F429056

General Info

Members Datasets Scaffolds Average Seq Length
381 256 372 387

Family's Representative Sequence

Representative Sequence 3300046689|Ga0495613_0017475|Ga0495613_0017475_3175_4560
Length 451
Sequence MHHALRLSKRFVAIAAVSLLAIGTTAAVATSASGHRTHHRGPSSKSHGDHHVSFHNGGLSITSSPFGNLPMGVPNIPDGGAAVTKYTLSNKRGMTVSILDYGGIIQSLDVPDNRGHEANVTLGFANIDGYTNAAYLKSNPYFGAIIGRYGNRIANGKFSIPAQNGFPASGPFTVDINNGANTLHGGFTGYDKEMWKATPVPPSHGSVGLTLTGIRSGTAGEGCNPALNQGVGSPPNTCTTGYPGNLKVSVTFTLNNQNQLSFHYVATTDAPTVVNLTNHSYWNLSGEGSGTINDHLLQINANSFTPVDSGLIPTGVIQPVAGTPFDFTRFHAIGERLRGNDQQLVFGRGYDHNFVLNNPHPGNVAARLFDPASGRLLTILTDQPGLQFYSGNFLDGTLYGTSGRQYRQGDGLALETQHFPDSPNHANFPSTELDPGQTYDSTTVYGFSTVS

