F429053

General Info

Members Datasets Scaffolds Average Seq Length
381 234 363 357

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0000099|Ga0495633_0000099_35543_36727
Length 394
Sequence VYYPVLISVGDSLLLAKKVLSSRKFLKMALQVGIVGLPNVGKSTLFNAVSNSAKAQASNYRFCTIEPNVGLVDVPDERLSKLEELVNPERVVPTTIEFVDIAGLVKGASKGEGLGNKFLANIREVDAIVHVIRCFEDDNILREEGAINPVSDKEIIDTELQLKDLESVEKKIARSEKMAKTGGDPKAKREFEVLKQCQEHLEKGKNIRELGLSKEDRTAIADLFLLTEKPVLYVGNVDEASMLTGNKYSQQLQESVKAEGATVIVMNNSIEAQISELEDIADKELFLSEYNLTEPGLNRLIRSAYNLLNLITYFTAGVQEVRAWTIHTGWKAPQAASVIHTDFEKGFIKAEVIGYEDYVKYGSETACRDNGRLRIEGKEYVVSDGDVMHFRFNV

Samples

Sample ID Description Type Environment
1 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
5 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
6 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
7 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
8 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
9 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
10 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
11 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
12 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
13 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
14 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
15 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
16 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
17 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
18 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
145 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
146 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
147 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
148 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
202 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
222 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
223 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
224 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
225 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
226 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
227 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
228 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
234 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.01
Metatranscriptomes 0.26
Isolates 4.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.97
Nodule 0
Rhizoplane 3.67
Rhizosphere 79.27
Stem 0
Stem Tuber 0
Unclassified 7.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1005480 3300002739 Bacteria 1862
2 JGI25151J46595_10000157 3300003187 Bacteria 88566
3 JGI25153J46596_10016889 3300003215 Bacteria 2900
4 rootL2_10006007 3300003322 Bacteria 9320
5 rootL2_10217083 3300003322 Bacteria 1844
6 JGI25160J50197_1007946 3300003354 Bacteria 4085
7 JGI25160J50197_1012343 3300003354 Bacteria 2971
8 JGI25407J50210_10003671 3300003373 Bacteria 3693
9 JGI25407J50210_10014625 3300003373 Bacteria 2023
10 Ga0055535_1003643 3300003761 Bacteria 4207
11 Ga0055542_1011233 3300003762 Bacteria 1598
12 Ga0055526_1017584 3300003771 Bacteria 2724
13 Ga0055528_1001068 3300003790 Bacteria 18074
14 Ga0055531_10000032 3300003794 Bacteria 154432
15 Ga0065165_1000355 3300005262 Bacteria 75282
16 Ga0065712_10154517 3300005290 Bacteria 1345
17 Ga0070658_10073980 3300005327 Bacteria 2795
18 Ga0070676_10002151 3300005328 Bacteria 10034
19 Ga0070676_10054024 3300005328 Bacteria 2367
20 Ga0070683_100027860 3300005329 Bacteria 5100
21 Ga0070683_100084249 3300005329 Bacteria 2979
22 Ga0070670_100069447 3300005331 Bacteria 3024
23 Ga0070677_10000006 3300005333 Bacteria 75244
24 Ga0070660_100281497 3300005339 Bacteria 1361
25 Ga0070691_10024541 3300005341 Bacteria 2802
26 Ga0070661_100123796 3300005344 Bacteria 1938
27 Ga0070674_100000011 3300005356 Bacteria 134886
28 Ga0070673_100240635 3300005364 Bacteria 1573
29 Ga0070659_100100573 3300005366 Bacteria 2327
30 Ga0070714_100001655 3300005435 Bacteria 16210
31 Ga0070681_10004493 3300005458 Bacteria 13306
32 Ga0068867_100009892 3300005459 Bacteria 6719
33 Ga0068867_100036589 3300005459 Bacteria 3565
34 Ga0068867_100044229 3300005459 Bacteria 3261
35 Ga0070706_100027454 3300005467 Bacteria 5239
36 Ga0070707_100000095 3300005468 Bacteria 79610
37 Ga0070707_100028269 3300005468 Bacteria 5335
38 Ga0070698_100390047 3300005471 Bacteria 1325
39 Ga0070699_100014850 3300005518 Bacteria 6696
40 Ga0070684_100046541 3300005535 Bacteria 3759
41 Ga0070697_100045280 3300005536 Bacteria 3566
42 Ga0068853_100017482 3300005539 Bacteria 5918
43 Ga0070693_100000398 3300005547 Bacteria 19763
44 Ga0068855_100000454 3300005563 Bacteria 50341
45 Ga0068854_100146315 3300005578 Bacteria 1818
46 Ga0068856_100010700 3300005614 Bacteria 8912
47 Ga0068856_100044714 3300005614 Bacteria 4359
48 Ga0068856_100048419 3300005614 Bacteria 4189
49 Ga0068852_100183401 3300005616 Bacteria 1970
50 Ga0068864_100266955 3300005618 Bacteria 1593
51 Ga0068863_100000042 3300005841 Bacteria 154459
52 Ga0068858_100353242 3300005842 Bacteria 1408
53 Ga0081455_10000903 3300005937 Bacteria 38277
54 Ga0081455_10005645 3300005937 Bacteria 13666
55 Ga0081455_10045675 3300005937 Bacteria 3808
56 Ga0081455_10126537 3300005937 Bacteria 2004
57 Ga0081538_10000431 3300005981 Bacteria 47122
58 Ga0081538_10004747 3300005981 Bacteria 12438
59 Ga0081538_10019734 3300005981 Bacteria 4992
60 Ga0081538_10054399 3300005981 Bacteria 2367
61 Ga0081538_10104238 3300005981 Bacteria 1416
62 Ga0075365_10040094 3300006038 Bacteria 3053
63 Ga0075428_100000646 3300006844 Bacteria 35860
64 Ga0075428_100024191 3300006844 Bacteria 6718
65 Ga0075428_100054895 3300006844 Bacteria 4365
66 Ga0075428_100082693 3300006844 Bacteria 3503
67 Ga0075430_100054095 3300006846 Bacteria 3378
68 Ga0075430_100098436 3300006846 Bacteria 2444
69 Ga0075431_100000220 3300006847 Bacteria 42522
70 Ga0075431_100005973 3300006847 Bacteria 12060
71 Ga0075431_100031792 3300006847 Bacteria 5437
72 Ga0075431_100034495 3300006847 Bacteria 5213
73 Ga0075431_100287065 3300006847 Bacteria 1665
74 Ga0075429_100000084 3300006880 Bacteria 49120
75 Ga0075429_100216159 3300006880 Bacteria 1679
76 Ga0075435_100025008 3300007076 Bacteria 4643
77 Ga0105240_10000253 3300009093 Bacteria 106101
78 Ga0105240_10020366 3300009093 Bacteria 8850
