 | 3300005339 | Bacteria | 3840 |
| 33 | Ga0070689_100005143 | 3300005340 | Bacteria | 8897 |
| 34 | Ga0070687_100119697 | 3300005343 | Bacteria | 1504 |
| 35 | Ga0070692_10001859 | 3300005345 | Bacteria | 7937 |
| 36 | Ga0070668_100017107 | 3300005347 | Bacteria | 5427 |
| 37 | Ga0070671_100295053 | 3300005355 | Bacteria | 1380 |
| 38 | Ga0070659_100005277 | 3300005366 | Bacteria | 9273 |
| 39 | Ga0070659_100015654 | 3300005366 | Bacteria | 5682 |
| 40 | Ga0070667_100012820 | 3300005367 | Bacteria | 6927 |
| 41 | Ga0070701_10084182 | 3300005438 | Bacteria | 1729 |
| 42 | Ga0070678_100186305 | 3300005456 | Bacteria | 1703 |
| 43 | Ga0070662_100035262 | 3300005457 | Bacteria | 3532 |
| 44 | Ga0070681_10103805 | 3300005458 | Bacteria | 2786 |
| 45 | Ga0070681_10374350 | 3300005458 | Bacteria | 1335 |
| 46 | Ga0068867_100211783 | 3300005459 | Bacteria | 1557 |
| 47 | Ga0070685_10047093 | 3300005466 | Bacteria | 2478 |
| 48 | Ga0070685_10085447 | 3300005466 | Bacteria | 1900 |
| 49 | Ga0070704_100010103 | 3300005549 | Bacteria | 5739 |
| 50 | Ga0068856_100098544 | 3300005614 | Bacteria | 2913 |
| 51 | Ga0068856_100194824 | 3300005614 | Bacteria | 2040 |
| 52 | Ga0070702_100003238 | 3300005615 | Bacteria | 7246 |
| 53 | Ga0070702_100008029 | 3300005615 | Bacteria | 5092 |
| 54 | Ga0068859_100162174 | 3300005617 | Bacteria | 2315 |
| 55 | Ga0068866_10056025 | 3300005718 | Bacteria | 2027 |
| 56 | Ga0068861_100043420 | 3300005719 | Bacteria | 3375 |
| 57 | Ga0068858_100086448 | 3300005842 | Bacteria | 2917 |
| 58 | Ga0068858_100098566 | 3300005842 | Bacteria | 2725 |
| 59 | Ga0068858_100103199 | 3300005842 | Bacteria | 2660 |
| 60 | Ga0068860_100012948 | 3300005843 | Bacteria | 8193 |
| 61 | Ga0068860_100111452 | 3300005843 | Bacteria | 2616 |
| 62 | Ga0081455_10003941 | 3300005937 | Bacteria | 16879 |
| 63 | Ga0081455_10041117 | 3300005937 | Bacteria | 4070 |
| 64 | Ga0081455_10158507 | 3300005937 | Bacteria | 1737 |
| 65 | Ga0081538_10000415 | 3300005981 | Bacteria | 48044 |
| 66 | Ga0081538_10007113 | 3300005981 | Bacteria | 9720 |
| 67 | Ga0081538_10014092 | 3300005981 | Bacteria | 6282 |
| 68 | Ga0081538_10035797 | 3300005981 | Bacteria | 3254 |
| 69 | Ga0081538_10043177 | 3300005981 | Bacteria | 2835 |
| 70 | Ga0081540_1000481 | 3300005983 | Bacteria | 39044 |
| 71 | Ga0081539_10038432 | 3300005985 | Bacteria | 2837 |
| 72 | Ga0070716_100000005 | 3300006173 | Bacteria | 273485 |
| 73 | Ga0070716_100000153 | 3300006173 | Bacteria | 27251 |
| 74 | Ga0075428_100000098 | 3300006844 | Bacteria | 73177 |
| 75 | Ga0075428_100063526 | 3300006844 | Bacteria | 4042 |
| 76 | Ga0097620_100162159 | 3300006931 | Bacteria | 2315 |
| 77 | Ga0105240_10000113 | 3300009093 | Bacteria | 168192 |
| 78 | Ga0105240_10000405 | 3300009093 | Bacteria | 80014 |
| 79 | Ga0111539_10001235 | 3300009094 | Bacteria | 34018 |
| 80 | Ga0111539_10010692 | 3300009094 | Bacteria | 11556 |
| 81 | Ga0105245_10077253 | 3300009098 | Bacteria | 3035 |
| 82 | Ga0105247_10153604 | 3300009101 | Bacteria | 1519 |
| 83 | Ga0114129_10095925 | 3300009147 | Bacteria | 4107 |
| 84 | Ga0114129_10388366 | 3300009147 | Bacteria | 1842 |
| 85 | Ga0105243_10021311 | 3300009148 | Bacteria | 4919 |
| 86 | Ga0105243_10036812 | 3300009148 | Bacteria | 3800 |
| 87 | Ga0105241_10033797 | 3300009174 | Bacteria | 3840 |
| 88 | Ga0105242_10033483 | 3300009176 | Bacteria | 4114 |
| 89 | Ga0105238_10000331 | 3300009551 | Bacteria | 51630 |
| 90 | Ga0105238_10088094 | 3300009551 | Bacteria | 3091 |
| 91 | Ga0105249_10020990 | 3300009553 | Bacteria | 5844 |
| 92 | Ga0105239_10000070 | 3300010375 | Bacteria | 144044 |
| 93 | Ga0157369_10016164 | 3300013105 | Bacteria | 8400 |
| 94 | Ga0157369_10193826 | 3300013105 | Bacteria | 2134 |
| 95 | Ga0157378_10071356 | 3300013297 | Bacteria | 3119 |
| 96 | Ga0163162_10007941 | 3300013306 | Bacteria | 10347 |
| 97 | Ga0157372_10098028 | 3300013307 | Bacteria | 3344 |
| 98 | Ga0182006_1033846 | 3300015261 | Bacteria | 2047 |
| 99 | Ga0182007_10010810 | 3300015262 | Bacteria | 3585 |
| 100 | Ga0183368_1007 | 3300015687 | Bacteria | 405609 |
| 101 | Ga0163161_10207392 | 3300017792 | Bacteria | 1513 |
| 102 | Ga0206356_11725725 | 3300020070 | Bacteria | 1724 |
| 103 | Ga0213876_10000123 | 3300021384 | Bacteria | 84497 |
| 104 | Ga0224712_10056142 | 3300022467 | Bacteria | 1551 |
| 105 | Ga0209566_102023 | 3300025225 | Bacteria | 4266 |
| 106 | Ga0209674_100037 | 3300025226 | Bacteria | 404339 |
| 107 | Ga0207427_101275 | 3300025231 | Bacteria | 9597 |
| 108 | Ga0209437_100924 | 3300025233 | Bacteria | 11174 |
| 109 | Ga0209258_101200 | 3300025242 | Bacteria | 10284 |
| 110 | Ga0207425_1019638 | 3300025245 | Bacteria | 1452 |
| 111 | Ga0209026_1004778 | 3300025250 | Bacteria | 3880 |
| 112 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 113 | Ga0209759_1001939 | 3300025256 | Bacteria | 10058 |
| 114 | Ga0209233_1007306 | 3300025261 | Bacteria | 3507 |
| 115 | Ga0209565_1000011 | 3300025263 | Bacteria | 637062 |
| 116 | Ga0209673_1005191 | 3300025273 | Bacteria | 6648 |
| 117 | Ga0209675_1005379 | 3300025291 | Bacteria | 5376 |
| 118 | Ga0209675_1006509 | 3300025291 | Bacteria | 4667 |
| 119 | Ga0209675_1024332 | 3300025291 | Bacteria | 1549 |
| 120 | Ga0209676_1004138 | 3300025292 | Bacteria | 8259 |
| 121 | Ga0209025_1000401 | 3300025294 | Bacteria | 88709 |
| 122 | Ga0209758_1019428 | 3300025297 | Bacteria | 3276 |
| 123 | Ga0209758_1023928 | 3300025297 | Bacteria | 2742 |
| 124 | Ga0209050_1000347 | 3300025298 | Bacteria | 90767 |
| 125 | Ga0209050_1000986 | 3300025298 | Bacteria | 36241 |
| 126 | Ga0209050_1002531 | 3300025298 | Bacteria | 15309 |
| 127 | Ga0209050_1010936 | 3300025298 | Bacteria | 4387 |
| 128 | Ga0209050_1016892 | 3300025298 | Bacteria | 2950 |
| 129 | Ga0209256_1000851 | 3300025299 | Bacteria | 38114 |
| 130 | Ga0209256_1003520 | 3300025299 | Bacteria | 10903 |
| 131 | Ga0209256_1004386 | 3300025299 | Bacteria | 8910 |
| 132 | Ga0209256_1020871 | 3300025299 | Bacteria | 2030 |
| 133 | Ga0209051_1007871 | 3300025303 | Bacteria | 5748 |
| 134 | Ga0209257_1000065 | 3300025304 | Bacteria | 353604 |
| 135 | Ga0209257_1000371 | 3300025304 | Bacteria | 90767 |
| 136 | Ga0207688_10036724 | 3300025901 | Bacteria | 2716 |