Samples

Sample ID Description Type Environment
1 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
2 2739367700 Dyella sp. YR388 Isolate Unclassified
3 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
4 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
5 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
6 2928963466 Dyella japonica 1073 Isolate Unclassified
7 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
8 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
9 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
132 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
139 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
153 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
154 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
157 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
158 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
246 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
247 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
248 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
249 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
250 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
251 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.33
Metatranscriptomes 1.31
Isolates 2.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.91
Nodule 0
Rhizoplane 6.82
Rhizosphere 72.44
Stem 0
Stem Tuber 0.26
Unclassified 6.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c003252 3300000043 Bacteria 1617
2 JGI24735J21928_10000175 3300002067 Bacteria 22763
3 JGI25162J39368_1000734 3300002737 Bacteria 22511
4 rootH2_10000615 3300003320 Bacteria 129558
5 rootH2_10015052 3300003320 Bacteria 12751
6 rootH1_10176214 3300003323 Bacteria 1611
7 JGI25407J50210_10003719 3300003373 Bacteria 3677
8 Ga0055533_1002649 3300003756 Bacteria 3972
9 Ga0055542_1001209 3300003762 Bacteria 14546
10 Ga0055537_1005315 3300003773 Bacteria 3479
11 Ga0055524_1000598 3300003775 Bacteria 26071
12 Ga0055524_1023577 3300003775 Bacteria 1978
13 Ga0055524_1023601 3300003775 Bacteria 1976
14 Ga0055524_1025179 3300003775 Bacteria 1869
15 Ga0055536_1005909 3300003781 Bacteria 5860
16 Ga0055530_10000131 3300003791 Bacteria 65535
17 Ga0055530_10001374 3300003791 Bacteria 18030
18 Ga0055530_10014649 3300003791 Bacteria 2600
19 Ga0055531_10000617 3300003794 Bacteria 30689
20 Ga0055531_10002141 3300003794 Bacteria 13509
21 Ga0055531_10006000 3300003794 Bacteria 6974
22 Ga0055531_10007825 3300003794 Bacteria 5753
23 Ga0055531_10009889 3300003794 Bacteria 4823
24 Ga0070658_10000001 3300005327 Bacteria 856789
25 Ga0070658_10000615 3300005327 Bacteria 30801
26 Ga0070658_10023990 3300005327 Bacteria 4895
27 Ga0070676_10034696 3300005328 Bacteria 2897
28 Ga0070666_10000023 3300005335 Bacteria 161603
29 Ga0068868_100023728 3300005338 Bacteria 4645
30 Ga0068868_100054916 3300005338 Bacteria 3141
31 Ga0070660_100003803 3300005339 Bacteria 10426
32 Ga0070660_100034163 3300005339 Bacteria 3840
33 Ga0070689_100005143 3300005340 Bacteria 8897
34 Ga0070687_100119697 3300005343 Bacteria 1504
35 Ga0070692_10001859 3300005345 Bacteria 7937
36 Ga0070668_100017107 3300005347 Bacteria 5427
37 Ga0070671_100295053 3300005355 Bacteria 1380
38 Ga0070659_100005277 3300005366 Bacteria 9273
39 Ga0070659_100015654 3300005366 Bacteria 5682
40 Ga0070667_100012820 3300005367 Bacteria 6927
41 Ga0070701_10084182 3300005438 Bacteria 1729
42 Ga0070678_100186305 3300005456 Bacteria 1703
43 Ga0070662_100035262 3300005457 Bacteria 3532
44 Ga0070681_10103805 3300005458 Bacteria 2786
45 Ga0070681_10374350 3300005458 Bacteria 1335
46 Ga0068867_100211783 3300005459 Bacteria 1557
47 Ga0070685_10047093 3300005466 Bacteria 2478
48 Ga0070685_10085447 3300005466 Bacteria 1900
49 Ga0070704_100010103 3300005549 Bacteria 5739
50 Ga0068856_100098544 3300005614 Bacteria 2913
51 Ga0068856_100194824 3300005614 Bacteria 2040
52 Ga0070702_100003238 3300005615 Bacteria 7246
53 Ga0070702_100008029 3300005615 Bacteria 5092
54 Ga0068859_100162174 3300005617 Bacteria 2315
55 Ga0068866_10056025 3300005718 Bacteria 2027
56 Ga0068861_100043420 3300005719 Bacteria 3375
57 Ga0068858_100086448 3300005842 Bacteria 2917
58 Ga0068858_100098566 3300005842 Bacteria 2725
59 Ga0068858_100103199 3300005842 Bacteria 2660
60 Ga0068860_100012948 3300005843 Bacteria 8193
61 Ga0068860_100111452 3300005843 Bacteria 2616
62 Ga0081455_10003941 3300005937 Bacteria 16879
63 Ga0081455_10041117 3300005937 Bacteria 4070
64 Ga0081455_10158507 3300005937 Bacteria 1737
65 Ga0081538_10000415 3300005981 Bacteria 48044
66 Ga0081538_10007113 3300005981 Bacteria 9720
67 Ga0081538_10014092 3300005981 Bacteria 6282
68 Ga0081538_10035797 3300005981 Bacteria 3254
69 Ga0081538_10043177 3300005981 Bacteria 2835
70 Ga0081540_1000481 3300005983 Bacteria 39044
71 Ga0081539_10038432 3300005985 Bacteria 2837
72 Ga0070716_100000005 3300006173 Bacteria 273485
73 Ga0070716_100000153 3300006173 Bacteria 27251
74 Ga0075428_100000098 3300006844 Bacteria 73177
75 Ga0075428_100063526 3300006844 Bacteria 4042
76 Ga0097620_100162159 3300006931 Bacteria 2315
77 Ga0105240_10000113 3300009093 Bacteria 168192
78 Ga0105240_10000405 3300009093 Bacteria 80014
79 Ga0111539_10001235 3300009094 Bacteria 34018
80 Ga0111539_10010692 3300009094 Bacteria 11556
81 Ga0105245_10077253 3300009098 Bacteria 3035
82 Ga0105247_10153604 3300009101 Bacteria 1519
83 Ga0114129_10095925 3300009147 Bacteria 4107
84 Ga0114129_10388366 3300009147 Bacteria 1842
85 Ga0105243_10021311 3300009148 Bacteria 4919
86 Ga0105243_10036812 3300009148 Bacteria 3800
87 Ga0105241_10033797 3300009174 Bacteria 3840
88 Ga0105242_10033483 3300009176 Bacteria 4114
89 Ga0105238_10000331 3300009551 Bacteria 51630
90 Ga0105238_10088094 3300009551 Bacteria 3091
91 Ga0105249_10020990 3300009553 Bacteria 5844
92 Ga0105239_10000070 3300010375 Bacteria 144044
93 Ga0157369_10016164 3300013105 Bacteria 8400
94 Ga0157369_10193826 3300013105 Bacteria 2134
95 Ga0157378_10071356 3300013297 Bacteria 3119
96 Ga0163162_10007941 3300013306 Bacteria 10347
97 Ga0157372_10098028 3300013307 Bacteria 3344
98 Ga0182006_1033846 3300015261 Bacteria 2047
99 Ga0182007_10010810 3300015262 Bacteria 3585
100 Ga0183368_1007 3300015687 Bacteria 405609
101 Ga0163161_10207392 3300017792 Bacteria 1513
102 Ga0206356_11725725 3300020070 Bacteria 1724
103 Ga0213876_10000123 3300021384 Bacteria 84497
104 Ga0224712_10056142 3300022467 Bacteria 1551