79 Ga0111539_10009626 3300009094 Bacteria 12200
80 Ga0111539_10012524 3300009094 Bacteria 10630
81 Ga0111539_10059982 3300009094 Bacteria 4510
82 Ga0111539_10102645 3300009094 Bacteria 3357
83 Ga0105245_10222387 3300009098 Bacteria 1822
84 Ga0114129_10010298 3300009147 Bacteria 13341
85 Ga0114129_10400176 3300009147 Bacteria 1810
86 Ga0105242_10269059 3300009176 Bacteria 1543
87 Ga0105237_10067146 3300009545 Bacteria 3581
88 Ga0105239_10032411 3300010375 Bacteria 5742
89 Ga0105239_10073744 3300010375 Bacteria 3752
90 Ga0105246_10121601 3300011119 Bacteria 1935
91 Ga0105246_10215647 3300011119 Bacteria 1501
92 Ga0157371_10017486 3300013102 Bacteria 5326
93 Ga0157374_10002177 3300013296 Bacteria 16513
94 Ga0157378_10024267 3300013297 Bacteria 5333
95 Ga0163162_10002359 3300013306 Bacteria 17740
96 Ga0163162_10055005 3300013306 Bacteria 4005
97 Ga0157375_10093172 3300013308 Bacteria 3078
98 Ga0157380_10000017 3300014326 Bacteria 119468
99 Ga0157376_10024307 3300014969 Bacteria 4754
100 Ga0182005_1000724 3300015265 Bacteria 15146
101 Ga0213876_10002706 3300021384 Bacteria 10332
102 Ga0209436_101611 3300025208 Bacteria 7544
103 Ga0209258_100126 3300025242 Bacteria 177846
104 Ga0209646_1000006 3300025246 Bacteria 694084
105 Ga0209026_1000220 3300025250 Bacteria 78595
106 Ga0209148_1000433 3300025254 Bacteria 46190
107 Ga0209673_1001178 3300025273 Bacteria 28341
108 Ga0209025_1000011 3300025294 Bacteria 976387
109 Ga0209564_1021708 3300025295 Bacteria 2297
110 Ga0209758_1000790 3300025297 Bacteria 45258
111 Ga0209050_1003014 3300025298 Bacteria 13058
112 Ga0207426_1001377 3300025302 Bacteria 20590
113 Ga0207426_1001952 3300025302 Bacteria 14722
114 Ga0209257_1000089 3300025304 Bacteria 277925
115 Ga0209257_1021040 3300025304 Bacteria 2384
116 Ga0207656_10034226 3300025321 Bacteria 2120
117 Ga0207655_1019200 3300025728 Bacteria 3586
118 Ga0207705_10089961 3300025909 Bacteria 2247
119 Ga0207654_10021182 3300025911 Bacteria 3454
120 Ga0207654_10132713 3300025911 Bacteria 1578
121 Ga0207707_10008072 3300025912 Bacteria 9141
122 Ga0207695_10000073 3300025913 Bacteria 312565
123 Ga0207695_10004518 3300025913 Bacteria 18929
124 Ga0207671_10005029 3300025914 Bacteria 12362
125 Ga0207646_10000234 3300025922 Bacteria 76450
126 Ga0207646_10001308 3300025922 Bacteria 30917
127 Ga0207646_10091869 3300025922 Bacteria 2717
128 Ga0207694_10016678 3300025924 Bacteria 5551
129 Ga0207650_10119672 3300025925 Bacteria 2048
130 Ga0207664_10002205 3300025929 Bacteria 12838
131 Ga0207664_10161031 3300025929 Bacteria 1914
132 Ga0207644_10120177 3300025931 Bacteria 1999
133 Ga0207691_10072972 3300025940 Bacteria 3095
134 Ga0207661_10036627 3300025944 Bacteria 3831
135 Ga0207679_10013908 3300025945 Bacteria 5275
136 Ga0207667_10000745 3300025949 Bacteria 42269
137 Ga0207640_10069930 3300025981 Bacteria 2359
138 Ga0207703_10322940 3300026035 Bacteria 1414
139 Ga0207639_10338318 3300026041 Bacteria 1341
140 Ga0207702_10120562 3300026078 Bacteria 2347
141 Ga0207641_10000231 3300026088 Bacteria 72245
142 Ga0207648_10068202 3300026089 Bacteria 3099
143 Ga0207648_10252172 3300026089 Bacteria 1573
144 Ga0207683_10008889 3300026121 Bacteria 8563
145 Ga0207698_10103803 3300026142 Bacteria 2363
146 Ga0207428_10012511 3300027907 Bacteria 7451
147 Ga0207428_10131454 3300027907 Bacteria 1915
148 Ga0268266_10341468 3300028379 Bacteria 1406
149 Ga0268264_10201151 3300028381 Bacteria 1823
150 Ga0265319_1026105 3300028563 Bacteria 2085
151 Ga0265338_10239162 3300028800 Bacteria 1346
152 Ga0316183_1016013 3300030742 Bacteria 2037
153 Ga0265331_10023333 3300031250 Bacteria 3144
154 Ga0265327_10007642 3300031251 Bacteria 8283
155 Ga0265316_10248073 3300031344 Bacteria 1308
156 Ga0307513_10066210 3300031456 Bacteria 3798
157 Ga0307508_10003772 3300031616 Bacteria 15136
158 Ga0307508_10197078 3300031616 Bacteria 1615
159 Ga0316579_10011601 3300031691 Bacteria 3748
160 Ga0307409_100009280 3300031995 Bacteria 6035
161 Ga0307414_10000167 3300032004 Bacteria 44152
162 Ga0307411_10058445 3300032005 Bacteria 2552
163 Ga0316574_0244151 3300035398 Bacteria 1148
164 Ga0395900_0042475 3300037418 Bacteria 4686
165 Ga0395900_0256762 3300037418 Bacteria 1747
166 Ga0395905_0008264 3300037471 Bacteria 10277
167 Ga0395901_0132178 3300038443 Bacteria 2623
168 Ga0400488_14007 3300038741 Bacteria 3632
169 Ga0400488_42984 3300038741 Bacteria 1120
170 Ga0436365_1107423 3300039437 Bacteria 15965
171 Ga0451795_0196308 3300041456 Bacteria 3665
172 Ga0451795_1036793 3300041456 Bacteria 1579
173 Ga0451853_2642503 3300041512 Bacteria 1871
174 Ga0439448_0006686 3300042005 Bacteria 3323
175 Ga0439450_012480 3300042008 Bacteria 1687
176 Ga0439454_000936 3300042011 Bacteria 2587
177 Ga0439463_003163 3300042016 Bacteria 4179
178 Ga0439444_0028611 3300042437 Bacteria 1033
179 Ga0439460_0072297 3300042461 Bacteria 1070
180 Ga0451577_0001502 3300042876 Bacteria 30835
181 Ga0451577_0128765 3300042876 Bacteria 2270
182 Ga0453683_0003836 3300044673 Bacteria 10914
183 Ga0453683_0130331 3300044673 Unclassified 1584
184 Ga0453683_0179985 3300044673 Bacteria 1341
185 Ga0453684_0000546 3300044712 Bacteria 142471
186 Ga0453684_0001005 3300044712 Bacteria 91475
187 Ga0453684_0045264 3300044712 Bacteria 5874
188 Ga0451576_0000022 3300045051 Bacteria 495037
189 Ga0451576_0004958 3300045051 Bacteria 16937
190 Ga0451576_0035770 3300045051 Bacteria 5267
191 Ga0451576_0037186 3300045051 Bacteria 5157
192 Ga0451576_0084537 3300045051 Bacteria 3301
193 Ga0495592_0000521 3300046454 Bacteria 27805
194 Ga0495653_0037654 3300046463 Bacteria 3798
195 Ga0495639_0009119 3300046475 Bacteria 4252
196 Ga0495608_0033135 3300046511 Bacteria 3494
197 Ga0495633_0000099 3300046558 Bacteria 116834
198 Ga0495667_0001314 3300046559 Bacteria 16316
199 Ga0495668_0001660 3300046616 Bacteria 20744
200 Ga0495657_0006341 3300046675 Bacteria 9266
201 Ga0495613_0162849 3300046689 Bacteria 1586
202 Ga0495624_0000164 3300046690 Bacteria 48886
203 Ga0495604_0043103 3300047317 Bacteria 3534
204 Ga0495604_0078681 3300047317 Bacteria 2474
205 Ga0495686_0000039 3300047472 Bacteria 304821
206 Ga0495593_0108954 3300047673 Bacteria 1415
207 Ga0495602_0055004 3300048088 Bacteria 3508
208 Ga0496106_0000160 3300048909 Bacteria 48936