| 137 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 138 | Ga0207647_10005179 | 3300025904 | Bacteria | 9593 |
| 139 | Ga0207647_10018415 | 3300025904 | Bacteria | 4724 |
| 140 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 141 | Ga0207705_10020900 | 3300025909 | Bacteria | 4671 |
| 142 | Ga0207705_10024840 | 3300025909 | Bacteria | 4277 |
| 143 | Ga0207707_10079261 | 3300025912 | Bacteria | 2868 |
| 144 | Ga0207695_10000609 | 3300025913 | Bacteria | 71895 |
| 145 | Ga0207695_10002090 | 3300025913 | Bacteria | 30400 |
| 146 | Ga0207671_10199070 | 3300025914 | Bacteria | 1564 |
| 147 | Ga0207693_10003521 | 3300025915 | Bacteria | 13366 |
| 148 | Ga0207662_10142185 | 3300025918 | Bacteria | 1520 |
| 149 | Ga0207657_10003748 | 3300025919 | Bacteria | 16154 |
| 150 | Ga0207657_10005776 | 3300025919 | Bacteria | 12904 |
| 151 | Ga0207657_10021303 | 3300025919 | Bacteria | 6104 |
| 152 | Ga0207694_10002097 | 3300025924 | Bacteria | 16468 |
| 153 | Ga0207650_10048614 | 3300025925 | Bacteria | 3129 |
| 154 | Ga0207687_10029745 | 3300025927 | Bacteria | 3676 |
| 155 | Ga0207687_10153829 | 3300025927 | Bacteria | 1758 |
| 156 | Ga0207700_10116807 | 3300025928 | Bacteria | 2156 |
| 157 | Ga0207664_10000041 | 3300025929 | Bacteria | 154806 |
| 158 | Ga0207690_10007084 | 3300025932 | Bacteria | 6659 |
| 159 | Ga0207690_10014038 | 3300025932 | Bacteria | 4829 |
| 160 | Ga0207706_10008967 | 3300025933 | Bacteria | 9205 |
| 161 | Ga0207709_10019472 | 3300025935 | Bacteria | 3817 |
| 162 | Ga0207709_10082884 | 3300025935 | Bacteria | 2072 |
| 163 | Ga0207665_10000012 | 3300025939 | Bacteria | 143062 |
| 164 | Ga0207665_10000014 | 3300025939 | Bacteria | 137803 |
| 165 | Ga0207689_10294118 | 3300025942 | Bacteria | 1345 |
| 166 | Ga0207679_10224109 | 3300025945 | Bacteria | 1583 |
| 167 | Ga0207667_10073400 | 3300025949 | Bacteria | 3555 |
| 168 | Ga0207668_10018005 | 3300025972 | Bacteria | 4437 |
| 169 | Ga0207668_10251581 | 3300025972 | Bacteria | 1435 |
| 170 | Ga0207640_10076209 | 3300025981 | Bacteria | 2275 |
| 171 | Ga0207703_10061937 | 3300026035 | Bacteria | 3064 |
| 172 | Ga0207703_10123525 | 3300026035 | Bacteria | 2225 |
| 173 | Ga0207702_10154226 | 3300026078 | Bacteria | 2092 |
| 174 | Ga0207648_10263654 | 3300026089 | Bacteria | 1538 |
| 175 | Ga0207674_10271814 | 3300026116 | Bacteria | 1642 |
| 176 | Ga0207675_100024814 | 3300026118 | Bacteria | 5578 |
| 177 | Ga0207683_10110845 | 3300026121 | Bacteria | 2457 |
| 178 | Ga0209371_1000023 | 3300027312 | Bacteria | 519553 |
| 179 | Ga0207428_10017712 | 3300027907 | Bacteria | 6109 |
| 180 | Ga0207428_10026645 | 3300027907 | Bacteria | 4821 |
| 181 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 182 | Ga0268264_10007451 | 3300028381 | Bacteria | 9132 |
| 183 | Ga0268264_10102392 | 3300028381 | Bacteria | 2492 |
| 184 | Ga0268256_1000023 | 3300030500 | Bacteria | 519631 |
| 185 | Ga0265332_10014921 | 3300031238 | Bacteria | 3435 |
| 186 | Ga0307405_10235788 | 3300031731 | Bacteria | 1352 |
| 187 | Ga0307407_10015336 | 3300031903 | Bacteria | 3785 |
| 188 | Ga0307407_10047966 | 3300031903 | Bacteria | 2428 |
| 189 | Ga0307412_10047062 | 3300031911 | Bacteria | 2831 |
| 190 | Ga0307409_100060588 | 3300031995 | Bacteria | 2952 |
| 191 | Ga0307409_100114860 | 3300031995 | Bacteria | 2266 |
| 192 | Ga0307409_100119662 | 3300031995 | Bacteria | 2227 |
| 193 | Ga0307414_10138108 | 3300032004 | Bacteria | 1904 |
| 194 | Ga0307507_10000073 | 3300033179 | Bacteria | 157894 |
| 195 | Ga0316587_1008256 | 3300033529 | Bacteria | 1633 |
| 196 | Ga0373953_0003953 | 3300035117 | Bacteria | 4672 |
| 197 | Ga0373954_0058130 | 3300035118 | Bacteria | 1822 |
| 198 | Ga0373927_0001239 | 3300035695 | Bacteria | 19386 |
| 199 | Ga0373933_0064324 | 3300035724 | Bacteria | 2219 |
| 200 | Ga0373933_0127181 | 3300035724 | Bacteria | 1600 |
| 201 | Ga0373947_0021173 | 3300035725 | Bacteria | 3763 |
| 202 | Ga0373937_0002986 | 3300036401 | Bacteria | 14172 |
| 203 | Ga0395899_0010590 | 3300037312 | Bacteria | 7066 |
| 204 | Ga0395900_0002796 | 3300037418 | Bacteria | 19064 |
| 205 | Ga0395900_0051602 | 3300037418 | Bacteria | 4236 |
| 206 | Ga0395900_0155911 | 3300037418 | Bacteria | 2332 |
| 207 | Ga0395898_0005521 | 3300037466 | Bacteria | 13648 |
| 208 | Ga0395898_0036896 | 3300037466 | Bacteria | 4851 |
| 209 | Ga0395898_0089667 | 3300037466 | Bacteria | 2959 |
| 210 | Ga0395898_0250919 | 3300037466 | Bacteria | 1687 |
| 211 | Ga0395905_0017581 | 3300037471 | Bacteria | 6786 |
| 212 | Ga0395905_0075500 | 3300037471 | Bacteria | 3159 |
| 213 | Ga0395905_0158379 | 3300037471 | Bacteria | 2129 |
| 214 | Ga0395901_0016210 | 3300038443 | Bacteria | 7590 |
| 215 | Ga0395901_0132467 | 3300038443 | Bacteria | 2619 |
| 216 | Ga0436365_0301130 | 3300039437 | Bacteria | 2369 |
| 217 | Ga0436365_0354346 | 3300039437 | Bacteria | 23652 |
| 218 | Ga0439439_0012178 | 3300041406 | Bacteria | 2078 |
| 219 | Ga0439461_0000461 | 3300041410 | Bacteria | 5890 |
| 220 | Ga0439461_0004873 | 3300041410 | Bacteria | 2262 |
| 221 | Ga0439465_0001271 | 3300041413 | Bacteria | 8113 |
| 222 | Ga0439465_0002191 | 3300041413 | Bacteria | 6404 |
| 223 | Ga0439431_0000186 | 3300041997 | Bacteria | 12046 |
| 224 | Ga0439432_001115 | 3300042006 | Bacteria | 10212 |
| 225 | Ga0439452_016973 | 3300042010 | Bacteria | 1968 |
| 226 | Ga0439452_029869 | 3300042010 | Bacteria | 1349 |
| 227 | Ga0439462_0001159 | 3300042015 | Bacteria | 5738 |
| 228 | Ga0466961_0097908 | 3300044693 | Bacteria | 1849 |
| 229 | Ga0466963_0021620 | 3300044694 | Bacteria | 4062 |
| 230 | Ga0466963_0028725 | 3300044694 | Bacteria | 3574 |
| 231 | Ga0466963_0088097 | 3300044694 | Bacteria | 2111 |
| 232 | Ga0466964_0056997 | 3300044706 | Bacteria | 1616 |
| 233 | Ga0466971_0110802 | 3300044719 | Bacteria | 1266 |
| 234 | Ga0466970_0109303 | 3300044765 | Bacteria | 1509 |
| 235 | Ga0466957_0093783 | 3300044842 | Bacteria | 1884 |
| 236 | Ga0466959_0091263 | 3300045049 | Bacteria | 2187 |
| 237 | Ga0466967_0001114 | 3300045976 | Bacteria | 14905 |
| 238 | Ga0466967_0001674 | 3300045976 | Bacteria | 13144 |
| 239 | Ga0466967_0012175 | 3300045976 | Bacteria | 6564 |
| 240 | Ga0466967_0045980 | 3300045976 | Bacteria | 3797 |