105 Ga0209566_102023 3300025225 Bacteria 4266
106 Ga0209674_100037 3300025226 Bacteria 404339
107 Ga0207427_101275 3300025231 Bacteria 9597
108 Ga0209437_100924 3300025233 Bacteria 11174
109 Ga0209258_101200 3300025242 Bacteria 10284
110 Ga0207425_1019638 3300025245 Bacteria 1452
111 Ga0209026_1004778 3300025250 Bacteria 3880
112 Ga0209148_1000002 3300025254 Bacteria 2399500
113 Ga0209759_1001939 3300025256 Bacteria 10058
114 Ga0209233_1007306 3300025261 Bacteria 3507
115 Ga0209565_1000011 3300025263 Bacteria 637062
116 Ga0209673_1005191 3300025273 Bacteria 6648
117 Ga0209675_1005379 3300025291 Bacteria 5376
118 Ga0209675_1006509 3300025291 Bacteria 4667
119 Ga0209675_1024332 3300025291 Bacteria 1549
120 Ga0209676_1004138 3300025292 Bacteria 8259
121 Ga0209025_1000401 3300025294 Bacteria 88709
122 Ga0209758_1019428 3300025297 Bacteria 3276
123 Ga0209758_1023928 3300025297 Bacteria 2742
124 Ga0209050_1000347 3300025298 Bacteria 90767
125 Ga0209050_1000986 3300025298 Bacteria 36241
126 Ga0209050_1002531 3300025298 Bacteria 15309
127 Ga0209050_1010936 3300025298 Bacteria 4387
128 Ga0209050_1016892 3300025298 Bacteria 2950
129 Ga0209256_1000851 3300025299 Bacteria 38114
130 Ga0209256_1003520 3300025299 Bacteria 10903
131 Ga0209256_1004386 3300025299 Bacteria 8910
132 Ga0209256_1020871 3300025299 Bacteria 2030
133 Ga0209051_1007871 3300025303 Bacteria 5748
134 Ga0209257_1000065 3300025304 Bacteria 353604
135 Ga0209257_1000371 3300025304 Bacteria 90767
136 Ga0207688_10036724 3300025901 Bacteria 2716
137 Ga0207680_10000002 3300025903 Bacteria 1018646
138 Ga0207647_10005179 3300025904 Bacteria 9593
139 Ga0207647_10018415 3300025904 Bacteria 4724
140 Ga0207705_10000002 3300025909 Bacteria 2046852
141 Ga0207705_10020900 3300025909 Bacteria 4671
142 Ga0207705_10024840 3300025909 Bacteria 4277
143 Ga0207707_10079261 3300025912 Bacteria 2868
144 Ga0207695_10000609 3300025913 Bacteria 71895
145 Ga0207695_10002090 3300025913 Bacteria 30400
146 Ga0207671_10199070 3300025914 Bacteria 1564
147 Ga0207693_10003521 3300025915 Bacteria 13366
148 Ga0207662_10142185 3300025918 Bacteria 1520
149 Ga0207657_10003748 3300025919 Bacteria 16154
150 Ga0207657_10005776 3300025919 Bacteria 12904
151 Ga0207657_10021303 3300025919 Bacteria 6104
152 Ga0207694_10002097 3300025924 Bacteria 16468
153 Ga0207650_10048614 3300025925 Bacteria 3129
154 Ga0207687_10029745 3300025927 Bacteria 3676
155 Ga0207687_10153829 3300025927 Bacteria 1758
156 Ga0207700_10116807 3300025928 Bacteria 2156
157 Ga0207664_10000041 3300025929 Bacteria 154806
158 Ga0207690_10007084 3300025932 Bacteria 6659
159 Ga0207690_10014038 3300025932 Bacteria 4829
160 Ga0207706_10008967 3300025933 Bacteria 9205
161 Ga0207709_10019472 3300025935 Bacteria 3817
162 Ga0207709_10082884 3300025935 Bacteria 2072
163 Ga0207665_10000012 3300025939 Bacteria 143062
164 Ga0207665_10000014 3300025939 Bacteria 137803
165 Ga0207689_10294118 3300025942 Bacteria 1345
166 Ga0207679_10224109 3300025945 Bacteria 1583
167 Ga0207667_10073400 3300025949 Bacteria 3555
168 Ga0207668_10018005 3300025972 Bacteria 4437
169 Ga0207668_10251581 3300025972 Bacteria 1435
170 Ga0207640_10076209 3300025981 Bacteria 2275
171 Ga0207703_10061937 3300026035 Bacteria 3064
172 Ga0207703_10123525 3300026035 Bacteria 2225
173 Ga0207702_10154226 3300026078 Bacteria 2092
174 Ga0207648_10263654 3300026089 Bacteria 1538
175 Ga0207674_10271814 3300026116 Bacteria 1642
176 Ga0207675_100024814 3300026118 Bacteria 5578
177 Ga0207683_10110845 3300026121 Bacteria 2457
178 Ga0209371_1000023 3300027312 Bacteria 519553
179 Ga0207428_10017712 3300027907 Bacteria 6109
180 Ga0207428_10026645 3300027907 Bacteria 4821
181 Ga0268266_10000004 3300028379 Bacteria 1495817
182 Ga0268264_10007451 3300028381 Bacteria 9132
183 Ga0268264_10102392 3300028381 Bacteria 2492
184 Ga0268256_1000023 3300030500 Bacteria 519631
185 Ga0265332_10014921 3300031238 Bacteria 3435
186 Ga0307405_10235788 3300031731 Bacteria 1352
187 Ga0307407_10015336 3300031903 Bacteria 3785
188 Ga0307407_10047966 3300031903 Bacteria 2428
189 Ga0307412_10047062 3300031911 Bacteria 2831
190 Ga0307409_100060588 3300031995 Bacteria 2952
191 Ga0307409_100114860 3300031995 Bacteria 2266
192 Ga0307409_100119662 3300031995 Bacteria 2227
193 Ga0307414_10138108 3300032004 Bacteria 1904
194 Ga0307507_10000073 3300033179 Bacteria 157894
195 Ga0316587_1008256 3300033529 Bacteria 1633
196 Ga0373953_0003953 3300035117 Bacteria 4672
197 Ga0373954_0058130 3300035118 Bacteria 1822
198 Ga0373927_0001239 3300035695 Bacteria 19386
199 Ga0373933_0064324 3300035724 Bacteria 2219
200 Ga0373933_0127181 3300035724 Bacteria 1600
201 Ga0373947_0021173 3300035725 Bacteria 3763
202 Ga0373937_0002986 3300036401 Bacteria 14172
203 Ga0395899_0010590 3300037312 Bacteria 7066
204 Ga0395900_0002796 3300037418 Bacteria 19064
205 Ga0395900_0051602 3300037418 Bacteria 4236
206 Ga0395900_0155911 3300037418 Bacteria 2332
207 Ga0395898_0005521 3300037466 Bacteria 13648
208 Ga0395898_0036896 3300037466 Bacteria 4851
209 Ga0395898_0089667 3300037466 Bacteria 2959
210 Ga0395898_0250919 3300037466 Bacteria 1687
211 Ga0395905_0017581 3300037471 Bacteria 6786
212 Ga0395905_0075500 3300037471 Bacteria 3159
213 Ga0395905_0158379 3300037471 Bacteria 2129
214 Ga0395901_0016210 3300038443 Bacteria 7590
215 Ga0395901_0132467 3300038443 Bacteria 2619
216 Ga0436365_0301130 3300039437 Bacteria 2369
217 Ga0436365_0354346 3300039437 Bacteria 23652
218 Ga0439439_0012178 3300041406 Bacteria 2078
219 Ga0439461_0000461 3300041410 Bacteria 5890
220 Ga0439461_0004873 3300041410 Bacteria 2262
221 Ga0439465_0001271 3300041413 Bacteria 8113
222 Ga0439465_0002191 3300041413 Bacteria 6404
223 Ga0439431_0000186 3300041997 Bacteria 12046
224 Ga0439432_001115 3300042006 Bacteria 10212
225 Ga0439452_016973 3300042010 Bacteria 1968
226 Ga0439452_029869 3300042010 Bacteria 1349
227 Ga0439462_0001159 3300042015 Bacteria 5738
228 Ga0466961_0097908 3300044693 Bacteria 1849
229 Ga0466963_0021620 3300044694 Bacteria 4062
230 Ga0466963_0028725 3300044694 Bacteria 3574
231 Ga0466963_0088097 3300044694 Bacteria 2111
232 Ga0466964_0056997 3300044706 Bacteria 1616
233 Ga0466971_0110802 3300044719 Bacteria 1266
234 Ga0466970_0109303 3300044765 Bacteria 1509
235 Ga0466957_0093783 3300044842 Bacteria 1884
236 Ga0466959_0091263 3300045049 Bacteria 2187
237 Ga0466967_0001114 3300045976 Bacteria 14905