209 Ga0496106_0117099 3300048909 Bacteria 2079
210 Ga0496107_0103689 3300048910 Bacteria 2087
211 Ga0496108_0018196 3300048911 Bacteria 5752
212 Ga0496108_0051348 3300048911 Bacteria 3454
213 Ga0496109_0020171 3300048912 Bacteria 5888
214 Ga0496109_0144263 3300048912 Bacteria 2227
215 Ga0496110_0036110 3300048913 Bacteria 4291
216 Ga0496110_0118006 3300048913 Bacteria 2389
217 Ga0496112_0000003 3300048915 Bacteria 660147
218 Ga0496114_0007370 3300048917 Bacteria 8691
219 Ga0496114_0012844 3300048917 Bacteria 6707
220 Ga0496124_0068828 3300048927 Bacteria 2941
221 Ga0496126_0023240 3300048929 Bacteria 6009
222 Ga0501332_00129 3300049548 Bacteria 2542
223 Ga0501031_0001250 3300049568 Bacteria 15581
224 Ga0501031_0025634 3300049568 Bacteria 3846
225 Ga0501032_0000391 3300049569 Bacteria 36115
226 Ga0501032_0004600 3300049569 Bacteria 10380
227 Ga0501032_0030128 3300049569 Bacteria 3722
228 Ga0501033_0001407 3300049570 Bacteria 21375
229 Ga0501033_0002337 3300049570 Bacteria 16166
230 Ga0501033_0016300 3300049570 Bacteria 5629
231 Ga0501033_0025864 3300049570 Bacteria 4419
232 Ga0501034_0000043 3300049571 Bacteria 229049
233 Ga0501034_0004409 3300049571 Bacteria 15669
234 Ga0501034_0013308 3300049571 Bacteria 8479
235 Ga0501036_0041110 3300049572 Bacteria 3913
236 Ga0501036_0042069 3300049572 Bacteria 3867
237 Ga0501036_0108156 3300049572 Bacteria 2351
238 Ga0501037_0000623 3300049573 Bacteria 27447
239 Ga0501037_0077558 3300049573 Bacteria 2411
240 Ga0501037_0080602 3300049573 Bacteria 2361
241 Ga0501038_0000280 3300049574 Bacteria 43290
242 Ga0501038_0004288 3300049574 Bacteria 13262
243 Ga0501038_0004365 3300049574 Bacteria 13159
244 Ga0501038_0023184 3300049574 Bacteria 5553
245 Ga0501038_0049744 3300049574 Bacteria 3624
246 Ga0501038_0080440 3300049574 Bacteria 2746
247 Ga0501039_0001252 3300049575 Bacteria 18547
248 Ga0501039_0018968 3300049575 Bacteria 5278
249 Ga0501039_0024589 3300049575 Bacteria 4627
250 Ga0501039_0042716 3300049575 Bacteria 3502
251 Ga0501040_0000797 3300049576 Bacteria 19585
252 Ga0501040_0003069 3300049576 Bacteria 10832
253 Ga0501040_0004987 3300049576 Bacteria 8590
254 Ga0501040_0083461 3300049576 Bacteria 2216
255 Ga0501041_0049565 3300049577 Bacteria 2558
256 Ga0501041_0062648 3300049577 Bacteria 2277
257 Ga0501041_0080187 3300049577 Bacteria 2010
258 Ga0501042_0000221 3300049578 Bacteria 27188
259 Ga0501042_0011714 3300049578 Bacteria 5925
260 Ga0501042_0054959 3300049578 Bacteria 2840
261 Ga0501042_0086547 3300049578 Bacteria 2247
262 Ga0501043_0000872 3300049579 Bacteria 26729
263 Ga0501043_0007011 3300049579 Bacteria 8977
264 Ga0501043_0052976 3300049579 Bacteria 3187
265 Ga0501043_0081831 3300049579 Bacteria 2537
266 Ga0501046_0001340 3300049580 Bacteria 23844
267 Ga0501046_0042557 3300049580 Bacteria 3621
268 Ga0501046_0071041 3300049580 Bacteria 2705
269 Ga0501046_0112539 3300049580 Bacteria 2078
270 Ga0501046_0141970 3300049580 Bacteria 1817
271 Ga0501046_0242915 3300049580 Bacteria 1327
272 Ga0501047_0002929 3300049581 Bacteria 16206
273 Ga0501047_0010600 3300049581 Bacteria 8718
274 Ga0501047_0190855 3300049581 Bacteria 1912
275 Ga0501048_0014675 3300049582 Bacteria 5796
276 Ga0501048_0052899 3300049582 Bacteria 2889
277 Ga0501068_0001131 3300049584 Bacteria 14135
278 Ga0501068_0027618 3300049584 Bacteria 3352
279 Ga0501068_0085328 3300049584 Bacteria 1943
280 Ga0501070_0161847 3300049586 Bacteria 1845
281 Ga0501070_0264339 3300049586 Bacteria 1406
282 Ga0501071_0035959 3300049587 Bacteria 3530
283 Ga0501071_0103528 3300049587 Bacteria 2100
284 Ga0501072_0001394 3300049588 Bacteria 18185
285 Ga0501072_0011337 3300049588 Bacteria 6812
286 Ga0501072_0053538 3300049588 Bacteria 3178
287 Ga0501072_0095742 3300049588 Bacteria 2359
288 Ga0501072_0178912 3300049588 Bacteria 1692
289 Ga0501074_0080115 3300049590 Bacteria 2343
290 Ga0501075_0004772 3300049591 Bacteria 9213
291 Ga0501075_0032117 3300049591 Bacteria 3899
292 Ga0501076_0000945 3300049592 Bacteria 18947
293 Ga0501076_0016088 3300049592 Bacteria 5664
294 Ga0501076_0104596 3300049592 Bacteria 2284
295 Ga0501076_0112472 3300049592 Bacteria 2202
296 Ga0501077_0000445 3300049593 Bacteria 25043
297 Ga0501077_0039017 3300049593 Bacteria 3024
298 Ga0501077_0040363 3300049593 Bacteria 2973
299 Ga0501233_033666 3300049668 Bacteria 1172
300 Ga0501238_008139 3300049671 Bacteria 1373
301 Ga0501079_0007158 3300049741 Bacteria 8421
302 Ga0501079_0143591 3300049741 Bacteria 1859
303 Ga0501081_0001083 3300049743 Bacteria 16374
304 Ga0501081_0054432 3300049743 Bacteria 2765
305 Ga0501081_0061616 3300049743 Bacteria 2601
306 Ga0501081_0087033 3300049743 Bacteria 2194
307 Ga0501083_0091639 3300049744 Bacteria 2007
308 Ga0501035_0009305 3300049822 Bacteria 9129
309 Ga0501035_0033336 3300049822 Bacteria 4684
310 Ga0501035_0116018 3300049822 Bacteria 2343
311 Ga0501035_0154409 3300049822 Bacteria 1990
312 Ga0501035_0258728 3300049822 Bacteria 1476
313 Ga0501044_0000482 3300049823 Bacteria 48412
314 Ga0501044_0003672 3300049823 Bacteria 17257
315 Ga0501044_0098574 3300049823 Bacteria 2942
316 Ga0501044_0144407 3300049823 Bacteria 2366
317 Ga0501045_0005046 3300049824 Bacteria 9143
318 Ga0501045_0008659 3300049824 Bacteria 7095
319 Ga0501045_0016904 3300049824 Bacteria 5180
320 Ga0501045_0032917 3300049824 Bacteria 3757
321 nmdc:mga03n38_223445_c1 3300050490 Bacteria 984
322 nmdc:mga00v17_54444_c1 3300050491 Bacteria 2440
323 nmdc:mga06z11_14875_c1 3300050494 Bacteria 3458
324 nmdc:mga05p37_158868_c1 3300050507 Bacteria 2761
325 nmdc:mga05p37_50324_c1 3300050507 Bacteria 5124
326 nmdc:mga05p37_7288_c1 3300050507 Bacteria 13049
327 nmdc:mga09592_104273_c1 3300050508 Bacteria 2430
328 nmdc:mga09592_8057_c1 3300050508 Bacteria 8572
329 nmdc:mga09592_97_c1 3300050508 Bacteria 52630
330 nmdc:mga09592_98447_c1 3300050508 Bacteria 2503
331 nmdc:mga0qj67_108445_c1 3300050509 Bacteria 2240
332 nmdc:mga0qj67_13700_c1 3300050509 Bacteria 6121
333 nmdc:mga0qj67_243563_c1 3300050509 Bacteria 1459
334 nmdc:mga0qj67_251159_c1 3300050509 Bacteria 1435
335 nmdc:mga0qj67_4433_c1 3300050509 Bacteria 10167
336 nmdc:mga06r32_2888_c1 3300050510 Bacteria 15416
337 nmdc:mga06r32_60339_c1 3300050510 Bacteria 3650