| 241 | Ga0466967_0127850 | 3300045976 | Bacteria | 2355 |
| 242 | Ga0466967_0473579 | 3300045976 | Bacteria | 1226 |
| 243 | Ga0495592_0007992 | 3300046454 | Bacteria | 7936 |
| 244 | Ga0495592_0031434 | 3300046454 | Bacteria | 4012 |
| 245 | Ga0495603_0156194 | 3300046455 | Bacteria | 1324 |
| 246 | Ga0495629_0067889 | 3300046459 | Bacteria | 2488 |
| 247 | Ga0495651_0001227 | 3300046462 | Bacteria | 19826 |
| 248 | Ga0495653_0013153 | 3300046463 | Bacteria | 6748 |
| 249 | Ga0495650_0000074 | 3300046471 | Bacteria | 251346 |
| 250 | Ga0495662_0003863 | 3300046476 | Bacteria | 7559 |
| 251 | Ga0495662_0042020 | 3300046476 | Bacteria | 2206 |
| 252 | Ga0495664_0001316 | 3300046477 | Bacteria | 13044 |
| 253 | Ga0495664_0118717 | 3300046477 | Bacteria | 1599 |
| 254 | Ga0495608_0003534 | 3300046511 | Bacteria | 11197 |
| 255 | Ga0495618_0006274 | 3300046514 | Bacteria | 7216 |
| 256 | Ga0495630_0004783 | 3300046517 | Bacteria | 9497 |
| 257 | Ga0495652_0008370 | 3300046529 | Bacteria | 9447 |
| 258 | Ga0495665_0048571 | 3300046531 | Bacteria | 2250 |
| 259 | Ga0495640_0073702 | 3300046533 | Bacteria | 2285 |
| 260 | Ga0495587_0005711 | 3300046536 | Bacteria | 8107 |
| 261 | Ga0495587_0095646 | 3300046536 | Bacteria | 1714 |
| 262 | Ga0495645_0001153 | 3300046543 | Bacteria | 17951 |
| 263 | Ga0495667_0000751 | 3300046559 | Bacteria | 20850 |
| 264 | Ga0495667_0032818 | 3300046559 | Bacteria | 3476 |
| 265 | Ga0495634_0053577 | 3300046642 | Bacteria | 2702 |
| 266 | Ga0495634_0084885 | 3300046642 | Bacteria | 2064 |
| 267 | Ga0495625_0022560 | 3300046660 | Bacteria | 4824 |
| 268 | Ga0495635_0005105 | 3300046663 | Bacteria | 9129 |
| 269 | Ga0495635_0050663 | 3300046663 | Bacteria | 2862 |
| 270 | Ga0495599_0004378 | 3300046678 | Bacteria | 8360 |
| 271 | Ga0495599_0059719 | 3300046678 | Bacteria | 2385 |
| 272 | Ga0495623_0021349 | 3300046679 | Bacteria | 4181 |
| 273 | Ga0495613_0006389 | 3300046689 | Bacteria | 8808 |
| 274 | Ga0495613_0017475 | 3300046689 | Bacteria | 5341 |
| 275 | Ga0495649_0001962 | 3300046694 | Bacteria | 14916 |
| 276 | Ga0495600_0044248 | 3300046809 | Bacteria | 2905 |
| 277 | Ga0495604_0001726 | 3300047317 | Bacteria | 17932 |
| 278 | Ga0495604_0076161 | 3300047317 | Bacteria | 2524 |
| 279 | Ga0495674_0012170 | 3300047319 | Bacteria | 8109 |
| 280 | Ga0495674_0207144 | 3300047319 | Bacteria | 1625 |
| 281 | Ga0495680_0002166 | 3300047322 | Bacteria | 20327 |
| 282 | Ga0495680_0118510 | 3300047322 | Bacteria | 1956 |
| 283 | Ga0495675_0190273 | 3300047444 | Bacteria | 1253 |
| 284 | Ga0495681_0009970 | 3300047470 | Bacteria | 5792 |
| 285 | Ga0495684_0044937 | 3300047471 | Bacteria | 3380 |
| 286 | Ga0495602_0008354 | 3300048088 | Bacteria | 10818 |
| 287 | Ga0495602_0086838 | 3300048088 | Bacteria | 2610 |
| 288 | Ga0496100_0031854 | 3300048903 | Bacteria | 3282 |
| 289 | Ga0496100_0094476 | 3300048903 | Bacteria | 2048 |
| 290 | Ga0496100_0451879 | 3300048903 | Bacteria | 985 |
| 291 | Ga0496101_0089491 | 3300048904 | Bacteria | 2288 |
| 292 | Ga0496102_0035345 | 3300048905 | Bacteria | 4497 |
| 293 | Ga0496104_0023436 | 3300048907 | Bacteria | 5675 |
| 294 | Ga0496104_0027893 | 3300048907 | Bacteria | 5228 |
| 295 | Ga0496104_0069072 | 3300048907 | Bacteria | 3358 |
| 296 | Ga0496104_0268577 | 3300048907 | Bacteria | 1618 |
| 297 | Ga0496105_0002435 | 3300048908 | Bacteria | 13482 |
| 298 | Ga0496105_0028585 | 3300048908 | Bacteria | 4559 |
| 299 | Ga0496106_0205249 | 3300048909 | Bacteria | 1569 |
| 300 | Ga0496107_0142997 | 3300048910 | Bacteria | 1768 |
| 301 | Ga0496108_0002572 | 3300048911 | Bacteria | 14535 |
| 302 | Ga0496108_0011152 | 3300048911 | Bacteria | 7304 |
| 303 | Ga0496109_0005577 | 3300048912 | Bacteria | 10536 |
| 304 | Ga0496109_0063930 | 3300048912 | Bacteria | 3366 |
| 305 | Ga0496110_0020392 | 3300048913 | Bacteria | 5598 |
| 306 | Ga0496111_0011094 | 3300048914 | Bacteria | 6064 |
| 307 | Ga0496111_0106677 | 3300048914 | Bacteria | 2062 |
| 308 | Ga0496112_0024424 | 3300048915 | Bacteria | 5787 |
| 309 | Ga0496113_0078043 | 3300048916 | Bacteria | 2533 |
| 310 | Ga0496115_0000272 | 3300048918 | Bacteria | 45410 |
| 311 | Ga0496115_0000603 | 3300048918 | Bacteria | 27521 |
| 312 | Ga0496115_0034850 | 3300048918 | Bacteria | 3979 |
| 313 | Ga0496115_0050135 | 3300048918 | Bacteria | 3343 |
| 314 | Ga0496117_0002182 | 3300048920 | Bacteria | 25529 |
| 315 | Ga0496117_0023067 | 3300048920 | Bacteria | 4973 |
| 316 | Ga0496118_0003175 | 3300048921 | Bacteria | 20997 |
| 317 | Ga0496118_0003446 | 3300048921 | Bacteria | 19915 |
| 318 | Ga0496119_0000048 | 3300048922 | Bacteria | 185846 |
| 319 | Ga0496120_0000113 | 3300048923 | Bacteria | 136672 |
| 320 | Ga0496120_0000133 | 3300048923 | Bacteria | 126194 |
| 321 | Ga0496121_0000013 | 3300048924 | Bacteria | 614976 |
| 322 | Ga0496121_0039730 | 3300048924 | Bacteria | 4139 |
| 323 | Ga0496121_0144852 | 3300048924 | Bacteria | 1757 |
| 324 | Ga0496126_0000240 | 3300048929 | Bacteria | 117890 |
| 325 | Ga0496126_0025341 | 3300048929 | Bacteria | 5707 |
| 326 | Ga0496126_0205549 | 3300048929 | Bacteria | 1660 |
| 327 | Ga0495682_0005889 | 3300049460 | Bacteria | 5031 |
| 328 | Ga0501033_0111822 | 3300049570 | Bacteria | 1987 |
| 329 | Ga0501033_0171055 | 3300049570 | Unclassified | 1560 |
| 330 | Ga0501034_0051057 | 3300049571 | Bacteria | 4170 |
| 331 | Ga0501034_0128030 | 3300049571 | Bacteria | 2524 |
| 332 | Ga0501036_0052115 | 3300049572 | Bacteria | 3465 |
| 333 | Ga0501036_0090047 | 3300049572 | Bacteria | 2592 |
| 334 | Ga0501037_0041480 | 3300049573 | Bacteria | 3384 |
| 335 | Ga0501041_0012272 | 3300049577 | Bacteria | 5076 |
| 336 | Ga0501042_0014417 | 3300049578 | Bacteria | 5395 |
| 337 | Ga0501043_0016143 | 3300049579 | Bacteria | 5856 |
| 338 | Ga0501043_0040387 | 3300049579 | Bacteria | 3666 |
| 339 | Ga0501043_0055900 | 3300049579 | Bacteria | 3100 |
| 340 | Ga0501046_0069868 | 3300049580 | Bacteria | 2731 |
| 341 | Ga0501048_0005980 | 3300049582 | Bacteria | 9269 |
| 342 | Ga0501069_0012017 | 3300049585 | Bacteria | 4596 |
| 343 | Ga0501070_0027465 | 3300049586 | Bacteria | 4774 |
| 344 | Ga0501071_0073448 | 3300049587 | Bacteria | 2495 |
| 345 | Ga0501072_0081967 | 3300049588 | Bacteria | 2557 |