238 Ga0466967_0001674 3300045976 Bacteria 13144
239 Ga0466967_0012175 3300045976 Bacteria 6564
240 Ga0466967_0045980 3300045976 Bacteria 3797
241 Ga0466967_0127850 3300045976 Bacteria 2355
242 Ga0466967_0473579 3300045976 Bacteria 1226
243 Ga0495592_0007992 3300046454 Bacteria 7936
244 Ga0495592_0031434 3300046454 Bacteria 4012
245 Ga0495603_0156194 3300046455 Bacteria 1324
246 Ga0495629_0067889 3300046459 Bacteria 2488
247 Ga0495651_0001227 3300046462 Bacteria 19826
248 Ga0495653_0013153 3300046463 Bacteria 6748
249 Ga0495650_0000074 3300046471 Bacteria 251346
250 Ga0495662_0003863 3300046476 Bacteria 7559
251 Ga0495662_0042020 3300046476 Bacteria 2206
252 Ga0495664_0001316 3300046477 Bacteria 13044
253 Ga0495664_0118717 3300046477 Bacteria 1599
254 Ga0495608_0003534 3300046511 Bacteria 11197
255 Ga0495618_0006274 3300046514 Bacteria 7216
256 Ga0495630_0004783 3300046517 Bacteria 9497
257 Ga0495652_0008370 3300046529 Bacteria 9447
258 Ga0495665_0048571 3300046531 Bacteria 2250
259 Ga0495640_0073702 3300046533 Bacteria 2285
260 Ga0495587_0005711 3300046536 Bacteria 8107
261 Ga0495587_0095646 3300046536 Bacteria 1714
262 Ga0495645_0001153 3300046543 Bacteria 17951
263 Ga0495667_0000751 3300046559 Bacteria 20850
264 Ga0495667_0032818 3300046559 Bacteria 3476
265 Ga0495634_0053577 3300046642 Bacteria 2702
266 Ga0495634_0084885 3300046642 Bacteria 2064
267 Ga0495625_0022560 3300046660 Bacteria 4824
268 Ga0495635_0005105 3300046663 Bacteria 9129
269 Ga0495635_0050663 3300046663 Bacteria 2862
270 Ga0495599_0004378 3300046678 Bacteria 8360
271 Ga0495599_0059719 3300046678 Bacteria 2385
272 Ga0495623_0021349 3300046679 Bacteria 4181
273 Ga0495613_0006389 3300046689 Bacteria 8808
274 Ga0495613_0017475 3300046689 Bacteria 5341
275 Ga0495649_0001962 3300046694 Bacteria 14916
276 Ga0495600_0044248 3300046809 Bacteria 2905
277 Ga0495604_0001726 3300047317 Bacteria 17932
278 Ga0495604_0076161 3300047317 Bacteria 2524
279 Ga0495674_0012170 3300047319 Bacteria 8109
280 Ga0495674_0207144 3300047319 Bacteria 1625
281 Ga0495680_0002166 3300047322 Bacteria 20327
282 Ga0495680_0118510 3300047322 Bacteria 1956
283 Ga0495675_0190273 3300047444 Bacteria 1253
284 Ga0495681_0009970 3300047470 Bacteria 5792
285 Ga0495684_0044937 3300047471 Bacteria 3380
286 Ga0495602_0008354 3300048088 Bacteria 10818
287 Ga0495602_0086838 3300048088 Bacteria 2610
288 Ga0496100_0031854 3300048903 Bacteria 3282
289 Ga0496100_0094476 3300048903 Bacteria 2048
290 Ga0496100_0451879 3300048903 Bacteria 985
291 Ga0496101_0089491 3300048904 Bacteria 2288
292 Ga0496102_0035345 3300048905 Bacteria 4497
293 Ga0496104_0023436 3300048907 Bacteria 5675
294 Ga0496104_0027893 3300048907 Bacteria 5228
295 Ga0496104_0069072 3300048907 Bacteria 3358
296 Ga0496104_0268577 3300048907 Bacteria 1618
297 Ga0496105_0002435 3300048908 Bacteria 13482
298 Ga0496105_0028585 3300048908 Bacteria 4559
299 Ga0496106_0205249 3300048909 Bacteria 1569
300 Ga0496107_0142997 3300048910 Bacteria 1768
301 Ga0496108_0002572 3300048911 Bacteria 14535
302 Ga0496108_0011152 3300048911 Bacteria 7304
303 Ga0496109_0005577 3300048912 Bacteria 10536
304 Ga0496109_0063930 3300048912 Bacteria 3366
305 Ga0496110_0020392 3300048913 Bacteria 5598
306 Ga0496111_0011094 3300048914 Bacteria 6064
307 Ga0496111_0106677 3300048914 Bacteria 2062
308 Ga0496112_0024424 3300048915 Bacteria 5787
309 Ga0496113_0078043 3300048916 Bacteria 2533
310 Ga0496115_0000272 3300048918 Bacteria 45410
311 Ga0496115_0000603 3300048918 Bacteria 27521
312 Ga0496115_0034850 3300048918 Bacteria 3979
313 Ga0496115_0050135 3300048918 Bacteria 3343
314 Ga0496117_0002182 3300048920 Bacteria 25529
315 Ga0496117_0023067 3300048920 Bacteria 4973
316 Ga0496118_0003175 3300048921 Bacteria 20997
317 Ga0496118_0003446 3300048921 Bacteria 19915
318 Ga0496119_0000048 3300048922 Bacteria 185846
319 Ga0496120_0000113 3300048923 Bacteria 136672
320 Ga0496120_0000133 3300048923 Bacteria 126194
321 Ga0496121_0000013 3300048924 Bacteria 614976
322 Ga0496121_0039730 3300048924 Bacteria 4139
323 Ga0496121_0144852 3300048924 Bacteria 1757
324 Ga0496126_0000240 3300048929 Bacteria 117890
325 Ga0496126_0025341 3300048929 Bacteria 5707
326 Ga0496126_0205549 3300048929 Bacteria 1660
327 Ga0495682_0005889 3300049460 Bacteria 5031
328 Ga0501033_0111822 3300049570 Bacteria 1987
329 Ga0501033_0171055 3300049570 Unclassified 1560
330 Ga0501034_0051057 3300049571 Bacteria 4170
331 Ga0501034_0128030 3300049571 Bacteria 2524
332 Ga0501036_0052115 3300049572 Bacteria 3465
333 Ga0501036_0090047 3300049572 Bacteria 2592
334 Ga0501037_0041480 3300049573 Bacteria 3384
335 Ga0501041_0012272 3300049577 Bacteria 5076
336 Ga0501042_0014417 3300049578 Bacteria 5395
337 Ga0501043_0016143 3300049579 Bacteria 5856
338 Ga0501043_0040387 3300049579 Bacteria 3666
339 Ga0501043_0055900 3300049579 Bacteria 3100
340 Ga0501046_0069868 3300049580 Bacteria 2731
341 Ga0501048_0005980 3300049582 Bacteria 9269
342 Ga0501069_0012017 3300049585 Bacteria 4596
343 Ga0501070_0027465 3300049586 Bacteria 4774
344 Ga0501071_0073448 3300049587 Bacteria 2495
345 Ga0501072_0081967 3300049588 Bacteria 2557
346 Ga0501073_0001164 3300049589 Bacteria 19195
347 Ga0501074_0003566 3300049590 Bacteria 11035
348 Ga0501074_0132093 3300049590 Bacteria 1786
349 Ga0501080_0004965 3300049742 Bacteria 11843
350 Ga0501083_0037999 3300049744 Bacteria 3274
351 Ga0501035_0005303 3300049822 Bacteria 12206
352 Ga0501035_0027696 3300049822 Bacteria 5179
353 Ga0501035_0032846 3300049822 Bacteria 4719
354 Ga0501044_0071066 3300049823 Bacteria 3539
355 Ga0501044_0341518 3300049823 Bacteria 1418
356 Ga0501045_0058689 3300049824 Bacteria 2818
357 nmdc:mga09592_127804_c1 3300050508 Bacteria 2185
358 nmdc:mga08y16_764_c1 3300050511 Bacteria 30613
359 Ga0495601_0058061 3300053077 Bacteria 2452
360 Ga0495595_0050495 3300053084 Bacteria 1926
361 Ga0495619_0002079 3300053085 Bacteria 13315
362 Ga0500643_013036 3300053087 Bacteria 2951
363 Ga0500566_0005015 3300053094 Bacteria 7888
364 Ga0500658_0000477 3300053134 Bacteria 17107
365 Ga0500559_0003991 3300053136 Bacteria 7093
366 Ga0500568_0026246 3300053139 Bacteria 2447
367 Ga0500588_0027723 3300053146 Bacteria 1599
368 Ga0500637_0033439 3300053178 Bacteria 2872
369 Ga0501084_0143192 3300054114 Bacteria 2013
370 Ga0587083_0010838 3300059505 Bacteria 1489
371 Ga0587075_005977 3300059644 Bacteria 1477
372 Ga0501082_0010232 3300060353 Bacteria 8075