338 nmdc:mga08y16_34595_c1 3300050511 Bacteria 5308
339 nmdc:mga08y16_41594_c1 3300050511 Bacteria 4814
340 nmdc:mga0rr50_46043_c1 3300050513 Bacteria 3210
341 Ga0495612_0001003 3300053078 Bacteria 11610
342 Ga0495595_0003799 3300053084 Bacteria 6010
343 Ga0495619_0008491 3300053085 Bacteria 6496
344 Ga0500646_0030305 3300053090 Bacteria 1484
345 Ga0500583_0019508 3300053092 Bacteria 2781
346 Ga0500556_0002130 3300053104 Bacteria 6726
347 Ga0500562_000007 3300053108 Bacteria 241755
348 Ga0500569_000800 3300053109 Bacteria 5531
349 Ga0500607_054708 3300053121 Bacteria 2112
350 Ga0500577_0001081 3300053142 Bacteria 7009
351 Ga0500588_0000370 3300053146 Bacteria 6951
352 Ga0500622_0000229 3300053156 Bacteria 58196
353 Ga0500622_0002683 3300053156 Bacteria 12605
354 Ga0500633_0004917 3300053160 Bacteria 3122
355 Ga0501084_0003369 3300054114 Bacteria 12942
356 Ga0501084_0101700 3300054114 Bacteria 2413
357 Ga0501082_0001704 3300060353 Bacteria 19398
358 Ga0501082_0034919 3300060353 Bacteria 4334
359 Ga0501082_0282388 3300060353 Bacteria 1445
360 Ga0530510_0003377 3300061734 Bacteria 10981
361 Ga0530510_0005793 3300061734 Bacteria 8565
362 Ga0530510_0035404 3300061734 Bacteria 3598
363 Ga0530510_0041438 3300061734 Bacteria 3324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042437 Ga0439444_0028611 Ga0439444_0028611_12_923 303
2 3300050490 nmdc:mga03n38_223445_c1 nmdc:mga03n38_223445_c1_11_934 305
3 3300049548 Ga0501332_00129 Ga0501332_00129_1491_2423 308
4 3300005535 Ga0070684_100046541 Ga0070684_1000465412 315
5 3300026078 Ga0207702_10120562 Ga0207702_101205622 316
6 3300005471 Ga0070698_100390047 Ga0070698_1003900472 318
7 3300005981 Ga0081538_10104238 Ga0081538_101042382 319
8 3300042461 Ga0439460_0072297 Ga0439460_0072297_100_1059 319
9 3300044673 Ga0453683_0130331 Ga0453683_0130331_513_1496 319
10 3300025922 Ga0207646_10001308 Ga0207646_1000130827 320
11 3300049668 Ga0501233_033666 Ga0501233_033666_181_1143 320
12 3300005981 Ga0081538_10019734 Ga0081538_100197342 321
13 3300038741 Ga0400488_42984 Ga0400488_42984_24_989 321
14 3300005329 Ga0070683_100027860 Ga0070683_1000278602 322
15 3300005563 Ga0068855_100000454 Ga0068855_10000045418 322
16 3300025913 Ga0207695_10000073 Ga0207695_10000073246 322
17 3300025944 Ga0207661_10036627 Ga0207661_100366273 322
18 3300025949 Ga0207667_10000745 Ga0207667_1000074513 322
19 3300005468 Ga0070707_100028269 Ga0070707_1000282692 324
20 3300025922 Ga0207646_10091869 Ga0207646_100918694 324
21 3300005435 Ga0070714_100001655 Ga0070714_10000165516 326
22 3300025929 Ga0207664_10002205 Ga0207664_1000220515 326
23 3300030742 Ga0316183_1016013 Ga0316183_10160132 327
24 3300046475 Ga0495639_0009119 Ga0495639_0009119_151_1224 327
25 3300047673 Ga0495593_0108954 Ga0495593_0108954_30_1103 327
26 3300031344 Ga0265316_10248073 Ga0265316_102480731 329
27 3300044712 Ga0453684_0045264 Ga0453684_0045264_260_1249 329
28 3300045051 Ga0451576_0004958 Ga0451576_0004958_13016_14005 329
29 3300045051 Ga0451576_0037186 Ga0451576_0037186_1016_2005 329
30 3300011119 Ga0105246_10121601 Ga0105246_101216012 331
31 3300011119 Ga0105246_10215647 Ga0105246_102156472 334
32 3300031251 Ga0265327_10007642 Ga0265327_100076422 335
33 3300013296 Ga0157374_10002177 Ga0157374_1000217710 336
34 3300046690 Ga0495624_0000164 Ga0495624_0000164_19991_21064 336
35 3300041456 Ga0451795_1036793 Ga0451795_1036793_104_1201 337
36 3300028563 Ga0265319_1026105 Ga0265319_10261051 338
37 3300048915 Ga0496112_0000003 Ga0496112_0000003_633141_634214 338
38 3300047317 Ga0495604_0043103 Ga0495604_0043103_1435_2508 340
39 3300005981 Ga0081538_10054399 Ga0081538_100543992 342
40 3300049577 Ga0501041_0080187 Ga0501041_0080187_287_1384 345
41 3300049588 Ga0501072_0178912 Ga0501072_0178912_306_1403 345
42 3300049592 Ga0501076_0112472 Ga0501076_0112472_1042_2139 345
43 3300005842 Ga0068858_100353242 Ga0068858_1003532421 346
44 3300006844 Ga0075428_100082693 Ga0075428_1000826933 346
45 3300006880 Ga0075429_100216159 Ga0075429_1002161592 346
46 3300009094 Ga0111539_10012524 Ga0111539_100125243 346
47 3300026035 Ga0207703_10322940 Ga0207703_103229401 346
48 3300027907 Ga0207428_10131454 Ga0207428_101314542 346
49 iso_pu_bacteria 2883068021 2883068344 346
50 3300013306 Ga0163162_10002359 Ga0163162_100023592 348
51 3300044673 Ga0453683_0003836 Ga0453683_0003836_7689_8795 349
52 3300044712 Ga0453684_0000546 Ga0453684_0000546_14832_15893 349
53 3300009093 Ga0105240_10020366 Ga0105240_100203669 350
54 3300013297 Ga0157378_10024267 Ga0157378_100242674 350
55 3300037418 Ga0395900_0042475 Ga0395900_0042475_2480_3577 350
56 3300037471 Ga0395905_0008264 Ga0395905_0008264_8222_9319 350
57 3300005614 Ga0068856_100048419 Ga0068856_1000484192 351
58 3300009093 Ga0105240_10000253 Ga0105240_1000025384 351
59 3300009545 Ga0105237_10067146 Ga0105237_100671462 351
60 3300010375 Ga0105239_10032411 Ga0105239_100324114 351
61 3300025911 Ga0207654_10021182 Ga0207654_100211822 351
62 3300025913 Ga0207695_10004518 Ga0207695_1000451811 351
63 3300025914 Ga0207671_10005029 Ga0207671_100050294 351
64 3300025924 Ga0207694_10016678 Ga0207694_100166782 351
65 3300047472 Ga0495686_0000039 Ga0495686_0000039_29073_30173 351
66 3300049580 Ga0501046_0112539 Ga0501046_0112539_788_1864 351
67 3300049588 Ga0501072_0011337 Ga0501072_0011337_4215_5291 351
68 3300049743 Ga0501081_0061616 Ga0501081_0061616_339_1415 351
69 3300049824 Ga0501045_0005046 Ga0501045_0005046_3367_4443 351
70 3300061734 Ga0530510_0003377 Ga0530510_0003377_1866_2942 351
71 3300007076 Ga0075435_100025008 Ga0075435_1000250084 354
72 3300009176 Ga0105242_10269059 Ga0105242_102690592 354
73 3300015265 Ga0182005_1000724 Ga0182005_100072411 354
74 3300048909 Ga0496106_0117099 Ga0496106_0117099_809_1879 354
75 3300048910 Ga0496107_0103689 Ga0496107_0103689_927_1997 354
76 3300050513 nmdc:mga0rr50_46043_c1 nmdc:mga0rr50_46043_c1_183_1253 354
77 3300005333 Ga0070677_10000006 Ga0070677_1000000651 355
78 3300005341 Ga0070691_10024541 Ga0070691_100245412 355
79 3300005356 Ga0070674_100000011 Ga0070674_1000000119 355
80 3300005547 Ga0070693_100000398 Ga0070693_10000039814 355
81 3300005614 Ga0068856_100010700 Ga0068856_1000107009 355
82 3300005841 Ga0068863_100000042 Ga0068863_10000004249 355