| 346 | Ga0501073_0001164 | 3300049589 | Bacteria | 19195 |
| 347 | Ga0501074_0003566 | 3300049590 | Bacteria | 11035 |
| 348 | Ga0501074_0132093 | 3300049590 | Bacteria | 1786 |
| 349 | Ga0501080_0004965 | 3300049742 | Bacteria | 11843 |
| 350 | Ga0501083_0037999 | 3300049744 | Bacteria | 3274 |
| 351 | Ga0501035_0005303 | 3300049822 | Bacteria | 12206 |
| 352 | Ga0501035_0027696 | 3300049822 | Bacteria | 5179 |
| 353 | Ga0501035_0032846 | 3300049822 | Bacteria | 4719 |
| 354 | Ga0501044_0071066 | 3300049823 | Bacteria | 3539 |
| 355 | Ga0501044_0341518 | 3300049823 | Bacteria | 1418 |
| 356 | Ga0501045_0058689 | 3300049824 | Bacteria | 2818 |
| 357 | nmdc:mga09592_127804_c1 | 3300050508 | Bacteria | 2185 |
| 358 | nmdc:mga08y16_764_c1 | 3300050511 | Bacteria | 30613 |
| 359 | Ga0495601_0058061 | 3300053077 | Bacteria | 2452 |
| 360 | Ga0495595_0050495 | 3300053084 | Bacteria | 1926 |
| 361 | Ga0495619_0002079 | 3300053085 | Bacteria | 13315 |
| 362 | Ga0500643_013036 | 3300053087 | Bacteria | 2951 |
| 363 | Ga0500566_0005015 | 3300053094 | Bacteria | 7888 |
| 364 | Ga0500658_0000477 | 3300053134 | Bacteria | 17107 |
| 365 | Ga0500559_0003991 | 3300053136 | Bacteria | 7093 |
| 366 | Ga0500568_0026246 | 3300053139 | Bacteria | 2447 |
| 367 | Ga0500588_0027723 | 3300053146 | Bacteria | 1599 |
| 368 | Ga0500637_0033439 | 3300053178 | Bacteria | 2872 |
| 369 | Ga0501084_0143192 | 3300054114 | Bacteria | 2013 |
| 370 | Ga0587083_0010838 | 3300059505 | Bacteria | 1489 |
| 371 | Ga0587075_005977 | 3300059644 | Bacteria | 1477 |
| 372 | Ga0501082_0010232 | 3300060353 | Bacteria | 8075 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048903 | Ga0496100_0451879 | Ga0496100_0451879_22_972 | 306 |
| 2 | 3300005981 | Ga0081538_10043177 | Ga0081538_100431772 | 318 |
| 3 | 3300049570 | Ga0501033_0171055 | Ga0501033_0171055_94_1140 | 320 |
| 4 | 3300046531 | Ga0495665_0048571 | Ga0495665_0048571_488_1663 | 324 |
| 5 | 3300049822 | Ga0501035_0005303 | Ga0501035_0005303_4270_5367 | 328 |
| 6 | 3300047444 | Ga0495675_0190273 | Ga0495675_0190273_82_1095 | 330 |
| 7 | 3300035725 | Ga0373947_0021173 | Ga0373947_0021173_2417_3751 | 332 |
| 8 | 3300003791 | Ga0055530_10014649 | Ga0055530_100146493 | 333 |
| 9 | 3300025298 | Ga0209050_1000986 | Ga0209050_100098611 | 333 |
| 10 | 3300046477 | Ga0495664_0001316 | Ga0495664_0001316_1444_2616 | 335 |
| 11 | 3300046517 | Ga0495630_0004783 | Ga0495630_0004783_8024_9196 | 335 |
| 12 | 3300046536 | Ga0495587_0095646 | Ga0495587_0095646_529_1701 | 335 |
| 13 | 3300009176 | Ga0105242_10033483 | Ga0105242_100334834 | 336 |
| 14 | 3300017792 | Ga0163161_10207392 | Ga0163161_102073921 | 336 |
| 15 | 3300048924 | Ga0496121_0144852 | Ga0496121_0144852_242_1417 | 336 |
| 16 | 3300006173 | Ga0070716_100000005 | Ga0070716_10000000564 | 338 |
| 17 | 3300025939 | Ga0207665_10000012 | Ga0207665_1000001264 | 338 |
| 18 | 3300025915 | Ga0207693_10003521 | Ga0207693_100035215 | 339 |
| 19 | 3300035117 | Ga0373953_0003953 | Ga0373953_0003953_1257_2609 | 339 |
| 20 | 3300035724 | Ga0373933_0064324 | Ga0373933_0064324_835_2187 | 339 |
| 21 | 3300045976 | Ga0466967_0473579 | Ga0466967_0473579_11_1108 | 339 |
| 22 | 3300046454 | Ga0495592_0031434 | Ga0495592_0031434_2267_3619 | 339 |
| 23 | 3300046463 | Ga0495653_0013153 | Ga0495653_0013153_1525_2877 | 339 |
| 24 | 3300046477 | Ga0495664_0118717 | Ga0495664_0118717_90_1442 | 339 |
| 25 | 3300046511 | Ga0495608_0003534 | Ga0495608_0003534_4649_6001 | 339 |
| 26 | 3300046514 | Ga0495618_0006274 | Ga0495618_0006274_2155_3507 | 339 |
| 27 | 3300046559 | Ga0495667_0000751 | Ga0495667_0000751_5353_6705 | 339 |
| 28 | 3300046642 | Ga0495634_0084885 | Ga0495634_0084885_382_1734 | 339 |
| 29 | 3300046663 | Ga0495635_0005105 | Ga0495635_0005105_5260_6612 | 339 |
| 30 | 3300046678 | Ga0495599_0059719 | Ga0495599_0059719_434_1786 | 339 |
| 31 | 3300046679 | Ga0495623_0021349 | Ga0495623_0021349_1649_3001 | 339 |
| 32 | 3300047317 | Ga0495604_0001726 | Ga0495604_0001726_10376_11728 | 339 |
| 33 | 3300047322 | Ga0495680_0002166 | Ga0495680_0002166_7967_9319 | 339 |
| 34 | 3300048088 | Ga0495602_0008354 | Ga0495602_0008354_4231_5583 | 339 |
| 35 | 3300048907 | Ga0496104_0023436 | Ga0496104_0023436_3017_4363 | 339 |
| 36 | 3300048914 | Ga0496111_0106677 | Ga0496111_0106677_336_1682 | 339 |
| 37 | 3300053077 | Ga0495601_0058061 | Ga0495601_0058061_977_2329 | 339 |
| 38 | 3300005339 | Ga0070660_100034163 | Ga0070660_1000341633 | 340 |
| 39 | 3300005355 | Ga0070671_100295053 | Ga0070671_1002950531 | 340 |
| 40 | 3300005458 | Ga0070681_10374350 | Ga0070681_103743501 | 340 |
| 41 | 3300005843 | Ga0068860_100012948 | Ga0068860_1000129482 | 340 |
| 42 | 3300006844 | Ga0075428_100000098 | Ga0075428_10000009825 | 340 |
| 43 | 3300022467 | Ga0224712_10056142 | Ga0224712_100561421 | 340 |
| 44 | 3300025919 | Ga0207657_10021303 | Ga0207657_100213036 | 340 |
| 45 | 3300025945 | Ga0207679_10224109 | Ga0207679_102241092 | 340 |
| 46 | 3300027907 | Ga0207428_10026645 | Ga0207428_100266453 | 340 |
| 47 | 3300028381 | Ga0268264_10007451 | Ga0268264_100074512 | 340 |
| 48 | 3300036401 | Ga0373937_0002986 | Ga0373937_0002986_11088_12473 | 340 |
| 49 | 3300046462 | Ga0495651_0001227 | Ga0495651_0001227_11558_12943 | 340 |
| 50 | 3300046536 | Ga0495587_0005711 | Ga0495587_0005711_2031_3416 | 340 |
| 51 | 3300047319 | Ga0495674_0012170 | Ga0495674_0012170_2084_3469 | 340 |
| 52 | 3300048903 | Ga0496100_0031854 | Ga0496100_0031854_1438_2817 | 340 |
| 53 | 3300048918 | Ga0496115_0050135 | Ga0496115_0050135_1050_2429 | 340 |
| 54 | 3300053084 | Ga0495595_0050495 | Ga0495595_0050495_154_1539 | 340 |
| 55 | 3300053085 | Ga0495619_0002079 | Ga0495619_0002079_5713_7098 | 340 |
| 56 | 3300059644 | Ga0587075_005977 | Ga0587075_005977_85_1464 | 340 |
| 57 | 3300005340 | Ga0070689_100005143 | Ga0070689_1000051436 | 341 |
| 58 | 3300009094 | Ga0111539_10001235 | Ga0111539_1000123518 | 341 |
| 59 | 3300015261 | Ga0182006_1033846 | Ga0182006_10338461 | 341 |
| 60 | 3300035118 | Ga0373954_0058130 | Ga0373954_0058130_659_1789 | 341 |
| 61 | 3300035724 | Ga0373933_0127181 | Ga0373933_0127181_204_1334 | 341 |
| 62 | 3300046454 | Ga0495592_0007992 | Ga0495592_0007992_5599_6729 | 341 |
| 63 | 3300046476 | Ga0495662_0003863 | Ga0495662_0003863_5239_6369 | 341 |