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0451879 Ga0496100_0451879_22_972 306
2 3300005981 Ga0081538_10043177 Ga0081538_100431772 318
3 3300049570 Ga0501033_0171055 Ga0501033_0171055_94_1140 320
4 3300046531 Ga0495665_0048571 Ga0495665_0048571_488_1663 324
5 3300049822 Ga0501035_0005303 Ga0501035_0005303_4270_5367 328
6 3300047444 Ga0495675_0190273 Ga0495675_0190273_82_1095 330
7 3300035725 Ga0373947_0021173 Ga0373947_0021173_2417_3751 332
8 3300003791 Ga0055530_10014649 Ga0055530_100146493 333
9 3300025298 Ga0209050_1000986 Ga0209050_100098611 333
10 3300046477 Ga0495664_0001316 Ga0495664_0001316_1444_2616 335
11 3300046517 Ga0495630_0004783 Ga0495630_0004783_8024_9196 335
12 3300046536 Ga0495587_0095646 Ga0495587_0095646_529_1701 335
13 3300009176 Ga0105242_10033483 Ga0105242_100334834 336
14 3300017792 Ga0163161_10207392 Ga0163161_102073921 336
15 3300048924 Ga0496121_0144852 Ga0496121_0144852_242_1417 336
16 3300006173 Ga0070716_100000005 Ga0070716_10000000564 338
17 3300025939 Ga0207665_10000012 Ga0207665_1000001264 338
18 3300025915 Ga0207693_10003521 Ga0207693_100035215 339
19 3300035117 Ga0373953_0003953 Ga0373953_0003953_1257_2609 339
20 3300035724 Ga0373933_0064324 Ga0373933_0064324_835_2187 339
21 3300045976 Ga0466967_0473579 Ga0466967_0473579_11_1108 339
22 3300046454 Ga0495592_0031434 Ga0495592_0031434_2267_3619 339
23 3300046463 Ga0495653_0013153 Ga0495653_0013153_1525_2877 339
24 3300046477 Ga0495664_0118717 Ga0495664_0118717_90_1442 339
25 3300046511 Ga0495608_0003534 Ga0495608_0003534_4649_6001 339
26 3300046514 Ga0495618_0006274 Ga0495618_0006274_2155_3507 339
27 3300046559 Ga0495667_0000751 Ga0495667_0000751_5353_6705 339
28 3300046642 Ga0495634_0084885 Ga0495634_0084885_382_1734 339
29 3300046663 Ga0495635_0005105 Ga0495635_0005105_5260_6612 339
30 3300046678 Ga0495599_0059719 Ga0495599_0059719_434_1786 339
31 3300046679 Ga0495623_0021349 Ga0495623_0021349_1649_3001 339
32 3300047317 Ga0495604_0001726 Ga0495604_0001726_10376_11728 339
33 3300047322 Ga0495680_0002166 Ga0495680_0002166_7967_9319 339
34 3300048088 Ga0495602_0008354 Ga0495602_0008354_4231_5583 339
35 3300048907 Ga0496104_0023436 Ga0496104_0023436_3017_4363 339
36 3300048914 Ga0496111_0106677 Ga0496111_0106677_336_1682 339
37 3300053077 Ga0495601_0058061 Ga0495601_0058061_977_2329 339
38 3300005339 Ga0070660_100034163 Ga0070660_1000341633 340
39 3300005355 Ga0070671_100295053 Ga0070671_1002950531 340
40 3300005458 Ga0070681_10374350 Ga0070681_103743501 340
41 3300005843 Ga0068860_100012948 Ga0068860_1000129482 340
42 3300006844 Ga0075428_100000098 Ga0075428_10000009825 340
43 3300022467 Ga0224712_10056142 Ga0224712_100561421 340
44 3300025919 Ga0207657_10021303 Ga0207657_100213036 340
45 3300025945 Ga0207679_10224109 Ga0207679_102241092 340
46 3300027907 Ga0207428_10026645 Ga0207428_100266453 340
47 3300028381 Ga0268264_10007451 Ga0268264_100074512 340
48 3300036401 Ga0373937_0002986 Ga0373937_0002986_11088_12473 340
49 3300046462 Ga0495651_0001227 Ga0495651_0001227_11558_12943 340
50 3300046536 Ga0495587_0005711 Ga0495587_0005711_2031_3416 340
51 3300047319 Ga0495674_0012170 Ga0495674_0012170_2084_3469 340
52 3300048903 Ga0496100_0031854 Ga0496100_0031854_1438_2817 340
53 3300048918 Ga0496115_0050135 Ga0496115_0050135_1050_2429 340
54 3300053084 Ga0495595_0050495 Ga0495595_0050495_154_1539 340
55 3300053085 Ga0495619_0002079 Ga0495619_0002079_5713_7098 340
56 3300059644 Ga0587075_005977 Ga0587075_005977_85_1464 340
57 3300005340 Ga0070689_100005143 Ga0070689_1000051436 341
58 3300009094 Ga0111539_10001235 Ga0111539_1000123518 341
59 3300015261 Ga0182006_1033846 Ga0182006_10338461 341
60 3300035118 Ga0373954_0058130 Ga0373954_0058130_659_1789 341
61 3300035724 Ga0373933_0127181 Ga0373933_0127181_204_1334 341
62 3300046454 Ga0495592_0007992 Ga0495592_0007992_5599_6729 341
63 3300046476 Ga0495662_0003863 Ga0495662_0003863_5239_6369 341
64 3300046533 Ga0495640_0073702 Ga0495640_0073702_97_1227 341
65 3300046543 Ga0495645_0001153 Ga0495645_0001153_5086_6216 341
66 3300046559 Ga0495667_0032818 Ga0495667_0032818_1104_2237 341
67 3300046642 Ga0495634_0053577 Ga0495634_0053577_1531_2664 341
68 3300046663 Ga0495635_0050663 Ga0495635_0050663_771_1904 341
69 3300046678 Ga0495599_0004378 Ga0495599_0004378_5726_6856 341
70 3300046689 Ga0495613_0006389 Ga0495613_0006389_469_1599 341
71 3300046809 Ga0495600_0044248 Ga0495600_0044248_241_1371 341
72 3300047317 Ga0495604_0076161 Ga0495604_0076161_13_1146 341
73 3300047319 Ga0495674_0207144 Ga0495674_0207144_184_1314 341
74 3300047322 Ga0495680_0118510 Ga0495680_0118510_731_1861 341
75 3300047471 Ga0495684_0044937 Ga0495684_0044937_1709_2842 341
76 3300048088 Ga0495602_0086838 Ga0495602_0086838_1218_2348 341
77 3300050511 nmdc:mga08y16_764_c1 nmdc:mga08y16_764_c1_19338_20453 341
78 3300053146 Ga0500588_0027723 Ga0500588_0027723_71_1297 341
79 3300003320 rootH2_10015052 rootH2_100150527 342
80 3300005459 Ga0068867_100211783 Ga0068867_1002117831 342
81 3300025925 Ga0207650_10048614 Ga0207650_100486142 342
82 3300026089 Ga0207648_10263654 Ga0207648_102636542 342
83 3300033179 Ga0307507_10000073 Ga0307507_10000073125 342
84 3300046529 Ga0495652_0008370 Ga0495652_0008370_3307_4443 342
85 3300031238 Ga0265332_10014921 Ga0265332_100149212 343
86 3300005328 Ga0070676_10034696 Ga0070676_100346963 344
87 3300005981 Ga0081538_10007113 Ga0081538_100071135 344
88 3300006173 Ga0070716_100000153 Ga0070716_1000001537 344
89 3300009553 Ga0105249_10020990 Ga0105249_100209909 344
90 3300025939 Ga0207665_10000014 Ga0207665_1000001486 344
91 3300053178 Ga0500637_0033439 Ga0500637_0033439_1659_2846 344
92 3300005338 Ga0068868_100054916 Ga0068868_1000549163 345
93 3300005343 Ga0070687_100119697 Ga0070687_1001196972 345
94 3300005438 Ga0070701_10084182 Ga0070701_100841823 345
95 3300005614 Ga0068856_100098544 Ga0068856_1000985441 345
96 3300005615 Ga0070702_100008029 Ga0070702_1000080293 345
97 3300005617 Ga0068859_100162174 Ga0068859_1001621742 345
98 3300005842 Ga0068858_100103199 Ga0068858_1001031993 345
99 3300006931 Ga0097620_100162159 Ga0097620_1001621592 345
100 3300009098 Ga0105245_10077253 Ga0105245_100772532 345
101 3300009101 Ga0105247_10153604 Ga0105247_101536042 345
102 3300009148 Ga0105243_10036812 Ga0105243_100368124 345
103 3300025901 Ga0207688_10036724 Ga0207688_100367241 345
104 3300025918 Ga0207662_10142185 Ga0207662_101421852 345
105 3300025927 Ga0207687_10029745 Ga0207687_100297454 345
106 3300025928 Ga0207700_10116807 Ga0207700_101168072 345
107 3300025935 Ga0207709_10019472 Ga0207709_100194724 345
108 3300025942 Ga0207689_10294118 Ga0207689_102941181 345
109 3300026035 Ga0207703_10123525 Ga0207703_101235252 345
110 3300026116 Ga0207674_10271814 Ga0207674_102718141 345
111 3300026118 Ga0207675_100024814 Ga0207675_1000248144 345
112 3300035695 Ga0373927_0001239 Ga0373927_0001239_13036_14136 345
113 3300048924 Ga0496121_0000013 Ga0496121_0000013_313631_314824 345
114 3300009093 Ga0105240_10000405 Ga0105240_100004057 346
115 3300010375 Ga0105239_10000070 Ga0105239_1000007067 346
116 3300025913 Ga0207695_10000609 Ga0207695_100006097 346
117 3300048907 Ga0496104_0027893 Ga0496104_0027893_3162_4352 346
118 3300048908 Ga0496105_0002435 Ga0496105_0002435_5149_6339 346
119 3300048920 Ga0496117_0002182 Ga0496117_0002182_10836_12026 346
120 3300048920 Ga0496117_0023067 Ga0496117_0023067_412_1545 346
121 3300048921 Ga0496118_0003446 Ga0496118_0003446_9670_10860 346
122 3300048922 Ga0496119_0000048 Ga0496119_0000048_80937_82127 346
123 3300048923 Ga0496120_0000133 Ga0496120_0000133_21282_22472 346
124 iso_pu_bacteria 2899370129 2899374031 347
125 3300037466 Ga0395898_0036896 Ga0395898_0036896_896_2029 348
126 3300045976 Ga0466967_0001114 Ga0466967_0001114_6181_7416 348