83 3300006847 Ga0075431_100031792 Ga0075431_1000317922 355
84 3300014326 Ga0157380_10000017 Ga0157380_1000001747 355
85 3300026088 Ga0207641_10000231 Ga0207641_1000023149 355
86 3300028381 Ga0268264_10201151 Ga0268264_102011511 355
87 3300046454 Ga0495592_0000521 Ga0495592_0000521_17637_18710 355
88 3300048909 Ga0496106_0000160 Ga0496106_0000160_15267_16340 355
89 3300048913 Ga0496110_0036110 Ga0496110_0036110_43_1116 355
90 3300048927 Ga0496124_0068828 Ga0496124_0068828_87_1190 355
91 3300053078 Ga0495612_0001003 Ga0495612_0001003_10053_11126 355
92 3300003187 JGI25151J46595_10000157 JGI25151J46595_1000015778 356
93 3300025294 Ga0209025_1000011 Ga0209025_100001125 356
94 3300025911 Ga0207654_10132713 Ga0207654_101327132 357
95 3300031456 Ga0307513_10066210 Ga0307513_100662102 357
96 3300031616 Ga0307508_10003772 Ga0307508_100037723 357
97 3300031616 Ga0307508_10197078 Ga0307508_101970782 357
98 3300003354 JGI25160J50197_1012343 JGI25160J50197_10123432 358
99 3300003373 JGI25407J50210_10003671 JGI25407J50210_100036713 358
100 3300003373 JGI25407J50210_10014625 JGI25407J50210_100146252 358
101 3300003771 Ga0055526_1017584 Ga0055526_10175841 358
102 3300005937 Ga0081455_10000903 Ga0081455_1000090322 358
103 3300005937 Ga0081455_10005645 Ga0081455_100056459 358
104 3300005937 Ga0081455_10045675 Ga0081455_100456753 358
105 3300005937 Ga0081455_10126537 Ga0081455_101265372 358
106 3300005981 Ga0081538_10000431 Ga0081538_1000043138 358
107 3300005981 Ga0081538_10004747 Ga0081538_1000474713 358
108 3300006038 Ga0075365_10040094 Ga0075365_100400942 358
109 3300006844 Ga0075428_100000646 Ga0075428_10000064610 358
110 3300006844 Ga0075428_100054895 Ga0075428_1000548954 358
111 3300006846 Ga0075430_100054095 Ga0075430_1000540954 358
112 3300006846 Ga0075430_100098436 Ga0075430_1000984362 358
113 3300006847 Ga0075431_100000220 Ga0075431_10000022028 358
114 3300006847 Ga0075431_100005973 Ga0075431_1000059733 358
115 3300006847 Ga0075431_100034495 Ga0075431_1000344955 358
116 3300006847 Ga0075431_100287065 Ga0075431_1002870652 358
117 3300006880 Ga0075429_100000084 Ga0075429_10000008426 358
118 3300009094 Ga0111539_10009626 Ga0111539_100096266 358
119 3300009147 Ga0114129_10010298 Ga0114129_100102985 358
120 3300009147 Ga0114129_10400176 Ga0114129_104001762 358
121 3300025295 Ga0209564_1021708 Ga0209564_10217082 358
122 3300025304 Ga0209257_1021040 Ga0209257_10210402 358
123 3300027907 Ga0207428_10012511 Ga0207428_100125114 358
124 3300028379 Ga0268266_10341468 Ga0268266_103414682 358
125 3300031995 Ga0307409_100009280 Ga0307409_1000092807 358
126 3300032005 Ga0307411_10058445 Ga0307411_100584453 358
127 3300042005 Ga0439448_0006686 Ga0439448_0006686_1998_3074 358
128 3300042008 Ga0439450_012480 Ga0439450_012480_155_1231 358
129 3300042011 Ga0439454_000936 Ga0439454_000936_630_1706 358
130 3300042016 Ga0439463_003163 Ga0439463_003163_148_1224 358
131 3300046463 Ga0495653_0037654 Ga0495653_0037654_498_1574 358
132 3300046511 Ga0495608_0033135 Ga0495608_0033135_840_1916 358
133 3300046559 Ga0495667_0001314 Ga0495667_0001314_9037_10113 358
134 3300046675 Ga0495657_0006341 Ga0495657_0006341_8032_9108 358
135 3300046689 Ga0495613_0162849 Ga0495613_0162849_183_1259 358
136 3300047317 Ga0495604_0078681 Ga0495604_0078681_439_1515 358
137 3300048088 Ga0495602_0055004 Ga0495602_0055004_1880_2956 358
138 3300049570 Ga0501033_0001407 Ga0501033_0001407_15078_16154 358
139 3300049572 Ga0501036_0041110 Ga0501036_0041110_437_1513 358
140 3300049572 Ga0501036_0108156 Ga0501036_0108156_696_1772 358
141 3300049573 Ga0501037_0080602 Ga0501037_0080602_654_1730 358
142 3300049575 Ga0501039_0018968 Ga0501039_0018968_2900_3976 358
143 3300049575 Ga0501039_0042716 Ga0501039_0042716_861_1937 358
144 3300049576 Ga0501040_0000797 Ga0501040_0000797_15069_16145 358
145 3300049576 Ga0501040_0004987 Ga0501040_0004987_1831_2907 358
146 3300049576 Ga0501040_0083461 Ga0501040_0083461_191_1267 358
147 3300049577 Ga0501041_0049565 Ga0501041_0049565_967_2043 358
148 3300049577 Ga0501041_0062648 Ga0501041_0062648_526_1602 358
149 3300049578 Ga0501042_0011714 Ga0501042_0011714_1383_2459 358
150 3300049578 Ga0501042_0054959 Ga0501042_0054959_927_2003 358
151 3300049578 Ga0501042_0086547 Ga0501042_0086547_578_1654 358
152 3300049580 Ga0501046_0042557 Ga0501046_0042557_1782_2858 358
153 3300049580 Ga0501046_0071041 Ga0501046_0071041_903_1979 358
154 3300049581 Ga0501047_0010600 Ga0501047_0010600_597_1673 358
155 3300049582 Ga0501048_0014675 Ga0501048_0014675_1168_2244 358
156 3300049582 Ga0501048_0052899 Ga0501048_0052899_97_1173 358
157 3300049584 Ga0501068_0027618 Ga0501068_0027618_195_1271 358
158 3300049584 Ga0501068_0085328 Ga0501068_0085328_572_1648 358
159 3300049586 Ga0501070_0264339 Ga0501070_0264339_61_1137 358
160 3300049587 Ga0501071_0035959 Ga0501071_0035959_154_1230 358
161 3300049587 Ga0501071_0103528 Ga0501071_0103528_1001_2077 358
162 3300049588 Ga0501072_0001394 Ga0501072_0001394_8866_9942 358
163 3300049588 Ga0501072_0053538 Ga0501072_0053538_1434_2510 358
164 3300049588 Ga0501072_0095742 Ga0501072_0095742_423_1499 358
165 3300049590 Ga0501074_0080115 Ga0501074_0080115_618_1694 358
166 3300049591 Ga0501075_0004772 Ga0501075_0004772_3294_4370 358
167 3300049591 Ga0501075_0032117 Ga0501075_0032117_1937_3013 358
168 3300049592 Ga0501076_0000945 Ga0501076_0000945_14514_15590 358
169 3300049592 Ga0501076_0016088 Ga0501076_0016088_359_1435 358
170 3300049592 Ga0501076_0104596 Ga0501076_0104596_852_1928 358
171 3300049593 Ga0501077_0000445 Ga0501077_0000445_8993_10069 358
172 3300049593 Ga0501077_0039017 Ga0501077_0039017_313_1389 358
173 3300049593 Ga0501077_0040363 Ga0501077_0040363_1138_2214 358
174 3300049741 Ga0501079_0007158 Ga0501079_0007158_641_1717 358
175 3300049741 Ga0501079_0143591 Ga0501079_0143591_44_1120 358
176 3300049743 Ga0501081_0001083 Ga0501081_0001083_399_1475 358
177 3300049743 Ga0501081_0054432 Ga0501081_0054432_336_1412 358
178 3300049743 Ga0501081_0087033 Ga0501081_0087033_733_1809 358
179 3300049744 Ga0501083_0091639 Ga0501083_0091639_106_1182 358
180 3300049822 Ga0501035_0033336 Ga0501035_0033336_3272_4348 358
181 3300049824 Ga0501045_0008659 Ga0501045_0008659_506_1582 358