| 64 | 3300046533 | Ga0495640_0073702 | Ga0495640_0073702_97_1227 | 341 |
| 65 | 3300046543 | Ga0495645_0001153 | Ga0495645_0001153_5086_6216 | 341 |
| 66 | 3300046559 | Ga0495667_0032818 | Ga0495667_0032818_1104_2237 | 341 |
| 67 | 3300046642 | Ga0495634_0053577 | Ga0495634_0053577_1531_2664 | 341 |
| 68 | 3300046663 | Ga0495635_0050663 | Ga0495635_0050663_771_1904 | 341 |
| 69 | 3300046678 | Ga0495599_0004378 | Ga0495599_0004378_5726_6856 | 341 |
| 70 | 3300046689 | Ga0495613_0006389 | Ga0495613_0006389_469_1599 | 341 |
| 71 | 3300046809 | Ga0495600_0044248 | Ga0495600_0044248_241_1371 | 341 |
| 72 | 3300047317 | Ga0495604_0076161 | Ga0495604_0076161_13_1146 | 341 |
| 73 | 3300047319 | Ga0495674_0207144 | Ga0495674_0207144_184_1314 | 341 |
| 74 | 3300047322 | Ga0495680_0118510 | Ga0495680_0118510_731_1861 | 341 |
| 75 | 3300047471 | Ga0495684_0044937 | Ga0495684_0044937_1709_2842 | 341 |
| 76 | 3300048088 | Ga0495602_0086838 | Ga0495602_0086838_1218_2348 | 341 |
| 77 | 3300050511 | nmdc:mga08y16_764_c1 | nmdc:mga08y16_764_c1_19338_20453 | 341 |
| 78 | 3300053146 | Ga0500588_0027723 | Ga0500588_0027723_71_1297 | 341 |
| 79 | 3300003320 | rootH2_10015052 | rootH2_100150527 | 342 |
| 80 | 3300005459 | Ga0068867_100211783 | Ga0068867_1002117831 | 342 |
| 81 | 3300025925 | Ga0207650_10048614 | Ga0207650_100486142 | 342 |
| 82 | 3300026089 | Ga0207648_10263654 | Ga0207648_102636542 | 342 |
| 83 | 3300033179 | Ga0307507_10000073 | Ga0307507_10000073125 | 342 |
| 84 | 3300046529 | Ga0495652_0008370 | Ga0495652_0008370_3307_4443 | 342 |
| 85 | 3300031238 | Ga0265332_10014921 | Ga0265332_100149212 | 343 |
| 86 | 3300005328 | Ga0070676_10034696 | Ga0070676_100346963 | 344 |
| 87 | 3300005981 | Ga0081538_10007113 | Ga0081538_100071135 | 344 |
| 88 | 3300006173 | Ga0070716_100000153 | Ga0070716_1000001537 | 344 |
| 89 | 3300009553 | Ga0105249_10020990 | Ga0105249_100209909 | 344 |
| 90 | 3300025939 | Ga0207665_10000014 | Ga0207665_1000001486 | 344 |
| 91 | 3300053178 | Ga0500637_0033439 | Ga0500637_0033439_1659_2846 | 344 |
| 92 | 3300005338 | Ga0068868_100054916 | Ga0068868_1000549163 | 345 |
| 93 | 3300005343 | Ga0070687_100119697 | Ga0070687_1001196972 | 345 |
| 94 | 3300005438 | Ga0070701_10084182 | Ga0070701_100841823 | 345 |
| 95 | 3300005614 | Ga0068856_100098544 | Ga0068856_1000985441 | 345 |
| 96 | 3300005615 | Ga0070702_100008029 | Ga0070702_1000080293 | 345 |
| 97 | 3300005617 | Ga0068859_100162174 | Ga0068859_1001621742 | 345 |
| 98 | 3300005842 | Ga0068858_100103199 | Ga0068858_1001031993 | 345 |
| 99 | 3300006931 | Ga0097620_100162159 | Ga0097620_1001621592 | 345 |
| 100 | 3300009098 | Ga0105245_10077253 | Ga0105245_100772532 | 345 |
| 101 | 3300009101 | Ga0105247_10153604 | Ga0105247_101536042 | 345 |
| 102 | 3300009148 | Ga0105243_10036812 | Ga0105243_100368124 | 345 |
| 103 | 3300025901 | Ga0207688_10036724 | Ga0207688_100367241 | 345 |
| 104 | 3300025918 | Ga0207662_10142185 | Ga0207662_101421852 | 345 |
| 105 | 3300025927 | Ga0207687_10029745 | Ga0207687_100297454 | 345 |
| 106 | 3300025928 | Ga0207700_10116807 | Ga0207700_101168072 | 345 |
| 107 | 3300025935 | Ga0207709_10019472 | Ga0207709_100194724 | 345 |
| 108 | 3300025942 | Ga0207689_10294118 | Ga0207689_102941181 | 345 |
| 109 | 3300026035 | Ga0207703_10123525 | Ga0207703_101235252 | 345 |
| 110 | 3300026116 | Ga0207674_10271814 | Ga0207674_102718141 | 345 |
| 111 | 3300026118 | Ga0207675_100024814 | Ga0207675_1000248144 | 345 |
| 112 | 3300035695 | Ga0373927_0001239 | Ga0373927_0001239_13036_14136 | 345 |
| 113 | 3300048924 | Ga0496121_0000013 | Ga0496121_0000013_313631_314824 | 345 |
| 114 | 3300009093 | Ga0105240_10000405 | Ga0105240_100004057 | 346 |
| 115 | 3300010375 | Ga0105239_10000070 | Ga0105239_1000007067 | 346 |
| 116 | 3300025913 | Ga0207695_10000609 | Ga0207695_100006097 | 346 |
| 117 | 3300048907 | Ga0496104_0027893 | Ga0496104_0027893_3162_4352 | 346 |
| 118 | 3300048908 | Ga0496105_0002435 | Ga0496105_0002435_5149_6339 | 346 |
| 119 | 3300048920 | Ga0496117_0002182 | Ga0496117_0002182_10836_12026 | 346 |
| 120 | 3300048920 | Ga0496117_0023067 | Ga0496117_0023067_412_1545 | 346 |
| 121 | 3300048921 | Ga0496118_0003446 | Ga0496118_0003446_9670_10860 | 346 |
| 122 | 3300048922 | Ga0496119_0000048 | Ga0496119_0000048_80937_82127 | 346 |
| 123 | 3300048923 | Ga0496120_0000133 | Ga0496120_0000133_21282_22472 | 346 |
| 124 | iso_pu_bacteria | 2899370129 | 2899374031 | 347 |
| 125 | 3300037466 | Ga0395898_0036896 | Ga0395898_0036896_896_2029 | 348 |
| 126 | 3300045976 | Ga0466967_0001114 | Ga0466967_0001114_6181_7416 | 348 |
| 127 | iso_pu_bacteria | 2965320100 | 2965321602 | 348 |
| 128 | 3300005339 | Ga0070660_100003803 | Ga0070660_1000038034 | 349 |
| 129 | 3300025919 | Ga0207657_10005776 | Ga0207657_100057764 | 349 |
| 130 | 3300031903 | Ga0307407_10015336 | Ga0307407_100153362 | 349 |
| 131 | 3300031911 | Ga0307412_10047062 | Ga0307412_100470622 | 349 |
| 132 | 3300031995 | Ga0307409_100060588 | Ga0307409_1000605882 | 349 |
| 133 | 3300037312 | Ga0395899_0010590 | Ga0395899_0010590_4735_5868 | 349 |
| 134 | 3300037466 | Ga0395898_0250919 | Ga0395898_0250919_371_1504 | 349 |
| 135 | 3300037471 | Ga0395905_0158379 | Ga0395905_0158379_871_2004 | 349 |
| 136 | 3300005327 | Ga0070658_10023990 | Ga0070658_100239902 | 350 |
| 137 | 3300005981 | Ga0081538_10035797 | Ga0081538_100357972 | 350 |
| 138 | 3300025909 | Ga0207705_10020900 | Ga0207705_100209002 | 350 |
| 139 | 3300037466 | Ga0395898_0005521 | Ga0395898_0005521_6509_7663 | 350 |
| 140 | 3300044694 | Ga0466963_0021620 | Ga0466963_0021620_816_2162 | 350 |
| 141 | 3300044765 | Ga0466970_0109303 | Ga0466970_0109303_318_1466 | 350 |
| 142 | 3300046455 | Ga0495603_0156194 | Ga0495603_0156194_21_1292 | 350 |
| 143 | 3300046476 | Ga0495662_0042020 | Ga0495662_0042020_242_1387 | 350 |
| 144 | 3300005466 | Ga0070685_10085447 | Ga0070685_100854471 | 352 |
| 145 | 3300005937 | Ga0081455_10003941 | Ga0081455_1000394111 | 352 |
| 146 | 3300005937 | Ga0081455_10041117 | Ga0081455_100411172 | 352 |
| 147 | 3300006844 | Ga0075428_100063526 | Ga0075428_1000635262 | 352 |
| 148 | 3300009094 | Ga0111539_10010692 | Ga0111539_100106924 | 352 |
| 149 | 3300009147 | Ga0114129_10095925 | Ga0114129_100959251 | 352 |