127 iso_pu_bacteria 2965320100 2965321602 348
128 3300005339 Ga0070660_100003803 Ga0070660_1000038034 349
129 3300025919 Ga0207657_10005776 Ga0207657_100057764 349
130 3300031903 Ga0307407_10015336 Ga0307407_100153362 349
131 3300031911 Ga0307412_10047062 Ga0307412_100470622 349
132 3300031995 Ga0307409_100060588 Ga0307409_1000605882 349
133 3300037312 Ga0395899_0010590 Ga0395899_0010590_4735_5868 349
134 3300037466 Ga0395898_0250919 Ga0395898_0250919_371_1504 349
135 3300037471 Ga0395905_0158379 Ga0395905_0158379_871_2004 349
136 3300005327 Ga0070658_10023990 Ga0070658_100239902 350
137 3300005981 Ga0081538_10035797 Ga0081538_100357972 350
138 3300025909 Ga0207705_10020900 Ga0207705_100209002 350
139 3300037466 Ga0395898_0005521 Ga0395898_0005521_6509_7663 350
140 3300044694 Ga0466963_0021620 Ga0466963_0021620_816_2162 350
141 3300044765 Ga0466970_0109303 Ga0466970_0109303_318_1466 350
142 3300046455 Ga0495603_0156194 Ga0495603_0156194_21_1292 350
143 3300046476 Ga0495662_0042020 Ga0495662_0042020_242_1387 350
144 3300005466 Ga0070685_10085447 Ga0070685_100854471 352
145 3300005937 Ga0081455_10003941 Ga0081455_1000394111 352
146 3300005937 Ga0081455_10041117 Ga0081455_100411172 352
147 3300006844 Ga0075428_100063526 Ga0075428_1000635262 352
148 3300009094 Ga0111539_10010692 Ga0111539_100106924 352
149 3300009147 Ga0114129_10095925 Ga0114129_100959251 352
150 3300027907 Ga0207428_10017712 Ga0207428_100177125 352
151 3300031903 Ga0307407_10047966 Ga0307407_100479662 352
152 3300031995 Ga0307409_100119662 Ga0307409_1001196622 352
153 3300039437 Ga0436365_0301130 Ga0436365_0301130_1177_2310 352
154 3300044693 Ga0466961_0097908 Ga0466961_0097908_60_1184 352
155 3300044719 Ga0466971_0110802 Ga0466971_0110802_99_1223 352
156 3300045049 Ga0466959_0091263 Ga0466959_0091263_23_1147 352
157 3300049572 Ga0501036_0090047 Ga0501036_0090047_650_1792 352
158 3300049577 Ga0501041_0012272 Ga0501041_0012272_3198_4337 352
159 3300049588 Ga0501072_0081967 Ga0501072_0081967_238_1380 352
160 3300049590 Ga0501074_0132093 Ga0501074_0132093_566_1708 352
161 3300049824 Ga0501045_0058689 Ga0501045_0058689_1198_2340 352
162 3300050508 nmdc:mga09592_127804_c1 nmdc:mga09592_127804_c1_754_2061 352
163 3300053136 Ga0500559_0003991 Ga0500559_0003991_5467_6699 352
164 3300003373 JGI25407J50210_10003719 JGI25407J50210_100037193 353
165 3300005549 Ga0070704_100010103 Ga0070704_1000101035 353
166 3300005981 Ga0081538_10000415 Ga0081538_1000041529 353
167 3300005981 Ga0081538_10014092 Ga0081538_100140923 353
168 3300009147 Ga0114129_10388366 Ga0114129_103883662 353
169 3300013297 Ga0157378_10071356 Ga0157378_100713562 353
170 3300020070 Ga0206356_11725725 Ga0206356_117257252 353
171 3300044706 Ga0466964_0056997 Ga0466964_0056997_46_1287 353
172 3300045976 Ga0466967_0012175 Ga0466967_0012175_3242_4483 353
173 3300046459 Ga0495629_0067889 Ga0495629_0067889_1033_2385 353
174 3300049570 Ga0501033_0111822 Ga0501033_0111822_797_1969 353
175 3300049571 Ga0501034_0051057 Ga0501034_0051057_940_2112 353
176 3300049572 Ga0501036_0052115 Ga0501036_0052115_1283_2455 353
177 3300049573 Ga0501037_0041480 Ga0501037_0041480_1416_2588 353
178 3300049578 Ga0501042_0014417 Ga0501042_0014417_1837_3009 353
179 3300049579 Ga0501043_0040387 Ga0501043_0040387_545_1717 353
180 3300049580 Ga0501046_0069868 Ga0501046_0069868_520_1692 353
181 3300049582 Ga0501048_0005980 Ga0501048_0005980_8078_9250 353
182 3300049585 Ga0501069_0012017 Ga0501069_0012017_190_1362 353
183 3300049586 Ga0501070_0027465 Ga0501070_0027465_1240_2412 353
184 3300049587 Ga0501071_0073448 Ga0501071_0073448_1067_2239 353
185 3300049589 Ga0501073_0001164 Ga0501073_0001164_12993_14165 353
186 3300049590 Ga0501074_0003566 Ga0501074_0003566_162_1334 353
187 3300049742 Ga0501080_0004965 Ga0501080_0004965_1943_3115 353
188 3300049744 Ga0501083_0037999 Ga0501083_0037999_123_1295 353
189 3300049822 Ga0501035_0032846 Ga0501035_0032846_3035_4207 353
190 3300049823 Ga0501044_0071066 Ga0501044_0071066_1240_2412 353
191 3300054114 Ga0501084_0143192 Ga0501084_0143192_79_1251 353
192 3300060353 Ga0501082_0010232 Ga0501082_0010232_69_1241 353
193 3300031731 Ga0307405_10235788 Ga0307405_102357882 354
194 3300037418 Ga0395900_0002796 Ga0395900_0002796_2832_3989 354
195 3300037418 Ga0395900_0051602 Ga0395900_0051602_1445_2632 354
196 3300037466 Ga0395898_0089667 Ga0395898_0089667_1327_2484 354
197 3300037471 Ga0395905_0017581 Ga0395905_0017581_3770_4927 354
198 3300037471 Ga0395905_0075500 Ga0395905_0075500_380_1567 354
199 3300038443 Ga0395901_0132467 Ga0395901_0132467_849_2036 354
200 3300041413 Ga0439465_0002191 Ga0439465_0002191_13_1125 354
201 3300045976 Ga0466967_0045980 Ga0466967_0045980_1314_2630 354
202 3300046689 Ga0495613_0017475 Ga0495613_0017475_3175_4560 354
203 3300005338 Ga0068868_100023728 Ga0068868_1000237282 355
204 3300005615 Ga0070702_100003238 Ga0070702_1000032385 355
205 3300005718 Ga0068866_10056025 Ga0068866_100560252 355
206 3300009148 Ga0105243_10021311 Ga0105243_100213112 355
207 3300025927 Ga0207687_10153829 Ga0207687_101538292 355
208 3300025935 Ga0207709_10082884 Ga0207709_100828842 355
209 3300025981 Ga0207640_10076209 Ga0207640_100762092 355
210 3300026035 Ga0207703_10061937 Ga0207703_100619372 355
211 3300031995 Ga0307409_100114860 Ga0307409_1001148602 355
212 3300032004 Ga0307414_10138108 Ga0307414_101381082 355
213 3300048907 Ga0496104_0268577 Ga0496104_0268577_50_1327 355
214 3300033529 Ga0316587_1008256 Ga0316587_10082561 356
215 3300048903 Ga0496100_0094476 Ga0496100_0094476_152_1471 356
216 3300048904 Ga0496101_0089491 Ga0496101_0089491_42_1361 356
217 3300048911 Ga0496108_0011152 Ga0496108_0011152_3954_5273 356
218 3300048912 Ga0496109_0063930 Ga0496109_0063930_981_2300 356
219 3300048913 Ga0496110_0020392 Ga0496110_0020392_185_1504 356
220 3300003323 rootH1_10176214 rootH1_101762141 357
221 3300005719 Ga0068861_100043420 Ga0068861_1000434202 357
222 3300005842 Ga0068858_100098566 Ga0068858_1000985663 357
223 3300009174 Ga0105241_10033797 Ga0105241_100337972 357
224 3300009551 Ga0105238_10088094 Ga0105238_100880943 357
225 3300027312 Ga0209371_1000023 Ga0209371_1000023179 357
226 3300030500 Ga0268256_1000023 Ga0268256_1000023261 357
227 3300046471 Ga0495650_0000074 Ga0495650_0000074_208845_209978 357
228 3300046660 Ga0495625_0022560 Ga0495625_0022560_152_1285 357
229 3300048905 Ga0496102_0035345 Ga0496102_0035345_32_1288 357
230 3300048908 Ga0496105_0028585 Ga0496105_0028585_3004_4260 357
231 3300048909 Ga0496106_0205249 Ga0496106_0205249_54_1310 357
232 3300048910 Ga0496107_0142997 Ga0496107_0142997_21_1277 357
233 3300048911 Ga0496108_0002572 Ga0496108_0002572_5859_7115 357
234 3300048912 Ga0496109_0005577 Ga0496109_0005577_1378_2634 357
235 3300048914 Ga0496111_0011094 Ga0496111_0011094_21_1277 357
236 3300048915 Ga0496112_0024424 Ga0496112_0024424_4201_5457 357
237 3300048916 Ga0496113_0078043 Ga0496113_0078043_211_1467 357
238 3300005937 Ga0081455_10158507 Ga0081455_101585071 358
239 3300005983 Ga0081540_1000481 Ga0081540_100048110 358
240 3300005985 Ga0081539_10038432 Ga0081539_100384321 358
241 3300037418 Ga0395900_0155911 Ga0395900_0155911_71_1426 358
242 3300044694 Ga0466963_0028725 Ga0466963_0028725_434_1768 358
243 3300044694 Ga0466963_0088097 Ga0466963_0088097_437_1765 358
244 3300044842 Ga0466957_0093783 Ga0466957_0093783_500_1810 358
245 3300045976 Ga0466967_0001674 Ga0466967_0001674_10864_12210 358
246 3300045976 Ga0466967_0127850 Ga0466967_0127850_93_1421 358
247 3300059505 Ga0587083_0010838 Ga0587083_0010838_84_1463 359
248 3300003320 rootH2_10000615 rootH2_1000061574 360
249 3300003775 Ga0055524_1023577 Ga0055524_10235772 360
250 3300003775 Ga0055524_1023601 Ga0055524_10236012 360