182 3300049824 Ga0501045_0016904 Ga0501045_0016904_3408_4484 358
183 3300050491 nmdc:mga00v17_54444_c1 nmdc:mga00v17_54444_c1_1150_2226 358
184 3300050494 nmdc:mga06z11_14875_c1 nmdc:mga06z11_14875_c1_1062_2138 358
185 3300050507 nmdc:mga05p37_158868_c1 nmdc:mga05p37_158868_c1_1443_2519 358
186 3300050507 nmdc:mga05p37_50324_c1 nmdc:mga05p37_50324_c1_1915_2991 358
187 3300050507 nmdc:mga05p37_7288_c1 nmdc:mga05p37_7288_c1_7783_8859 358
188 3300050508 nmdc:mga09592_104273_c1 nmdc:mga09592_104273_c1_1284_2360 358
189 3300050508 nmdc:mga09592_8057_c1 nmdc:mga09592_8057_c1_4478_5554 358
190 3300050508 nmdc:mga09592_97_c1 nmdc:mga09592_97_c1_29902_30978 358
191 3300050508 nmdc:mga09592_98447_c1 nmdc:mga09592_98447_c1_584_1660 358
192 3300050509 nmdc:mga0qj67_108445_c1 nmdc:mga0qj67_108445_c1_1085_2161 358
193 3300050509 nmdc:mga0qj67_13700_c1 nmdc:mga0qj67_13700_c1_2582_3658 358
194 3300050509 nmdc:mga0qj67_243563_c1 nmdc:mga0qj67_243563_c1_328_1404 358
195 3300050509 nmdc:mga0qj67_251159_c1 nmdc:mga0qj67_251159_c1_50_1129 358
196 3300050509 nmdc:mga0qj67_4433_c1 nmdc:mga0qj67_4433_c1_8382_9458 358
197 3300050510 nmdc:mga06r32_2888_c1 nmdc:mga06r32_2888_c1_9919_10995 358
198 3300050510 nmdc:mga06r32_60339_c1 nmdc:mga06r32_60339_c1_1785_2861 358
199 3300050511 nmdc:mga08y16_34595_c1 nmdc:mga08y16_34595_c1_4141_5217 358
200 3300053084 Ga0495595_0003799 Ga0495595_0003799_3714_4790 358
201 3300053085 Ga0495619_0008491 Ga0495619_0008491_2383_3459 358
202 3300054114 Ga0501084_0003369 Ga0501084_0003369_5300_6376 358
203 3300054114 Ga0501084_0101700 Ga0501084_0101700_1118_2194 358
204 3300060353 Ga0501082_0001704 Ga0501082_0001704_11170_12246 358
205 3300060353 Ga0501082_0034919 Ga0501082_0034919_1313_2389 358
206 3300060353 Ga0501082_0282388 Ga0501082_0282388_213_1289 358
207 3300061734 Ga0530510_0005793 Ga0530510_0005793_1200_2276 358
208 3300061734 Ga0530510_0035404 Ga0530510_0035404_751_1827 358
209 3300061734 Ga0530510_0041438 Ga0530510_0041438_2062_3138 358
210 3300053108 Ga0500562_000007 Ga0500562_000007_122879_123976 359
211 3300053156 Ga0500622_0002683 Ga0500622_0002683_846_1943 359
212 iso_pu_bacteria 2852673933 2852676385 360
213 iso_pu_bacteria 2857604169 2857606122 360
214 iso_pu_bacteria 2857609550 2857613277 360
215 iso_pu_bacteria 2928510474 2928513318 360
216 iso_pu_bacteria 2884634485 2884634781 361
217 3300028800 Ga0265338_10239162 Ga0265338_102391622 362
218 3300053104 Ga0500556_0002130 Ga0500556_0002130_459_1574 362
219 3300005290 Ga0065712_10154517 Ga0065712_101545171 363
220 3300005327 Ga0070658_10073980 Ga0070658_100739802 363
221 3300005328 Ga0070676_10054024 Ga0070676_100540242 363
222 3300005329 Ga0070683_100084249 Ga0070683_1000842491 363
223 3300005331 Ga0070670_100069447 Ga0070670_1000694472 363
224 3300005339 Ga0070660_100281497 Ga0070660_1002814972 363
225 3300005344 Ga0070661_100123796 Ga0070661_1001237962 363
226 3300005364 Ga0070673_100240635 Ga0070673_1002406352 363
227 3300005366 Ga0070659_100100573 Ga0070659_1001005733 363
228 3300005458 Ga0070681_10004493 Ga0070681_100044936 363
229 3300005459 Ga0068867_100036589 Ga0068867_1000365892 363
230 3300005459 Ga0068867_100044229 Ga0068867_1000442293 363
231 3300005467 Ga0070706_100027454 Ga0070706_1000274543 363
232 3300005468 Ga0070707_100000095 Ga0070707_10000009568 363
233 3300005518 Ga0070699_100014850 Ga0070699_1000148503 363
234 3300005536 Ga0070697_100045280 Ga0070697_1000452803 363
235 3300005614 Ga0068856_100044714 Ga0068856_1000447142 363
236 3300005616 Ga0068852_100183401 Ga0068852_1001834012 363
237 3300005618 Ga0068864_100266955 Ga0068864_1002669552 363
238 3300009094 Ga0111539_10059982 Ga0111539_100599822 363
239 3300009094 Ga0111539_10102645 Ga0111539_101026453 363
240 3300009098 Ga0105245_10222387 Ga0105245_102223872 363
241 3300013306 Ga0163162_10055005 Ga0163162_100550053 363
242 3300013308 Ga0157375_10093172 Ga0157375_100931722 363
243 3300014969 Ga0157376_10024307 Ga0157376_100243072 363
244 3300025321 Ga0207656_10034226 Ga0207656_100342262 363
245 3300025909 Ga0207705_10089961 Ga0207705_100899612 363
246 3300025912 Ga0207707_10008072 Ga0207707_100080725 363
247 3300025922 Ga0207646_10000234 Ga0207646_1000023465 363
248 3300025925 Ga0207650_10119672 Ga0207650_101196722 363
249 3300025929 Ga0207664_10161031 Ga0207664_101610312 363
250 3300025931 Ga0207644_10120177 Ga0207644_101201772 363
251 3300025940 Ga0207691_10072972 Ga0207691_100729724 363
252 3300025945 Ga0207679_10013908 Ga0207679_100139084 363
253 3300026089 Ga0207648_10252172 Ga0207648_102521721 363
254 3300026121 Ga0207683_10008889 Ga0207683_100088899 363
255 3300026142 Ga0207698_10103803 Ga0207698_101038032 363
256 3300031691 Ga0316579_10011601 Ga0316579_100116012 363
257 3300035398 Ga0316574_0244151 Ga0316574_0244151_14_1108 363
258 3300037418 Ga0395900_0256762 Ga0395900_0256762_604_1695 363
259 3300038443 Ga0395901_0132178 Ga0395901_0132178_1320_2411 363
260 3300038741 Ga0400488_14007 Ga0400488_14007_1349_2440 363
261 3300041512 Ga0451853_2642503 Ga0451853_2642503_746_1837 363
262 3300042876 Ga0451577_0128765 Ga0451577_0128765_528_1619 363
263 3300044673 Ga0453683_0179985 Ga0453683_0179985_211_1302 363
264 3300048911 Ga0496108_0018196 Ga0496108_0018196_2788_3879 363
265 3300048911 Ga0496108_0051348 Ga0496108_0051348_1727_2818 363
266 3300048912 Ga0496109_0020171 Ga0496109_0020171_2337_3428 363
267 3300048912 Ga0496109_0144263 Ga0496109_0144263_215_1306 363
268 3300048913 Ga0496110_0118006 Ga0496110_0118006_1216_2307 363
269 3300048917 Ga0496114_0007370 Ga0496114_0007370_6123_7214 363
270 3300048917 Ga0496114_0012844 Ga0496114_0012844_2564_3655 363
271 3300049568 Ga0501031_0001250 Ga0501031_0001250_245_1336 363
272 3300049568 Ga0501031_0025634 Ga0501031_0025634_1970_3061 363
273 3300049569 Ga0501032_0000391 Ga0501032_0000391_29481_30572 363
274 3300049569 Ga0501032_0004600 Ga0501032_0004600_1514_2605 363
275 3300049569 Ga0501032_0030128 Ga0501032_0030128_1434_2525 363
276 3300049570 Ga0501033_0002337 Ga0501033_0002337_12201_13292 363
277 3300049570 Ga0501033_0016300 Ga0501033_0016300_2806_3897 363
278 3300049570 Ga0501033_0025864 Ga0501033_0025864_2339_3430 363
279 3300049571 Ga0501034_0004409 Ga0501034_0004409_6360_7451 363