| 150 | 3300027907 | Ga0207428_10017712 | Ga0207428_100177125 | 352 |
| 151 | 3300031903 | Ga0307407_10047966 | Ga0307407_100479662 | 352 |
| 152 | 3300031995 | Ga0307409_100119662 | Ga0307409_1001196622 | 352 |
| 153 | 3300039437 | Ga0436365_0301130 | Ga0436365_0301130_1177_2310 | 352 |
| 154 | 3300044693 | Ga0466961_0097908 | Ga0466961_0097908_60_1184 | 352 |
| 155 | 3300044719 | Ga0466971_0110802 | Ga0466971_0110802_99_1223 | 352 |
| 156 | 3300045049 | Ga0466959_0091263 | Ga0466959_0091263_23_1147 | 352 |
| 157 | 3300049572 | Ga0501036_0090047 | Ga0501036_0090047_650_1792 | 352 |
| 158 | 3300049577 | Ga0501041_0012272 | Ga0501041_0012272_3198_4337 | 352 |
| 159 | 3300049588 | Ga0501072_0081967 | Ga0501072_0081967_238_1380 | 352 |
| 160 | 3300049590 | Ga0501074_0132093 | Ga0501074_0132093_566_1708 | 352 |
| 161 | 3300049824 | Ga0501045_0058689 | Ga0501045_0058689_1198_2340 | 352 |
| 162 | 3300050508 | nmdc:mga09592_127804_c1 | nmdc:mga09592_127804_c1_754_2061 | 352 |
| 163 | 3300053136 | Ga0500559_0003991 | Ga0500559_0003991_5467_6699 | 352 |
| 164 | 3300003373 | JGI25407J50210_10003719 | JGI25407J50210_100037193 | 353 |
| 165 | 3300005549 | Ga0070704_100010103 | Ga0070704_1000101035 | 353 |
| 166 | 3300005981 | Ga0081538_10000415 | Ga0081538_1000041529 | 353 |
| 167 | 3300005981 | Ga0081538_10014092 | Ga0081538_100140923 | 353 |
| 168 | 3300009147 | Ga0114129_10388366 | Ga0114129_103883662 | 353 |
| 169 | 3300013297 | Ga0157378_10071356 | Ga0157378_100713562 | 353 |
| 170 | 3300020070 | Ga0206356_11725725 | Ga0206356_117257252 | 353 |
| 171 | 3300044706 | Ga0466964_0056997 | Ga0466964_0056997_46_1287 | 353 |
| 172 | 3300045976 | Ga0466967_0012175 | Ga0466967_0012175_3242_4483 | 353 |
| 173 | 3300046459 | Ga0495629_0067889 | Ga0495629_0067889_1033_2385 | 353 |
| 174 | 3300049570 | Ga0501033_0111822 | Ga0501033_0111822_797_1969 | 353 |
| 175 | 3300049571 | Ga0501034_0051057 | Ga0501034_0051057_940_2112 | 353 |
| 176 | 3300049572 | Ga0501036_0052115 | Ga0501036_0052115_1283_2455 | 353 |
| 177 | 3300049573 | Ga0501037_0041480 | Ga0501037_0041480_1416_2588 | 353 |
| 178 | 3300049578 | Ga0501042_0014417 | Ga0501042_0014417_1837_3009 | 353 |
| 179 | 3300049579 | Ga0501043_0040387 | Ga0501043_0040387_545_1717 | 353 |
| 180 | 3300049580 | Ga0501046_0069868 | Ga0501046_0069868_520_1692 | 353 |
| 181 | 3300049582 | Ga0501048_0005980 | Ga0501048_0005980_8078_9250 | 353 |
| 182 | 3300049585 | Ga0501069_0012017 | Ga0501069_0012017_190_1362 | 353 |
| 183 | 3300049586 | Ga0501070_0027465 | Ga0501070_0027465_1240_2412 | 353 |
| 184 | 3300049587 | Ga0501071_0073448 | Ga0501071_0073448_1067_2239 | 353 |
| 185 | 3300049589 | Ga0501073_0001164 | Ga0501073_0001164_12993_14165 | 353 |
| 186 | 3300049590 | Ga0501074_0003566 | Ga0501074_0003566_162_1334 | 353 |
| 187 | 3300049742 | Ga0501080_0004965 | Ga0501080_0004965_1943_3115 | 353 |
| 188 | 3300049744 | Ga0501083_0037999 | Ga0501083_0037999_123_1295 | 353 |
| 189 | 3300049822 | Ga0501035_0032846 | Ga0501035_0032846_3035_4207 | 353 |
| 190 | 3300049823 | Ga0501044_0071066 | Ga0501044_0071066_1240_2412 | 353 |
| 191 | 3300054114 | Ga0501084_0143192 | Ga0501084_0143192_79_1251 | 353 |
| 192 | 3300060353 | Ga0501082_0010232 | Ga0501082_0010232_69_1241 | 353 |
| 193 | 3300031731 | Ga0307405_10235788 | Ga0307405_102357882 | 354 |
| 194 | 3300037418 | Ga0395900_0002796 | Ga0395900_0002796_2832_3989 | 354 |
| 195 | 3300037418 | Ga0395900_0051602 | Ga0395900_0051602_1445_2632 | 354 |
| 196 | 3300037466 | Ga0395898_0089667 | Ga0395898_0089667_1327_2484 | 354 |
| 197 | 3300037471 | Ga0395905_0017581 | Ga0395905_0017581_3770_4927 | 354 |
| 198 | 3300037471 | Ga0395905_0075500 | Ga0395905_0075500_380_1567 | 354 |
| 199 | 3300038443 | Ga0395901_0132467 | Ga0395901_0132467_849_2036 | 354 |
| 200 | 3300041413 | Ga0439465_0002191 | Ga0439465_0002191_13_1125 | 354 |
| 201 | 3300045976 | Ga0466967_0045980 | Ga0466967_0045980_1314_2630 | 354 |
| 202 | 3300046689 | Ga0495613_0017475 | Ga0495613_0017475_3175_4560 | 354 |
| 203 | 3300005338 | Ga0068868_100023728 | Ga0068868_1000237282 | 355 |
| 204 | 3300005615 | Ga0070702_100003238 | Ga0070702_1000032385 | 355 |
| 205 | 3300005718 | Ga0068866_10056025 | Ga0068866_100560252 | 355 |
| 206 | 3300009148 | Ga0105243_10021311 | Ga0105243_100213112 | 355 |
| 207 | 3300025927 | Ga0207687_10153829 | Ga0207687_101538292 | 355 |
| 208 | 3300025935 | Ga0207709_10082884 | Ga0207709_100828842 | 355 |
| 209 | 3300025981 | Ga0207640_10076209 | Ga0207640_100762092 | 355 |
| 210 | 3300026035 | Ga0207703_10061937 | Ga0207703_100619372 | 355 |
| 211 | 3300031995 | Ga0307409_100114860 | Ga0307409_1001148602 | 355 |
| 212 | 3300032004 | Ga0307414_10138108 | Ga0307414_101381082 | 355 |
| 213 | 3300048907 | Ga0496104_0268577 | Ga0496104_0268577_50_1327 | 355 |
| 214 | 3300033529 | Ga0316587_1008256 | Ga0316587_10082561 | 356 |
| 215 | 3300048903 | Ga0496100_0094476 | Ga0496100_0094476_152_1471 | 356 |
| 216 | 3300048904 | Ga0496101_0089491 | Ga0496101_0089491_42_1361 | 356 |
| 217 | 3300048911 | Ga0496108_0011152 | Ga0496108_0011152_3954_5273 | 356 |
| 218 | 3300048912 | Ga0496109_0063930 | Ga0496109_0063930_981_2300 | 356 |
| 219 | 3300048913 | Ga0496110_0020392 | Ga0496110_0020392_185_1504 | 356 |
| 220 | 3300003323 | rootH1_10176214 | rootH1_101762141 | 357 |
| 221 | 3300005719 | Ga0068861_100043420 | Ga0068861_1000434202 | 357 |
| 222 | 3300005842 | Ga0068858_100098566 | Ga0068858_1000985663 | 357 |
| 223 | 3300009174 | Ga0105241_10033797 | Ga0105241_100337972 | 357 |
| 224 | 3300009551 | Ga0105238_10088094 | Ga0105238_100880943 | 357 |
| 225 | 3300027312 | Ga0209371_1000023 | Ga0209371_1000023179 | 357 |
| 226 | 3300030500 | Ga0268256_1000023 | Ga0268256_1000023261 | 357 |
| 227 | 3300046471 | Ga0495650_0000074 | Ga0495650_0000074_208845_209978 | 357 |
| 228 | 3300046660 | Ga0495625_0022560 | Ga0495625_0022560_152_1285 | 357 |
| 229 | 3300048905 | Ga0496102_0035345 | Ga0496102_0035345_32_1288 | 357 |
| 230 | 3300048908 | Ga0496105_0028585 | Ga0496105_0028585_3004_4260 | 357 |
| 231 | 3300048909 | Ga0496106_0205249 | Ga0496106_0205249_54_1310 | 357 |
| 232 | 3300048910 | Ga0496107_0142997 | Ga0496107_0142997_21_1277 | 357 |