251 3300003775 Ga0055524_1025179 Ga0055524_10251792 360
252 3300003781 Ga0055536_1005909 Ga0055536_10059093 360
253 3300003791 Ga0055530_10001374 Ga0055530_1000137411 360
254 3300003794 Ga0055531_10002141 Ga0055531_100021413 360
255 3300003794 Ga0055531_10006000 Ga0055531_100060005 360
256 3300003794 Ga0055531_10007825 Ga0055531_100078252 360
257 3300005327 Ga0070658_10000615 Ga0070658_1000061524 360
258 3300005335 Ga0070666_10000023 Ga0070666_10000023106 360
259 3300005347 Ga0070668_100017107 Ga0070668_1000171071 360
260 3300005367 Ga0070667_100012820 Ga0070667_1000128206 360
261 3300005456 Ga0070678_100186305 Ga0070678_1001863052 360
262 3300005842 Ga0068858_100086448 Ga0068858_1000864481 360
263 3300005843 Ga0068860_100111452 Ga0068860_1001114522 360
264 3300009551 Ga0105238_10000331 Ga0105238_1000033129 360
265 3300013306 Ga0163162_10007941 Ga0163162_100079415 360
266 3300025245 Ga0207425_1019638 Ga0207425_10196382 360
267 3300025291 Ga0209675_1005379 Ga0209675_10053793 360
268 3300025291 Ga0209675_1024332 Ga0209675_10243321 360
269 3300025292 Ga0209676_1004138 Ga0209676_10041385 360
270 3300025294 Ga0209025_1000401 Ga0209025_10004013 360
271 3300025297 Ga0209758_1023928 Ga0209758_10239284 360
272 3300025298 Ga0209050_1002531 Ga0209050_10025313 360
273 3300025298 Ga0209050_1016892 Ga0209050_10168922 360
274 3300025299 Ga0209256_1003520 Ga0209256_10035203 360
275 3300025299 Ga0209256_1004386 Ga0209256_10043862 360
276 3300025299 Ga0209256_1020871 Ga0209256_10208711 360
277 3300025303 Ga0209051_1007871 Ga0209051_10078715 360
278 3300025304 Ga0209257_1000065 Ga0209257_1000065205 360
279 3300025903 Ga0207680_10000002 Ga0207680_10000002102 360
280 3300025909 Ga0207705_10024840 Ga0207705_100248402 360
281 3300025924 Ga0207694_10002097 Ga0207694_1000209711 360
282 3300025972 Ga0207668_10251581 Ga0207668_102515811 360
283 3300026121 Ga0207683_10110845 Ga0207683_101108452 360
284 3300028379 Ga0268266_10000004 Ga0268266_10000004107 360
285 3300028381 Ga0268264_10102392 Ga0268264_101023922 360
286 3300042010 Ga0439452_016973 Ga0439452_016973_170_1315 360
287 3300048924 Ga0496121_0039730 Ga0496121_0039730_686_1828 360
288 3300048929 Ga0496126_0205549 Ga0496126_0205549_343_1485 360
289 3300049579 Ga0501043_0016143 Ga0501043_0016143_43_1188 360
290 iso_pu_bacteria 2928963466 2928966804 360
291 iso_pu_bacteria 8003014200 8003015643 360
292 3300005345 Ga0070692_10001859 Ga0070692_100018596 361
293 3300005457 Ga0070662_100035262 Ga0070662_1000352622 361
294 3300005614 Ga0068856_100194824 Ga0068856_1001948242 361
295 3300013307 Ga0157372_10098028 Ga0157372_100980283 361
296 3300015262 Ga0182007_10010810 Ga0182007_100108103 361
297 3300025904 Ga0207647_10018415 Ga0207647_100184155 361
298 3300025914 Ga0207671_10199070 Ga0207671_101990701 361
299 3300025919 Ga0207657_10003748 Ga0207657_100037489 361
300 3300025929 Ga0207664_10000041 Ga0207664_1000004144 361
301 3300025933 Ga0207706_10008967 Ga0207706_100089672 361
302 3300025949 Ga0207667_10073400 Ga0207667_100734001 361
303 3300026078 Ga0207702_10154226 Ga0207702_101542262 361
304 iso_pu_bacteria 2939611941 2939615299 361
305 3300039437 Ga0436365_0354346 Ga0436365_0354346_19555_20676 362
306 iso_pu_bacteria 2643221622 2644128249 362
307 3300005327 Ga0070658_10000001 Ga0070658_10000001413 363
308 3300005366 Ga0070659_100005277 Ga0070659_1000052777 363
309 3300005366 Ga0070659_100015654 Ga0070659_1000156544 363
310 3300013105 Ga0157369_10016164 Ga0157369_100161646 363
311 3300021384 Ga0213876_10000123 Ga0213876_1000012382 363
312 3300025909 Ga0207705_10000002 Ga0207705_100000021467 363
313 3300025932 Ga0207690_10007084 Ga0207690_100070845 363
314 3300025932 Ga0207690_10014038 Ga0207690_100140382 363
315 3300025972 Ga0207668_10018005 Ga0207668_100180055 363
316 3300002067 JGI24735J21928_10000175 JGI24735J21928_100001754 364
317 3300002737 JGI25162J39368_1000734 JGI25162J39368_100073410 364
318 3300003756 Ga0055533_1002649 Ga0055533_10026492 364
319 3300003762 Ga0055542_1001209 Ga0055542_100120910 364
320 3300005458 Ga0070681_10103805 Ga0070681_101038051 364
321 3300005466 Ga0070685_10047093 Ga0070685_100470931 364
322 3300013105 Ga0157369_10193826 Ga0157369_101938262 364
323 3300015687 Ga0183368_1007 Ga0183368_1007257 364
324 3300025225 Ga0209566_102023 Ga0209566_1020231 364
325 3300025226 Ga0209674_100037 Ga0209674_100037102 364
326 3300025231 Ga0207427_101275 Ga0207427_1012755 364
327 3300025233 Ga0209437_100924 Ga0209437_1009246 364
328 3300025242 Ga0209258_101200 Ga0209258_1012009 364
329 3300025250 Ga0209026_1004778 Ga0209026_10047782 364
330 3300025254 Ga0209148_1000002 Ga0209148_1000002398 364
331 3300025256 Ga0209759_1001939 Ga0209759_10019393 364
332 3300025261 Ga0209233_1007306 Ga0209233_10073062 364
333 3300025904 Ga0207647_10005179 Ga0207647_100051799 364
334 3300025912 Ga0207707_10079261 Ga0207707_100792612 364
335 3300038443 Ga0395901_0016210 Ga0395901_0016210_4211_5344 364
336 3300041410 Ga0439461_0000461 Ga0439461_0000461_2425_3573 364
337 3300041413 Ga0439465_0001271 Ga0439465_0001271_2244_3392 364
338 3300041997 Ga0439431_0000186 Ga0439431_0000186_10818_11966 364
339 3300042006 Ga0439432_001115 Ga0439432_001115_6144_7292 364
340 3300042015 Ga0439462_0001159 Ga0439462_0001159_3269_4417 364
341 3300046694 Ga0495649_0001962 Ga0495649_0001962_7997_9145 364
342 3300048907 Ga0496104_0069072 Ga0496104_0069072_1209_2357 364
343 3300048918 Ga0496115_0000272 Ga0496115_0000272_2708_3856 364
344 3300048918 Ga0496115_0000603 Ga0496115_0000603_9700_10848 364
345 3300048929 Ga0496126_0025341 Ga0496126_0025341_3967_5115 364
346 3300049460 Ga0495682_0005889 Ga0495682_0005889_145_1293 364
347 3300049571 Ga0501034_0128030 Ga0501034_0128030_649_1782 364
348 3300049579 Ga0501043_0055900 Ga0501043_0055900_1746_2879 364
349 3300049822 Ga0501035_0027696 Ga0501035_0027696_3885_5018 364
350 3300049823 Ga0501044_0341518 Ga0501044_0341518_109_1242 364
351 3300053134 Ga0500658_0000477 Ga0500658_0000477_2221_3372 364
352 iso_pu_bacteria 2739367700 2739733510 364
353 3300009093 Ga0105240_10000113 Ga0105240_1000011396 365
354 3300025913 Ga0207695_10002090 Ga0207695_1000209012 365
355 3300041406 Ga0439439_0012178 Ga0439439_0012178_794_1945 365
356 3300042010 Ga0439452_029869 Ga0439452_029869_119_1270 365
357 3300047470 Ga0495681_0009970 Ga0495681_0009970_2615_3766 365
358 3300048918 Ga0496115_0034850 Ga0496115_0034850_2137_3327 365
359 3300048921 Ga0496118_0003175 Ga0496118_0003175_17019_18209 365
360 3300048923 Ga0496120_0000113 Ga0496120_0000113_118779_119969 365
361 3300048929 Ga0496126_0000240 Ga0496126_0000240_99692_100882 365
362 3300053087 Ga0500643_013036 Ga0500643_013036_722_1873 365
363 3300053139 Ga0500568_0026246 Ga0500568_0026246_1069_2220 365
364 iso_pu_bacteria 2852653556 2852657286 365
365 3300000043 ARcpr5yngRDRAFT_c003252 ARcpr5yngRDRAFT_0032522 366
366 3300003773 Ga0055537_1005315 Ga0055537_10053153 366
367 3300003775 Ga0055524_1000598 Ga0055524_100059817 366
368 3300003791 Ga0055530_10000131 Ga0055530_100001314 366
369 3300003794 Ga0055531_10000617 Ga0055531_100006174 366
370 3300003794 Ga0055531_10009889 Ga0055531_100098895 366
371 3300025263 Ga0209565_1000011 Ga0209565_1000011622 366
372 3300025273 Ga0209673_1005191 Ga0209673_10051913 366
373 3300025291 Ga0209675_1006509 Ga0209675_10065094 366
374 3300025297 Ga0209758_1019428 Ga0209758_10194282 366
375 3300025298 Ga0209050_1000347 Ga0209050_100034722 366
376 3300025298 Ga0209050_1010936 Ga0209050_10109362 366
377 3300025299 Ga0209256_1000851 Ga0209256_10008514 366
378 3300025304 Ga0209257_1000371 Ga0209257_100037122 366
379 3300041410 Ga0439461_0004873 Ga0439461_0004873_30_1181 366
380 3300053094 Ga0500566_0005015 Ga0500566_0005015_803_1954 366
381 iso_pu_bacteria 2885429604 2885431022 366