280 3300049572 Ga0501036_0042069 Ga0501036_0042069_2744_3835 363
281 3300049573 Ga0501037_0000623 Ga0501037_0000623_22038_23129 363
282 3300049573 Ga0501037_0077558 Ga0501037_0077558_948_2039 363
283 3300049574 Ga0501038_0000280 Ga0501038_0000280_36871_37962 363
284 3300049574 Ga0501038_0004288 Ga0501038_0004288_566_1657 363
285 3300049574 Ga0501038_0004365 Ga0501038_0004365_6684_7775 363
286 3300049574 Ga0501038_0023184 Ga0501038_0023184_2032_3123 363
287 3300049574 Ga0501038_0049744 Ga0501038_0049744_1275_2366 363
288 3300049574 Ga0501038_0080440 Ga0501038_0080440_66_1157 363
289 3300049575 Ga0501039_0001252 Ga0501039_0001252_15148_16239 363
290 3300049575 Ga0501039_0024589 Ga0501039_0024589_417_1508 363
291 3300049576 Ga0501040_0003069 Ga0501040_0003069_1523_2614 363
292 3300049578 Ga0501042_0000221 Ga0501042_0000221_9769_10860 363
293 3300049579 Ga0501043_0000872 Ga0501043_0000872_24594_25685 363
294 3300049579 Ga0501043_0007011 Ga0501043_0007011_1565_2656 363
295 3300049579 Ga0501043_0081831 Ga0501043_0081831_1136_2227 363
296 3300049580 Ga0501046_0001340 Ga0501046_0001340_917_2008 363
297 3300049580 Ga0501046_0141970 Ga0501046_0141970_22_1113 363
298 3300049580 Ga0501046_0242915 Ga0501046_0242915_55_1146 363
299 3300049581 Ga0501047_0002929 Ga0501047_0002929_4286_5377 363
300 3300049584 Ga0501068_0001131 Ga0501068_0001131_2206_3297 363
301 3300049822 Ga0501035_0009305 Ga0501035_0009305_7162_8253 363
302 3300049822 Ga0501035_0116018 Ga0501035_0116018_208_1299 363
303 3300049822 Ga0501035_0154409 Ga0501035_0154409_594_1685 363
304 3300049823 Ga0501044_0000482 Ga0501044_0000482_4286_5377 363
305 3300049823 Ga0501044_0003672 Ga0501044_0003672_10714_11805 363
306 3300049823 Ga0501044_0144407 Ga0501044_0144407_229_1320 363
307 3300049824 Ga0501045_0032917 Ga0501045_0032917_1062_2153 363
308 3300050511 nmdc:mga08y16_41594_c1 nmdc:mga08y16_41594_c1_434_1525 363
309 iso_pu_bacteria 2818991442 2819576365 363
310 iso_pu_bacteria 2818991444 2819590990 363
311 iso_pu_bacteria 2821136567 2821142569 363
312 iso_pu_bacteria 2884791551 2884793012 363
313 iso_pu_bacteria 2896085136 2896089056 363
314 iso_pu_bacteria 2904467357 2904470263 363
315 iso_pu_bacteria 2929177148 2929181132 363
316 iso_pu_bacteria 2929239360 2929243328 363
317 iso_pu_bacteria 2929921140 2929925203 363
318 iso_pu_bacteria 2945977869 2945983533 363
319 iso_pu_bacteria 2946013367 2946017077 363
320 iso_pu_bacteria 8003151029 8003155107 363
321 3300005578 Ga0068854_100146315 Ga0068854_1001463152 364
322 3300013102 Ga0157371_10017486 Ga0157371_100174866 364
323 3300025728 Ga0207655_1019200 Ga0207655_10192001 364
324 3300025981 Ga0207640_10069930 Ga0207640_100699302 364
325 3300041456 Ga0451795_0196308 Ga0451795_0196308_192_1292 364
326 3300005328 Ga0070676_10002151 Ga0070676_100021519 365
327 3300005459 Ga0068867_100009892 Ga0068867_10000989210 365
328 3300005539 Ga0068853_100017482 Ga0068853_1000174823 365
329 3300006844 Ga0075428_100024191 Ga0075428_1000241913 365
330 3300026041 Ga0207639_10338318 Ga0207639_103383182 365
331 3300026089 Ga0207648_10068202 Ga0207648_100682023 365
332 3300031250 Ga0265331_10023333 Ga0265331_100233333 365
333 3300032004 Ga0307414_10000167 Ga0307414_1000016731 365
334 3300042876 Ga0451577_0001502 Ga0451577_0001502_3318_4415 365
335 3300044712 Ga0453684_0001005 Ga0453684_0001005_52179_53276 365
336 3300045051 Ga0451576_0000022 Ga0451576_0000022_247844_248980 365
337 3300045051 Ga0451576_0084537 Ga0451576_0084537_858_1955 365
338 3300046616 Ga0495668_0001660 Ga0495668_0001660_15880_16977 365
339 3300049571 Ga0501034_0000043 Ga0501034_0000043_150796_151893 365
340 3300049579 Ga0501043_0052976 Ga0501043_0052976_174_1364 365
341 3300049581 Ga0501047_0190855 Ga0501047_0190855_551_1768 365
342 3300045051 Ga0451576_0035770 Ga0451576_0035770_823_1929 366
343 3300053146 Ga0500588_0000370 Ga0500588_0000370_951_2051 366
344 3300002739 JGI25158J39367_1005480 JGI25158J39367_10054802 367
345 3300003215 JGI25153J46596_10016889 JGI25153J46596_100168892 367
346 3300003322 rootL2_10006007 rootL2_100060073 367
347 3300003322 rootL2_10217083 rootL2_102170832 367
348 3300003354 JGI25160J50197_1007946 JGI25160J50197_10079462 367
349 3300003761 Ga0055535_1003643 Ga0055535_10036432 367
350 3300003762 Ga0055542_1011233 Ga0055542_10112331 367
351 3300003790 Ga0055528_1001068 Ga0055528_10010687 367
352 3300003794 Ga0055531_10000032 Ga0055531_1000003220 367
353 3300005262 Ga0065165_1000355 Ga0065165_100035547 367
354 3300010375 Ga0105239_10073744 Ga0105239_100737443 367
355 3300021384 Ga0213876_10002706 Ga0213876_100027067 367
356 3300025208 Ga0209436_101611 Ga0209436_1016113 367
357 3300025242 Ga0209258_100126 Ga0209258_100126102 367
358 3300025246 Ga0209646_1000006 Ga0209646_1000006498 367
359 3300025250 Ga0209026_1000220 Ga0209026_100022050 367
360 3300025254 Ga0209148_1000433 Ga0209148_10004338 367
361 3300025273 Ga0209673_1001178 Ga0209673_10011785 367
362 3300025297 Ga0209758_1000790 Ga0209758_10007909 367
363 3300025298 Ga0209050_1003014 Ga0209050_10030145 367
364 3300025302 Ga0207426_1001377 Ga0207426_100137710 367
365 3300025302 Ga0207426_1001952 Ga0207426_10019525 367
366 3300025304 Ga0209257_1000089 Ga0209257_100008995 367
367 3300039437 Ga0436365_1107423 Ga0436365_1107423_9723_10826 367
368 3300046558 Ga0495633_0000099 Ga0495633_0000099_35543_36727 367
369 3300048929 Ga0496126_0023240 Ga0496126_0023240_2198_3301 367
370 3300049571 Ga0501034_0013308 Ga0501034_0013308_45_1148 367
371 3300049586 Ga0501070_0161847 Ga0501070_0161847_54_1157 367
372 3300049671 Ga0501238_008139 Ga0501238_008139_38_1162 367
373 3300049822 Ga0501035_0258728 Ga0501035_0258728_329_1432 367
374 3300049823 Ga0501044_0098574 Ga0501044_0098574_687_1790 367
375 3300053090 Ga0500646_0030305 Ga0500646_0030305_308_1411 367
376 3300053092 Ga0500583_0019508 Ga0500583_0019508_995_2098 367
377 3300053109 Ga0500569_000800 Ga0500569_000800_381_1484 367
378 3300053121 Ga0500607_054708 Ga0500607_054708_168_1271 367
379 3300053142 Ga0500577_0001081 Ga0500577_0001081_4130_5233 367
380 3300053156 Ga0500622_0000229 Ga0500622_0000229_33651_34754 367
381 3300053160 Ga0500633_0004917 Ga0500633_0004917_1076_2221 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06071

YchF-GTPase_C

Protein of unknown function (DUF933)

310

393

0.99

PF01926

MMR_HSR1

50S ribosome-binding GTPase

31

173

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jal-assembly2.cif.gz_B ychf protein (hi0393) 0.9367 1 366
1jal-assembly2.cif.gz_B ychf protein (hi0393) 0.934 1 366
2dwq-assembly2.cif.gz_B thermus thermophilus ychf gtp-binding protein 0.9333 3 366
2dwq-assembly2.cif.gz_B thermus thermophilus ychf gtp-binding protein 0.9306 3 366
5ee0-assembly1.cif.gz_A crystal structure of osychf1 at ph 6.5 0.9174 3 365
ID Description Score Start End Superfamily
af_K7L8F3_337_419_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9987 284 365 3.10.20.30
af_Q6Z1J6_301_384_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9947 281 362 3.10.20.30
af_Q7ZU42_294_388_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9884 273 365 3.10.20.30
af_Q54CY8_295_409_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9797 254 365 3.10.20.30
1ni3A02 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.977 283 363 3.10.20.30
ID Description Score Start End GO Terms
AF-W1VBG4-F1-model_v4 GTP-binding protein 1.001 294 366 GO:0005737
GO:0016887
AF-A0A0F9MAX7-F1-model_v4 TGS domain-containing protein 0.9995 296 366 GO:0005737
GO:0016887
AF-A0A2W5SUJ7-F1-model_v4 Redox-regulated ATPase YchF 0.9985 296 366 GO:0005737
GO:0016887
AF-T1BPC8-F1-model_v4 Protein containing DUF933 0.9957 289 366 GO:0005737
GO:0016887
AF-A0A529LWD5-F1-model_v4 DUF933 domain-containing protein 0.994 298 366 GO:0005737
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.67 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map