| 233 | 3300048911 | Ga0496108_0002572 | Ga0496108_0002572_5859_7115 | 357 |
| 234 | 3300048912 | Ga0496109_0005577 | Ga0496109_0005577_1378_2634 | 357 |
| 235 | 3300048914 | Ga0496111_0011094 | Ga0496111_0011094_21_1277 | 357 |
| 236 | 3300048915 | Ga0496112_0024424 | Ga0496112_0024424_4201_5457 | 357 |
| 237 | 3300048916 | Ga0496113_0078043 | Ga0496113_0078043_211_1467 | 357 |
| 238 | 3300005937 | Ga0081455_10158507 | Ga0081455_101585071 | 358 |
| 239 | 3300005983 | Ga0081540_1000481 | Ga0081540_100048110 | 358 |
| 240 | 3300005985 | Ga0081539_10038432 | Ga0081539_100384321 | 358 |
| 241 | 3300037418 | Ga0395900_0155911 | Ga0395900_0155911_71_1426 | 358 |
| 242 | 3300044694 | Ga0466963_0028725 | Ga0466963_0028725_434_1768 | 358 |
| 243 | 3300044694 | Ga0466963_0088097 | Ga0466963_0088097_437_1765 | 358 |
| 244 | 3300044842 | Ga0466957_0093783 | Ga0466957_0093783_500_1810 | 358 |
| 245 | 3300045976 | Ga0466967_0001674 | Ga0466967_0001674_10864_12210 | 358 |
| 246 | 3300045976 | Ga0466967_0127850 | Ga0466967_0127850_93_1421 | 358 |
| 247 | 3300059505 | Ga0587083_0010838 | Ga0587083_0010838_84_1463 | 359 |
| 248 | 3300003320 | rootH2_10000615 | rootH2_1000061574 | 360 |
| 249 | 3300003775 | Ga0055524_1023577 | Ga0055524_10235772 | 360 |
| 250 | 3300003775 | Ga0055524_1023601 | Ga0055524_10236012 | 360 |
| 251 | 3300003775 | Ga0055524_1025179 | Ga0055524_10251792 | 360 |
| 252 | 3300003781 | Ga0055536_1005909 | Ga0055536_10059093 | 360 |
| 253 | 3300003791 | Ga0055530_10001374 | Ga0055530_1000137411 | 360 |
| 254 | 3300003794 | Ga0055531_10002141 | Ga0055531_100021413 | 360 |
| 255 | 3300003794 | Ga0055531_10006000 | Ga0055531_100060005 | 360 |
| 256 | 3300003794 | Ga0055531_10007825 | Ga0055531_100078252 | 360 |
| 257 | 3300005327 | Ga0070658_10000615 | Ga0070658_1000061524 | 360 |
| 258 | 3300005335 | Ga0070666_10000023 | Ga0070666_10000023106 | 360 |
| 259 | 3300005347 | Ga0070668_100017107 | Ga0070668_1000171071 | 360 |
| 260 | 3300005367 | Ga0070667_100012820 | Ga0070667_1000128206 | 360 |
| 261 | 3300005456 | Ga0070678_100186305 | Ga0070678_1001863052 | 360 |
| 262 | 3300005842 | Ga0068858_100086448 | Ga0068858_1000864481 | 360 |
| 263 | 3300005843 | Ga0068860_100111452 | Ga0068860_1001114522 | 360 |
| 264 | 3300009551 | Ga0105238_10000331 | Ga0105238_1000033129 | 360 |
| 265 | 3300013306 | Ga0163162_10007941 | Ga0163162_100079415 | 360 |
| 266 | 3300025245 | Ga0207425_1019638 | Ga0207425_10196382 | 360 |
| 267 | 3300025291 | Ga0209675_1005379 | Ga0209675_10053793 | 360 |
| 268 | 3300025291 | Ga0209675_1024332 | Ga0209675_10243321 | 360 |
| 269 | 3300025292 | Ga0209676_1004138 | Ga0209676_10041385 | 360 |
| 270 | 3300025294 | Ga0209025_1000401 | Ga0209025_10004013 | 360 |
| 271 | 3300025297 | Ga0209758_1023928 | Ga0209758_10239284 | 360 |
| 272 | 3300025298 | Ga0209050_1002531 | Ga0209050_10025313 | 360 |
| 273 | 3300025298 | Ga0209050_1016892 | Ga0209050_10168922 | 360 |
| 274 | 3300025299 | Ga0209256_1003520 | Ga0209256_10035203 | 360 |
| 275 | 3300025299 | Ga0209256_1004386 | Ga0209256_10043862 | 360 |
| 276 | 3300025299 | Ga0209256_1020871 | Ga0209256_10208711 | 360 |
| 277 | 3300025303 | Ga0209051_1007871 | Ga0209051_10078715 | 360 |
| 278 | 3300025304 | Ga0209257_1000065 | Ga0209257_1000065205 | 360 |
| 279 | 3300025903 | Ga0207680_10000002 | Ga0207680_10000002102 | 360 |
| 280 | 3300025909 | Ga0207705_10024840 | Ga0207705_100248402 | 360 |
| 281 | 3300025924 | Ga0207694_10002097 | Ga0207694_1000209711 | 360 |
| 282 | 3300025972 | Ga0207668_10251581 | Ga0207668_102515811 | 360 |
| 283 | 3300026121 | Ga0207683_10110845 | Ga0207683_101108452 | 360 |
| 284 | 3300028379 | Ga0268266_10000004 | Ga0268266_10000004107 | 360 |
| 285 | 3300028381 | Ga0268264_10102392 | Ga0268264_101023922 | 360 |
| 286 | 3300042010 | Ga0439452_016973 | Ga0439452_016973_170_1315 | 360 |
| 287 | 3300048924 | Ga0496121_0039730 | Ga0496121_0039730_686_1828 | 360 |
| 288 | 3300048929 | Ga0496126_0205549 | Ga0496126_0205549_343_1485 | 360 |
| 289 | 3300049579 | Ga0501043_0016143 | Ga0501043_0016143_43_1188 | 360 |
| 290 | iso_pu_bacteria | 2928963466 | 2928966804 | 360 |
| 291 | iso_pu_bacteria | 8003014200 | 8003015643 | 360 |
| 292 | 3300005345 | Ga0070692_10001859 | Ga0070692_100018596 | 361 |
| 293 | 3300005457 | Ga0070662_100035262 | Ga0070662_1000352622 | 361 |
| 294 | 3300005614 | Ga0068856_100194824 | Ga0068856_1001948242 | 361 |
| 295 | 3300013307 | Ga0157372_10098028 | Ga0157372_100980283 | 361 |
| 296 | 3300015262 | Ga0182007_10010810 | Ga0182007_100108103 | 361 |
| 297 | 3300025904 | Ga0207647_10018415 | Ga0207647_100184155 | 361 |
| 298 | 3300025914 | Ga0207671_10199070 | Ga0207671_101990701 | 361 |
| 299 | 3300025919 | Ga0207657_10003748 | Ga0207657_100037489 | 361 |
| 300 | 3300025929 | Ga0207664_10000041 | Ga0207664_1000004144 | 361 |
| 301 | 3300025933 | Ga0207706_10008967 | Ga0207706_100089672 | 361 |
| 302 | 3300025949 | Ga0207667_10073400 | Ga0207667_100734001 | 361 |
| 303 | 3300026078 | Ga0207702_10154226 | Ga0207702_101542262 | 361 |
| 304 | iso_pu_bacteria | 2939611941 | 2939615299 | 361 |
| 305 | 3300039437 | Ga0436365_0354346 | Ga0436365_0354346_19555_20676 | 362 |
| 306 | iso_pu_bacteria | 2643221622 | 2644128249 | 362 |
| 307 | 3300005327 | Ga0070658_10000001 | Ga0070658_10000001413 | 363 |
| 308 | 3300005366 | Ga0070659_100005277 | Ga0070659_1000052777 | 363 |
| 309 | 3300005366 | Ga0070659_100015654 | Ga0070659_1000156544 | 363 |
| 310 | 3300013105 | Ga0157369_10016164 | Ga0157369_100161646 | 363 |
| 311 | 3300021384 | Ga0213876_10000123 | Ga0213876_1000012382 | 363 |
| 312 | 3300025909 | Ga0207705_10000002 | Ga0207705_100000021467 | 363 |
| 313 | 3300025932 | Ga0207690_10007084 | Ga0207690_100070845 | 363 |
| 314 | 3300025932 | Ga0207690_10014038 | Ga0207690_100140382 | 363 |
| 315 | 3300025972 | Ga0207668_10018005 | Ga0207668_100180055 | 363 |
| 316 | 3300002067 | JGI24735J21928_10000175 | JGI24735J21928_100001754 | 364 |
| 317 | 3300002737 | JGI25162J39368_1000734 | JGI25162J39368_100073410 | 364 |
| 318 | 3300003756 | Ga0055533_1002649 | Ga0055533_10026492 | 364 |
| 319 | 3300003762 | Ga0055542_1001209 | Ga0055542_100120910 | 364 |
| 320 | 3300005458 | Ga0070681_10103805 | Ga0070681_101038051 | 364 |