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01263

Aldose_epim

Aldose 1-epimerase

84

446

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rnl-assembly1.cif.gz_A the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus 0.9683 3 358
1so0-assembly4.cif.gz_D crystal structure of human galactose mutarotase complexed with galactose 0.9634 6 358
4rnl-assembly1.cif.gz_A the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus 0.9599 3 358
1so0-assembly4.cif.gz_D crystal structure of human galactose mutarotase complexed with galactose 0.9523 6 358
1lur-assembly2.cif.gz_B crystal structure of the galm/aldose epimerase homologue from c. elegans, northeast structural genomics target wr66 0.9514 24 358
ID Description Score Start End Superfamily
4rnlC00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9688 6 358 2.70.98.10
af_Q33AZ5_28_362_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9624 24 358 2.70.98.10
af_I1KJ59_42_349_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9555 54 358 2.70.98.10
4rnlC00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9547 6 358 2.70.98.10
af_P0A9C3_9_344_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.949 16 358 2.70.98.10
ID Description Score Start End GO Terms
AF-A0A520JGB0-F1-model_v4 Galactose mutarotase 0.9975 48 358 GO:0004034
GO:0005737
GO:0006006
GO:0030246
GO:0033499
AF-A0A4Q2XIY9-F1-model_v4 deleted 0.9961 6 358
AF-A0A4V2AQR7-F1-model_v4 deleted 0.992 1 326
AF-A0A4Q2YZI2-F1-model_v4 Aldose 1-epimerase (Galactose mutarotase) (Type-1 mutarotase) 0.9917 1 239 GO:0004034
GO:0006006
GO:0030246
GO:0033499
AF-T0H0Y2-F1-model_v4 Aldose 1-epimerase (EC 5.1.3.3) 0.9915 16 358 GO:0004034
GO:0005737
GO:0006006
GO:0030246
GO:0033499

Feature Viewer

pLDDT pTM Quality
94.26 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map