| 321 | 3300005466 | Ga0070685_10047093 | Ga0070685_100470931 | 364 |
| 322 | 3300013105 | Ga0157369_10193826 | Ga0157369_101938262 | 364 |
| 323 | 3300015687 | Ga0183368_1007 | Ga0183368_1007257 | 364 |
| 324 | 3300025225 | Ga0209566_102023 | Ga0209566_1020231 | 364 |
| 325 | 3300025226 | Ga0209674_100037 | Ga0209674_100037102 | 364 |
| 326 | 3300025231 | Ga0207427_101275 | Ga0207427_1012755 | 364 |
| 327 | 3300025233 | Ga0209437_100924 | Ga0209437_1009246 | 364 |
| 328 | 3300025242 | Ga0209258_101200 | Ga0209258_1012009 | 364 |
| 329 | 3300025250 | Ga0209026_1004778 | Ga0209026_10047782 | 364 |
| 330 | 3300025254 | Ga0209148_1000002 | Ga0209148_1000002398 | 364 |
| 331 | 3300025256 | Ga0209759_1001939 | Ga0209759_10019393 | 364 |
| 332 | 3300025261 | Ga0209233_1007306 | Ga0209233_10073062 | 364 |
| 333 | 3300025904 | Ga0207647_10005179 | Ga0207647_100051799 | 364 |
| 334 | 3300025912 | Ga0207707_10079261 | Ga0207707_100792612 | 364 |
| 335 | 3300038443 | Ga0395901_0016210 | Ga0395901_0016210_4211_5344 | 364 |
| 336 | 3300041410 | Ga0439461_0000461 | Ga0439461_0000461_2425_3573 | 364 |
| 337 | 3300041413 | Ga0439465_0001271 | Ga0439465_0001271_2244_3392 | 364 |
| 338 | 3300041997 | Ga0439431_0000186 | Ga0439431_0000186_10818_11966 | 364 |
| 339 | 3300042006 | Ga0439432_001115 | Ga0439432_001115_6144_7292 | 364 |
| 340 | 3300042015 | Ga0439462_0001159 | Ga0439462_0001159_3269_4417 | 364 |
| 341 | 3300046694 | Ga0495649_0001962 | Ga0495649_0001962_7997_9145 | 364 |
| 342 | 3300048907 | Ga0496104_0069072 | Ga0496104_0069072_1209_2357 | 364 |
| 343 | 3300048918 | Ga0496115_0000272 | Ga0496115_0000272_2708_3856 | 364 |
| 344 | 3300048918 | Ga0496115_0000603 | Ga0496115_0000603_9700_10848 | 364 |
| 345 | 3300048929 | Ga0496126_0025341 | Ga0496126_0025341_3967_5115 | 364 |
| 346 | 3300049460 | Ga0495682_0005889 | Ga0495682_0005889_145_1293 | 364 |
| 347 | 3300049571 | Ga0501034_0128030 | Ga0501034_0128030_649_1782 | 364 |
| 348 | 3300049579 | Ga0501043_0055900 | Ga0501043_0055900_1746_2879 | 364 |
| 349 | 3300049822 | Ga0501035_0027696 | Ga0501035_0027696_3885_5018 | 364 |
| 350 | 3300049823 | Ga0501044_0341518 | Ga0501044_0341518_109_1242 | 364 |
| 351 | 3300053134 | Ga0500658_0000477 | Ga0500658_0000477_2221_3372 | 364 |
| 352 | iso_pu_bacteria | 2739367700 | 2739733510 | 364 |
| 353 | 3300009093 | Ga0105240_10000113 | Ga0105240_1000011396 | 365 |
| 354 | 3300025913 | Ga0207695_10002090 | Ga0207695_1000209012 | 365 |
| 355 | 3300041406 | Ga0439439_0012178 | Ga0439439_0012178_794_1945 | 365 |
| 356 | 3300042010 | Ga0439452_029869 | Ga0439452_029869_119_1270 | 365 |
| 357 | 3300047470 | Ga0495681_0009970 | Ga0495681_0009970_2615_3766 | 365 |
| 358 | 3300048918 | Ga0496115_0034850 | Ga0496115_0034850_2137_3327 | 365 |
| 359 | 3300048921 | Ga0496118_0003175 | Ga0496118_0003175_17019_18209 | 365 |
| 360 | 3300048923 | Ga0496120_0000113 | Ga0496120_0000113_118779_119969 | 365 |
| 361 | 3300048929 | Ga0496126_0000240 | Ga0496126_0000240_99692_100882 | 365 |
| 362 | 3300053087 | Ga0500643_013036 | Ga0500643_013036_722_1873 | 365 |
| 363 | 3300053139 | Ga0500568_0026246 | Ga0500568_0026246_1069_2220 | 365 |
| 364 | iso_pu_bacteria | 2852653556 | 2852657286 | 365 |
| 365 | 3300000043 | ARcpr5yngRDRAFT_c003252 | ARcpr5yngRDRAFT_0032522 | 366 |
| 366 | 3300003773 | Ga0055537_1005315 | Ga0055537_10053153 | 366 |
| 367 | 3300003775 | Ga0055524_1000598 | Ga0055524_100059817 | 366 |
| 368 | 3300003791 | Ga0055530_10000131 | Ga0055530_100001314 | 366 |
| 369 | 3300003794 | Ga0055531_10000617 | Ga0055531_100006174 | 366 |
| 370 | 3300003794 | Ga0055531_10009889 | Ga0055531_100098895 | 366 |
| 371 | 3300025263 | Ga0209565_1000011 | Ga0209565_1000011622 | 366 |
| 372 | 3300025273 | Ga0209673_1005191 | Ga0209673_10051913 | 366 |
| 373 | 3300025291 | Ga0209675_1006509 | Ga0209675_10065094 | 366 |
| 374 | 3300025297 | Ga0209758_1019428 | Ga0209758_10194282 | 366 |
| 375 | 3300025298 | Ga0209050_1000347 | Ga0209050_100034722 | 366 |
| 376 | 3300025298 | Ga0209050_1010936 | Ga0209050_10109362 | 366 |
| 377 | 3300025299 | Ga0209256_1000851 | Ga0209256_10008514 | 366 |
| 378 | 3300025304 | Ga0209257_1000371 | Ga0209257_100037122 | 366 |
| 379 | 3300041410 | Ga0439461_0004873 | Ga0439461_0004873_30_1181 | 366 |
| 380 | 3300053094 | Ga0500566_0005015 | Ga0500566_0005015_803_1954 | 366 |
| 381 | iso_pu_bacteria | 2885429604 | 2885431022 | 366 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4rnl-assembly1.cif.gz_A | the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus | 0.9683 | 3 | 358 |
| 1so0-assembly4.cif.gz_D | crystal structure of human galactose mutarotase complexed with galactose | 0.9634 | 6 | 358 |
| 4rnl-assembly1.cif.gz_A | the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus | 0.9599 | 3 | 358 |
| 1so0-assembly4.cif.gz_D | crystal structure of human galactose mutarotase complexed with galactose | 0.9523 | 6 | 358 |
| 1lur-assembly2.cif.gz_B | crystal structure of the galm/aldose epimerase homologue from c. elegans, northeast structural genomics target wr66 | 0.9514 | 24 | 358 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4rnlC00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9688 | 6 | 358 | 2.70.98.10 |
| af_Q33AZ5_28_362_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9624 | 24 | 358 | 2.70.98.10 |
| af_I1KJ59_42_349_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9555 | 54 | 358 | 2.70.98.10 |
| 4rnlC00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9547 | 6 | 358 | 2.70.98.10 |
| af_P0A9C3_9_344_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.949 | 16 | 358 | 2.70.98.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520JGB0-F1-model_v4 | Galactose mutarotase | 0.9975 | 48 | 358 |
GO:0004034
GO:0005737 GO:0006006 GO:0030246 GO:0033499 |
| AF-A0A4Q2XIY9-F1-model_v4 | deleted | 0.9961 | 6 | 358 |
|
| AF-A0A4V2AQR7-F1-model_v4 | deleted | 0.992 | 1 | 326 |
|
| AF-A0A4Q2YZI2-F1-model_v4 | Aldose 1-epimerase (Galactose mutarotase) (Type-1 mutarotase) | 0.9917 | 1 | 239 |
GO:0004034
GO:0006006 GO:0030246 GO:0033499 |
| AF-T0H0Y2-F1-model_v4 | Aldose 1-epimerase (EC 5.1.3.3) | 0.9915 | 16 | 358 |
GO:0004034
GO:0005737 GO:0006006 GO:0030246 GO:0033499 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar