F429001
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 381 | 202 | 379 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300031824|Ga0307413_10541550|Ga0307413_105415501 |
| Length | 164 |
| Sequence | MAQETIGGPAVQLGGEQKEEGMITRTARARYQGMGKDGQGWVSTQSGVLSEQRYAFGTRFENEPGTNPEELIAAAHAGCFTMALSFALAKEGITEGTLETEARVTLEKEGEGFRIGRSDLTLDANVPLDEDRLRELAEEAKANCPVSKLLNAEMALEVRARQAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 2 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 65 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 106 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 107 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 109 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 110 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 111 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 112 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 113 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 114 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 115 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 116 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 119 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 120 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 121 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 122 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 126 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 127 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 130 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 131 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 133 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 134 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 137 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 138 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 139 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 140 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 141 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 142 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 143 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 144 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 145 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 146 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 147 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 148 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 149 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 150 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 170 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 171 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 172 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 173 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 174 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 175 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 176 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 177 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 183 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 184 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 185 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 186 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 187 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 188 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 189 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 190 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 191 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 192 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 193 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 194 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 195 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 196 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 197 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 198 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 199 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 200 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 201 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 202 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.95 |
| Metatranscriptomes | 0.52 |
| Isolates | 0.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.56 |
| Nodule | 0 |
| Rhizoplane | 0.79 |
| Rhizosphere | 89.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1032790 | 3300002739 | Unclassified | 579 |
| 2 | rootH2_10217621 | 3300003320 | Bacteria | 2422 |
| 3 | rootL2_10102593 | 3300003322 | Bacteria | 2930 |
| 4 | Ga0070658_10000571 | 3300005327 | Bacteria | 32039 |
| 5 | Ga0070658_10002861 | 3300005327 | Bacteria | 14332 |
| 6 | Ga0070658_10010980 | 3300005327 | Bacteria | 7259 |
| 7 | Ga0070658_10062405 | 3300005327 | Bacteria | 3037 |
| 8 | Ga0070658_10205817 | 3300005327 | Bacteria | 1661 |
| 9 | Ga0070658_10435509 | 3300005327 | Bacteria | 1129 |
| 10 | Ga0070658_10855416 | 3300005327 | Bacteria | 790 |
| 11 | Ga0070658_11364002 | 3300005327 | Bacteria | 615 |
| 12 | Ga0070683_100700441 | 3300005329 | Bacteria | 970 |
| 13 | Ga0070670_100000153 | 3300005331 | Bacteria | 63436 |
| 14 | Ga0068869_100310713 | 3300005334 | Bacteria | 1276 |
| 15 | Ga0070666_10049324 | 3300005335 | Bacteria | 2829 |
| 16 | Ga0070666_10784620 | 3300005335 | Bacteria | 701 |
| 17 | Ga0070680_100523065 | 3300005336 | Bacteria | 1016 |
| 18 | Ga0070682_100645004 | 3300005337 | Bacteria | 842 |
| 19 | Ga0068868_101109339 | 3300005338 | Bacteria | 728 |
| 20 | Ga0070660_100000091 | 3300005339 | Bacteria | 54397 |
| 21 | Ga0070660_100003214 | 3300005339 | Bacteria | 11223 |
| 22 | Ga0070660_100005183 | 3300005339 | Bacteria | 9014 |
| 23 | Ga0070660_100105787 | 3300005339 | Bacteria | 2234 |
| 24 | Ga0070660_100215239 | 3300005339 | Bacteria | 1560 |
| 25 | Ga0070660_100291246 | 3300005339 | Bacteria | 1337 |
| 26 | Ga0070660_100405670 | 3300005339 | Bacteria | 1127 |
| 27 | Ga0070660_100525932 | 3300005339 | Bacteria | 985 |
| 28 | Ga0070660_101554051 | 3300005339 | Bacteria | 563 |
| 29 | Ga0070689_100156299 | 3300005340 | Bacteria | 1841 |
| 30 | Ga0070661_100000114 | 3300005344 | Bacteria | 67216 |
| 31 | Ga0070661_100257482 | 3300005344 | Bacteria | 1348 |
| 32 | Ga0070661_100260882 | 3300005344 | Bacteria | 1340 |
| 33 | Ga0070661_100981028 | 3300005344 | Bacteria | 700 |
| 34 | Ga0070692_10000864 | 3300005345 | Bacteria | 10185 |
| 35 | Ga0070692_10006531 | 3300005345 | Bacteria | 5071 |
| 36 | Ga0070692_10027193 | 3300005345 | Bacteria | 2833 |
| 37 | Ga0070692_10092738 | 3300005345 | Bacteria | 1644 |
| 38 | Ga0070668_100000508 | 3300005347 | Bacteria | 25733 |
| 39 | Ga0070668_100101489 | 3300005347 | Bacteria | 2280 |
| 40 | Ga0070668_100233842 | 3300005347 | Bacteria | 1520 |
| 41 | Ga0070668_100414274 | 3300005347 | Bacteria | 1153 |
| 42 | Ga0070669_100018321 | 3300005353 | Bacteria | 5004 |
| 43 | Ga0070669_100240396 | 3300005353 | Bacteria | 1438 |
| 44 | Ga0070671_100011703 | 3300005355 | Bacteria | 7056 |
| 45 | Ga0070659_100300222 | 3300005366 | Bacteria | 1339 |
| 46 | Ga0070659_100441852 | 3300005366 | Bacteria | 1102 |
| 47 | Ga0070667_100000146 | 3300005367 | Bacteria | 88847 |
| 48 | Ga0070667_100017069 | 3300005367 | Bacteria | 6012 |
| 49 | Ga0070667_100106892 | 3300005367 | Bacteria | 2422 |
| 50 | Ga0070663_100004745 | 3300005455 | Bacteria | 8021 |
| 51 | Ga0070681_10225718 | 3300005458 | Bacteria | 1788 |
| 52 | Ga0070679_100006019 | 3300005530 | Bacteria | 11286 |
| 53 | Ga0070697_100037383 | 3300005536 | Bacteria | 3922 |
| 54 | Ga0070665_100001180 | 3300005548 | Bacteria | 31967 |
| 55 | Ga0070665_100024524 | 3300005548 | Bacteria | 6077 |
| 56 | Ga0070665_100190674 | 3300005548 | Bacteria | 2051 |
| 57 | Ga0070665_100529673 | 3300005548 | Bacteria | 1190 |
| 58 | Ga0070704_100997253 | 3300005549 | Bacteria | 757 |
| 59 | Ga0068855_100000129 | 3300005563 | Bacteria | 96519 |
| 60 | Ga0068855_100015869 | 3300005563 | Bacteria | 9063 |
| 61 | Ga0068855_100365378 | 3300005563 | Bacteria | 1587 |
| 62 | Ga0068855_100406764 | 3300005563 | Bacteria | 1491 |
| 63 | Ga0068855_100454843 | 3300005563 | Bacteria | 1396 |
| 64 | Ga0068855_100630304 | 3300005563 | Bacteria | 1153 |
| 65 | Ga0070664_100090827 | 3300005564 | Bacteria | 2643 |
| 66 | Ga0068857_100942973 | 3300005577 | Bacteria | 829 |
| 67 | Ga0068854_100000359 | 3300005578 | Bacteria | 29216 |
| 68 | Ga0068856_100047623 | 3300005614 | Bacteria | 4224 |
| 69 | Ga0068856_101125973 | 3300005614 | Bacteria | 802 |
| 70 | Ga0068852_100000619 | 3300005616 | Bacteria | 23305 |
| 71 | Ga0068859_100003999 | 3300005617 | Bacteria | 15025 |
| 72 | Ga0068864_100000060 | 3300005618 | Bacteria | 124506 |
| 73 | Ga0068864_100000313 | 3300005618 | Bacteria | 42907 |
| 74 | Ga0068864_100551340 | 3300005618 | Bacteria | 1114 |
| 75 | Ga0068861_100068358 | 3300005719 | Bacteria | 2745 |
| 76 | Ga0068863_100000253 | 3300005841 | Bacteria | 56367 |
| 77 | Ga0068863_100029038 | 3300005841 | Bacteria | 5282 |
| 78 | Ga0068863_100155117 | 3300005841 | Bacteria | 2192 |
| 79 | Ga0068858_100006005 | 3300005842 | Bacteria | 11860 |
| 80 | Ga0068858_100015118 | 3300005842 | Bacteria | 7259 |
| 81 | Ga0068860_100000308 | 3300005843 | Bacteria | 67784 |
| 82 | Ga0068862_100000129 | 3300005844 | Bacteria | 88141 |
| 83 | Ga0068862_100033719 | 3300005844 | Bacteria | 4330 |
| 84 | Ga0068862_100036714 | 3300005844 | Bacteria | 4153 |
| 85 | Ga0068862_100380490 | 3300005844 | Bacteria | 1316 |
| 86 | Ga0075370_10890353 | 3300006353 | Bacteria | 544 |
| 87 | Ga0075428_100052052 | 3300006844 | Bacteria | 4489 |
| 88 | Ga0075428_101764058 | 3300006844 | Bacteria | 645 |
| 89 | Ga0097620_100003999 | 3300006931 | Bacteria | 15025 |
| 90 | Ga0105251_10203858 | 3300009011 | Bacteria | 891 |
| 91 | Ga0105250_10276180 | 3300009092 | Bacteria | 722 |
| 92 | Ga0105240_10002841 | 3300009093 | Bacteria | 27371 |
| 93 | Ga0105240_10044710 | 3300009093 | Bacteria | 5624 |
| 94 | Ga0111539_12315632 | 3300009094 | Unclassified | 623 |
| 95 | Ga0105247_10044757 | 3300009101 | Bacteria | 2715 |
| 96 | Ga0114129_10306648 | 3300009147 | Bacteria | 2114 |
| 97 | Ga0105241_10588841 | 3300009174 | Bacteria | 1003 |
| 98 | Ga0105248_10001464 | 3300009177 | Bacteria | 26304 |
| 99 | Ga0105248_10030470 | 3300009177 | Bacteria | 6023 |
| 100 | Ga0105248_10063810 | 3300009177 | Bacteria | 4134 |
| 101 | Ga0105248_10065608 | 3300009177 | Bacteria | 4076 |
| 102 | Ga0105237_10139473 | 3300009545 | Bacteria | 2419 |
| 103 | Ga0105237_10364473 | 3300009545 | Bacteria | 1449 |
| 104 | Ga0105238_10329084 | 3300009551 | Bacteria | 1514 |
| 105 | Ga0105238_10696497 | 3300009551 | Bacteria | 1028 |
| 106 | Ga0105238_10739151 | 3300009551 | Bacteria | 997 |
| 107 | Ga0105238_10944878 | 3300009551 | Bacteria | 882 |
| 108 | Ga0105249_10001621 | 3300009553 | Bacteria | 19708 |
| 109 | Ga0105249_10904149 | 3300009553 | Bacteria | 950 |
| 110 | Ga0105249_10924176 | 3300009553 | Bacteria | 940 |
| 111 | Ga0105239_11035792 | 3300010375 | Bacteria | 944 |
| 112 | Ga0157373_10032797 | 3300013100 | Bacteria | 3737 |
| 113 | Ga0157373_10488764 | 3300013100 | Bacteria | 888 |
| 114 | Ga0157371_10003542 | 3300013102 | Bacteria | 14084 |
| 115 | Ga0157371_10321079 | 3300013102 | Bacteria | 1124 |
| 116 | Ga0157370_10058583 | 3300013104 | Bacteria | 3661 |
| 117 | Ga0157369_10550901 | 3300013105 | Bacteria | 1192 |
| 118 | Ga0157378_12904182 | 3300013297 | Bacteria | 531 |
| 119 | Ga0163162_10060051 | 3300013306 | Bacteria | 3835 |
| 120 | Ga0163162_10067112 | 3300013306 | Bacteria | 3637 |
| 121 | Ga0157372_10712020 | 3300013307 | Bacteria | 1168 |
| 122 | Ga0157379_10001749 | 3300014968 | Bacteria | 17962 |
| 123 | Ga0157379_10053434 | 3300014968 | Bacteria | 3608 |
| 124 | Ga0213876_10000128 | 3300021384 | Bacteria | 82771 |
| 125 | Ga0207713_1182576 | 3300025735 | Bacteria | 654 |
| 126 | Ga0207710_10025644 | 3300025900 | Bacteria | 2544 |
| 127 | Ga0207680_10005545 | 3300025903 | Bacteria | 6033 |
| 128 | Ga0207680_10034433 | 3300025903 | Bacteria | 2898 |
| 129 | Ga0207647_10013059 | 3300025904 | Bacteria | 5771 |
| 130 | Ga0207647_10019114 | 3300025904 | Bacteria | 4613 |
| 131 | Ga0207647_10078597 | 3300025904 | Bacteria | 1981 |
| 132 | Ga0207647_10271435 | 3300025904 | Bacteria | 970 |
| 133 | Ga0207645_10374027 | 3300025907 | Bacteria | 955 |
| 134 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 135 | Ga0207705_10000091 | 3300025909 | Bacteria | 110768 |
| 136 | Ga0207705_10002133 | 3300025909 | Bacteria | 15351 |
| 137 | Ga0207705_10031804 | 3300025909 | Bacteria | 3769 |
| 138 | Ga0207705_10046271 | 3300025909 | Bacteria | 3126 |
| 139 | Ga0207705_10155818 | 3300025909 | Bacteria | 1714 |
| 140 | Ga0207705_10390175 | 3300025909 | Bacteria | 1076 |
| 141 | Ga0207705_10978194 | 3300025909 | Bacteria | 654 |
| 142 | Ga0207707_10106417 | 3300025912 | Bacteria | 2452 |
| 143 | Ga0207695_10004342 | 3300025913 | Bacteria | 19417 |
| 144 | Ga0207695_10027764 | 3300025913 | Bacteria | 6297 |
| 145 | Ga0207671_10940969 | 3300025914 | Bacteria | 682 |
| 146 | Ga0207660_10000892 | 3300025917 | Bacteria | 19647 |
| 147 | Ga0207660_10352638 | 3300025917 | Bacteria | 1179 |
| 148 | Ga0207657_10000092 | 3300025919 | Bacteria | 85665 |
| 149 | Ga0207657_10000252 | 3300025919 | Bacteria | 57036 |
| 150 | Ga0207657_10021780 | 3300025919 | Bacteria | 6022 |
| 151 | Ga0207657_10037432 | 3300025919 | Bacteria | 4332 |
| 152 | Ga0207657_10101948 | 3300025919 | Bacteria | 2381 |
| 153 | Ga0207657_10227324 | 3300025919 | Bacteria | 1493 |
| 154 | Ga0207657_10836287 | 3300025919 | Bacteria | 711 |
| 155 | Ga0207649_10000011 | 3300025920 | Bacteria | 266219 |
| 156 | Ga0207649_11347282 | 3300025920 | Bacteria | 565 |
| 157 | Ga0207652_10000001 | 3300025921 | Bacteria | 1006643 |
| 158 | Ga0207652_10000002 | 3300025921 | Bacteria | 878035 |
| 159 | Ga0207681_10032673 | 3300025923 | Bacteria | 3408 |
| 160 | Ga0207694_10508710 | 3300025924 | Bacteria | 1009 |
| 161 | Ga0207694_11006596 | 3300025924 | Bacteria | 705 |
| 162 | Ga0207650_10000064 | 3300025925 | Bacteria | 142969 |
| 163 | Ga0207650_10037913 | 3300025925 | Bacteria | 3515 |
| 164 | Ga0207644_10007618 | 3300025931 | Bacteria | 7059 |
| 165 | Ga0207690_10110247 | 3300025932 | Bacteria | 1981 |
| 166 | Ga0207690_10262857 | 3300025932 | Bacteria | 1338 |
| 167 | Ga0207690_10622155 | 3300025932 | Bacteria | 883 |
| 168 | Ga0207711_10001333 | 3300025941 | Bacteria | 23353 |
| 169 | Ga0207711_10101198 | 3300025941 | Bacteria | 2550 |
| 170 | Ga0207711_10130518 | 3300025941 | Bacteria | 2253 |
| 171 | Ga0207711_10267369 | 3300025941 | Bacteria | 1573 |
| 172 | Ga0207689_10306568 | 3300025942 | Bacteria | 1316 |
| 173 | Ga0207661_10191456 | 3300025944 | Bacteria | 1793 |
| 174 | Ga0207661_11005165 | 3300025944 | Bacteria | 768 |
| 175 | Ga0207679_10474340 | 3300025945 | Bacteria | 1113 |
| 176 | Ga0207679_11958534 | 3300025945 | Bacteria | 534 |
| 177 | Ga0207667_10001226 | 3300025949 | Bacteria | 32150 |
| 178 | Ga0207667_10188761 | 3300025949 | Bacteria | 2115 |
| 179 | Ga0207667_10342442 | 3300025949 | Bacteria | 1526 |
| 180 | Ga0207712_10001631 | 3300025961 | Bacteria | 15131 |
| 181 | Ga0207712_10611739 | 3300025961 | Bacteria | 943 |
| 182 | Ga0207668_10000154 | 3300025972 | Bacteria | 47517 |
| 183 | Ga0207668_10000379 | 3300025972 | Bacteria | 28234 |
| 184 | Ga0207668_10011687 | 3300025972 | Bacteria | 5343 |
| 185 | Ga0207668_10766026 | 3300025972 | Bacteria | 852 |
| 186 | Ga0207640_10002692 | 3300025981 | Bacteria | 9510 |
| 187 | Ga0207658_10000390 | 3300025986 | Bacteria | 42467 |
| 188 | Ga0207658_10011353 | 3300025986 | Bacteria | 6061 |
| 189 | Ga0207658_10013056 | 3300025986 | Bacteria | 5673 |
| 190 | Ga0207677_11330360 | 3300026023 | Bacteria | 660 |
| 191 | Ga0207703_10002812 | 3300026035 | Bacteria | 14851 |
| 192 | Ga0207703_10013054 | 3300026035 | Bacteria | 6474 |
| 193 | Ga0207639_10742300 | 3300026041 | Bacteria | 912 |
| 194 | Ga0207678_10004734 | 3300026067 | Bacteria | 12223 |
| 195 | Ga0207678_10035640 | 3300026067 | Bacteria | 4332 |
| 196 | Ga0207678_10902949 | 3300026067 | Bacteria | 781 |
| 197 | Ga0207702_10265264 | 3300026078 | Bacteria | 1618 |
| 198 | Ga0207702_12408499 | 3300026078 | Bacteria | 513 |
| 199 | Ga0207641_10000634 | 3300026088 | Bacteria | 38355 |
| 200 | Ga0207641_10325489 | 3300026088 | Bacteria | 1458 |
| 201 | Ga0207676_10000131 | 3300026095 | Bacteria | 66092 |
| 202 | Ga0207676_10857254 | 3300026095 | Bacteria | 889 |
| 203 | Ga0207674_10907915 | 3300026116 | Bacteria | 849 |
| 204 | Ga0207674_11510683 | 3300026116 | Bacteria | 641 |
| 205 | Ga0207675_100555640 | 3300026118 | Bacteria | 1147 |
| 206 | Ga0207698_10000177 | 3300026142 | Bacteria | 39133 |
| 207 | Ga0268266_10000812 | 3300028379 | Bacteria | 41107 |
| 208 | Ga0268266_10039346 | 3300028379 | Bacteria | 4027 |
| 209 | Ga0268266_10873757 | 3300028379 | Bacteria | 869 |
| 210 | Ga0268265_10000933 | 3300028380 | Bacteria | 26903 |
| 211 | Ga0268265_10015897 | 3300028380 | Bacteria | 5162 |
| 212 | Ga0268265_10016310 | 3300028380 | Bacteria | 5100 |
| 213 | Ga0268264_10000360 | 3300028381 | Bacteria | 67798 |
| 214 | Ga0268264_10023875 | 3300028381 | Bacteria | 4987 |
| 215 | Ga0307517_10129466 | 3300028786 | Bacteria | 1824 |
| 216 | Ga0307511_10029315 | 3300030521 | Bacteria | 4973 |
| 217 | Ga0265330_10001406 | 3300031235 | Bacteria | 14087 |
| 218 | Ga0307408_100028017 | 3300031548 | Bacteria | 3889 |
| 219 | Ga0307408_100416516 | 3300031548 | Bacteria | 1157 |
| 220 | Ga0307408_101401915 | 3300031548 | Bacteria | 658 |
| 221 | Ga0307408_101469325 | 3300031548 | Bacteria | 644 |
| 222 | Ga0307408_101559765 | 3300031548 | Bacteria | 626 |
| 223 | Ga0307408_101708080 | 3300031548 | Bacteria | 600 |
| 224 | Ga0316578_10330489 | 3300031728 | Unclassified | 909 |
| 225 | Ga0316578_10859177 | 3300031728 | Unclassified | 525 |
| 226 | Ga0307405_10036428 | 3300031731 | Bacteria | 2948 |
| 227 | Ga0307405_10063635 | 3300031731 | Bacteria | 2341 |
| 228 | Ga0307405_10442970 | 3300031731 | Bacteria | 1028 |
| 229 | Ga0316577_10097213 | 3300031733 | Bacteria | 1650 |
| 230 | Ga0307413_10066875 | 3300031824 | Bacteria | 2244 |
| 231 | Ga0307413_10541550 | 3300031824 | Bacteria | 942 |
| 232 | Ga0307413_10647256 | 3300031824 | Bacteria | 871 |
| 233 | Ga0307413_10942039 | 3300031824 | Bacteria | 736 |
| 234 | Ga0307410_10075371 | 3300031852 | Bacteria | 2352 |
| 235 | Ga0307410_10081925 | 3300031852 | Bacteria | 2268 |
| 236 | Ga0307410_10123999 | 3300031852 | Bacteria | 1888 |
| 237 | Ga0307410_10171356 | 3300031852 | Bacteria | 1636 |
| 238 | Ga0307410_11608028 | 3300031852 | Bacteria | 574 |
| 239 | Ga0307406_10030556 | 3300031901 | Bacteria | 3272 |
| 240 | Ga0307406_10241758 | 3300031901 | Bacteria | 1354 |
| 241 | Ga0307407_10019566 | 3300031903 | Bacteria | 3450 |
| 242 | Ga0307407_10076171 | 3300031903 | Bacteria | 2013 |
| 243 | Ga0307407_10278331 | 3300031903 | Bacteria | 1158 |
| 244 | Ga0307412_10278081 | 3300031911 | Bacteria | 1313 |
| 245 | Ga0307412_10449059 | 3300031911 | Bacteria | 1062 |
| 246 | Ga0307412_12097707 | 3300031911 | Bacteria | 525 |
| 247 | Ga0307409_100036198 | 3300031995 | Bacteria | 3625 |
| 248 | Ga0307409_100085324 | 3300031995 | Bacteria | 2566 |
| 249 | Ga0307409_100214916 | 3300031995 | Bacteria | 1731 |
| 250 | Ga0307409_100260400 | 3300031995 | Bacteria | 1591 |
| 251 | Ga0307409_100353438 | 3300031995 | Bacteria | 1388 |
| 252 | Ga0307409_101180500 | 3300031995 | Bacteria | 788 |
| 253 | Ga0307416_100022142 | 3300032002 | Bacteria | 4580 |
| 254 | Ga0307416_100065406 | 3300032002 | Bacteria | 2988 |
| 255 | Ga0307416_101030566 | 3300032002 | Bacteria | 926 |
| 256 | Ga0307416_101246416 | 3300032002 | Bacteria | 849 |
| 257 | Ga0307416_101684733 | 3300032002 | Bacteria | 739 |
| 258 | Ga0307414_10046105 | 3300032004 | Bacteria | 2989 |
| 259 | Ga0307414_10203196 | 3300032004 | Bacteria | 1613 |
| 260 | Ga0307411_10026629 | 3300032005 | Bacteria | 3484 |
| 261 | Ga0307411_10249915 | 3300032005 | Bacteria | 1393 |
| 262 | Ga0307411_10306206 | 3300032005 | Bacteria | 1276 |
| 263 | Ga0307411_10447155 | 3300032005 | Bacteria | 1080 |
| 264 | Ga0307411_10753628 | 3300032005 | Bacteria | 853 |
| 265 | Ga0307411_11273127 | 3300032005 | Bacteria | 669 |
| 266 | Ga0307411_12020968 | 3300032005 | Unclassified | 538 |
| 267 | Ga0307415_100174784 | 3300032126 | Bacteria | 1679 |
| 268 | Ga0307415_100407272 | 3300032126 | Bacteria | 1163 |
| 269 | Ga0307415_100693517 | 3300032126 | Bacteria | 918 |
| 270 | Ga0307415_101388107 | 3300032126 | Bacteria | 668 |
| 271 | Ga0316593_10151474 | 3300032168 | Bacteria | 844 |
| 272 | Ga0316593_10208232 | 3300032168 | Bacteria | 724 |
| 273 | Ga0373940_0030907 | 3300035088 | Bacteria | 1427 |
| 274 | Ga0373941_0408299 | 3300035115 | Bacteria | 563 |
| 275 | Ga0373953_0036807 | 3300035117 | Bacteria | 1929 |
| 276 | Ga0373954_0025166 | 3300035118 | Bacteria | 2719 |
| 277 | Ga0373957_0168912 | 3300035120 | Bacteria | 903 |
| 278 | Ga0373937_0046952 | 3300036401 | Bacteria | 3950 |
| 279 | Ga0316582_0148275 | 3300036647 | Bacteria | 1585 |
| 280 | Ga0316582_0170156 | 3300036647 | Bacteria | 1479 |
| 281 | Ga0316582_1210130 | 3300036647 | Bacteria | 514 |
| 282 | Ga0316584_0191464 | 3300036712 | Bacteria | 1512 |
| 283 | Ga0316584_0531105 | 3300036712 | Bacteria | 823 |
| 284 | Ga0373925_0147638 | 3300037068 | Bacteria | 1844 |
| 285 | Ga0395899_0000132 | 3300037312 | Bacteria | 115455 |
| 286 | Ga0395899_0066959 | 3300037312 | Bacteria | 2636 |
| 287 | Ga0395899_0601521 | 3300037312 | Bacteria | 700 |
| 288 | Ga0395900_0000477 | 3300037418 | Bacteria | 56791 |
| 289 | Ga0395900_0397263 | 3300037418 | Bacteria | 1343 |
| 290 | Ga0395898_0010152 | 3300037466 | Bacteria | 9856 |
| 291 | Ga0395898_0039484 | 3300037466 | Bacteria | 4672 |
| 292 | Ga0395898_0191401 | 3300037466 | Bacteria | 1954 |
| 293 | Ga0395898_0353269 | 3300037466 | Bacteria | 1402 |
| 294 | Ga0395898_0455357 | 3300037466 | Bacteria | 1218 |
| 295 | Ga0395898_0837604 | 3300037466 | Bacteria | 859 |
| 296 | Ga0395905_0022794 | 3300037471 | Bacteria | 5920 |
| 297 | Ga0395905_0073352 | 3300037471 | Bacteria | 3208 |
| 298 | Ga0395905_0209922 | 3300037471 | Bacteria | 1824 |
| 299 | Ga0395905_0439087 | 3300037471 | Bacteria | 1202 |
| 300 | Ga0395905_0910252 | 3300037471 | Bacteria | 782 |
| 301 | Ga0395905_1371470 | 3300037471 | Bacteria | 611 |
| 302 | Ga0316581_0225646 | 3300037588 | Bacteria | 576 |
| 303 | Ga0436364_1207386 | 3300037853 | Bacteria | 826 |
| 304 | Ga0395901_0000275 | 3300038443 | Bacteria | 63659 |
| 305 | Ga0395901_0016131 | 3300038443 | Bacteria | 7609 |
| 306 | Ga0395901_0060741 | 3300038443 | Bacteria | 3933 |
| 307 | Ga0395901_1273440 | 3300038443 | Bacteria | 698 |
| 308 | Ga0436365_1686123 | 3300039437 | Bacteria | 49596 |
| 309 | Ga0436362_1287140 | 3300039453 | Bacteria | 68344 |
| 310 | Ga0439448_0001546 | 3300042005 | Bacteria | 6014 |
| 311 | Ga0439432_009200 | 3300042006 | Bacteria | 3449 |
| 312 | Ga0439432_158888 | 3300042006 | Bacteria | 662 |
| 313 | Ga0439449_0043099 | 3300042007 | Bacteria | 1676 |
| 314 | Ga0439449_0364700 | 3300042007 | Bacteria | 547 |
| 315 | Ga0439458_0000459 | 3300042157 | Bacteria | 10339 |
| 316 | Ga0451577_0934231 | 3300042876 | Bacteria | 780 |
| 317 | Ga0453683_0111208 | 3300044673 | Bacteria | 1723 |
| 318 | Ga0453683_0417518 | 3300044673 | Bacteria | 866 |
| 319 | Ga0466963_0078031 | 3300044694 | Bacteria | 2238 |
| 320 | Ga0451576_0070823 | 3300045051 | Bacteria | 3629 |
| 321 | Ga0466967_1872840 | 3300045976 | Bacteria | 597 |
| 322 | Ga0495629_0166761 | 3300046459 | Bacteria | 1529 |
| 323 | Ga0495584_0194603 | 3300046491 | Bacteria | 1031 |
| 324 | Ga0495585_0065370 | 3300046492 | Bacteria | 1993 |
| 325 | Ga0495620_0069732 | 3300046515 | Bacteria | 1441 |
| 326 | Ga0495637_0135881 | 3300046520 | Bacteria | 936 |
| 327 | Ga0495654_0211350 | 3300046530 | Bacteria | 825 |
| 328 | Ga0495609_0080733 | 3300046538 | Bacteria | 1422 |
| 329 | Ga0495597_0002700 | 3300046542 | Bacteria | 10949 |
| 330 | Ga0495622_0033161 | 3300046557 | Bacteria | 2411 |
| 331 | Ga0495668_0061502 | 3300046616 | Bacteria | 2071 |
| 332 | Ga0495625_0285166 | 3300046660 | Bacteria | 1061 |
| 333 | Ga0495659_0086471 | 3300046664 | Bacteria | 1198 |
| 334 | Ga0495623_0155018 | 3300046679 | Bacteria | 1351 |
| 335 | Ga0495669_0095156 | 3300046684 | Bacteria | 1379 |
| 336 | Ga0495669_0108327 | 3300046684 | Bacteria | 1295 |
| 337 | Ga0495669_0181457 | 3300046684 | Bacteria | 1003 |
| 338 | Ga0495581_0135881 | 3300047315 | Bacteria | 1433 |
| 339 | Ga0495687_010917 | 3300047443 | Bacteria | 4930 |
| 340 | Ga0495593_0208970 | 3300047673 | Bacteria | 980 |
| 341 | Ga0495602_0376970 | 3300048088 | Bacteria | 1017 |
| 342 | Ga0496101_1168677 | 3300048904 | Bacteria | 603 |
| 343 | Ga0496102_0297484 | 3300048905 | Bacteria | 1521 |
| 344 | Ga0496103_0180765 | 3300048906 | Bacteria | 1356 |
| 345 | Ga0496116_0294359 | 3300048919 | Bacteria | 777 |
| 346 | Ga0496117_0041016 | 3300048920 | Bacteria | 3397 |
| 347 | Ga0496118_0002955 | 3300048921 | Bacteria | 22041 |
| 348 | Ga0496119_0023841 | 3300048922 | Bacteria | 4325 |
| 349 | Ga0496120_0094375 | 3300048923 | Bacteria | 1593 |
| 350 | Ga0496121_0000152 | 3300048924 | Bacteria | 150767 |
| 351 | Ga0495682_0073086 | 3300049460 | Bacteria | 1234 |
| 352 | Ga0501033_0771981 | 3300049570 | Bacteria | 651 |
| 353 | Ga0501035_0866030 | 3300049822 | Bacteria | 718 |
| 354 | nmdc:mga05p37_247944_c1 | 3300050507 | Bacteria | 2137 |
| 355 | nmdc:mga09592_644456_c1 | 3300050508 | Bacteria | 905 |
| 356 | Ga0500635_0000208 | 3300053080 | Bacteria | 28812 |
| 357 | Ga0500643_004190 | 3300053087 | Bacteria | 6607 |
| 358 | Ga0500643_011525 | 3300053087 | Bacteria | 3223 |
| 359 | Ga0500651_0386445 | 3300053093 | Bacteria | 788 |
| 360 | Ga0500556_0021116 | 3300053104 | Bacteria | 2094 |
| 361 | Ga0500569_033716 | 3300053109 | Bacteria | 1456 |
| 362 | Ga0500595_001609 | 3300053119 | Bacteria | 11894 |
| 363 | Ga0500595_029670 | 3300053119 | Bacteria | 1853 |
| 364 | Ga0500608_032746 | 3300053122 | Bacteria | 2471 |
| 365 | Ga0500642_0131874 | 3300053130 | Bacteria | 1171 |
| 366 | Ga0500642_0262690 | 3300053130 | Bacteria | 789 |
| 367 | Ga0500642_0311360 | 3300053130 | Bacteria | 708 |
| 368 | Ga0500658_0023853 | 3300053134 | Bacteria | 2340 |
| 369 | Ga0500559_0013592 | 3300053136 | Bacteria | 3446 |
| 370 | Ga0500577_0499962 | 3300053142 | Bacteria | 531 |
| 371 | Ga0500590_027208 | 3300053148 | Bacteria | 2965 |
| 372 | Ga0500619_114286 | 3300053154 | Bacteria | 919 |
| 373 | Ga0500639_096117 | 3300053163 | Bacteria | 1467 |
| 374 | Ga0500636_0034993 | 3300053177 | Bacteria | 2973 |
| 375 | Ga0500637_0052695 | 3300053178 | Bacteria | 2321 |
| 376 | Ga0500576_208614 | 3300053725 | Bacteria | 655 |
| 377 | Ga0500625_006868 | 3300053729 | Bacteria | 4893 |
| 378 | Ga0500596_001848 | 3300053735 | Bacteria | 4254 |
| 379 | Ga0590071_069549 | 3300059421 | Bacteria | 867 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036712 | Ga0316584_0191464 | Ga0316584_0191464_419_793 | 117 |
| 2 | 3300036647 | Ga0316582_1210130 | Ga0316582_1210130_123_500 | 118 |
| 3 | 3300005345 | Ga0070692_10027193 | Ga0070692_100271932 | 126 |
| 4 | iso_pu_bacteria | 2829745981 | 2829747562 | 133 |
| 5 | iso_pu_bacteria | 8054302542 | 8054304755 | 133 |
| 6 | 3300005327 | Ga0070658_10002861 | Ga0070658_100028614 | 134 |
| 7 | 3300005563 | Ga0068855_100015869 | Ga0068855_1000158698 | 134 |
| 8 | 3300005563 | Ga0068855_100454843 | Ga0068855_1004548432 | 134 |
| 9 | 3300005563 | Ga0068855_100630304 | Ga0068855_1006303042 | 134 |
| 10 | 3300005577 | Ga0068857_100942973 | Ga0068857_1009429732 | 134 |
| 11 | 3300005578 | Ga0068854_100000359 | Ga0068854_10000035924 | 134 |
| 12 | 3300005614 | Ga0068856_100047623 | Ga0068856_1000476233 | 134 |
| 13 | 3300005614 | Ga0068856_101125973 | Ga0068856_1011259732 | 134 |
| 14 | 3300005616 | Ga0068852_100000619 | Ga0068852_10000061916 | 134 |
| 15 | 3300009093 | Ga0105240_10044710 | Ga0105240_100447103 | 134 |
| 16 | 3300009545 | Ga0105237_10364473 | Ga0105237_103644732 | 134 |
| 17 | 3300009551 | Ga0105238_10739151 | Ga0105238_107391512 | 134 |
| 18 | 3300025904 | Ga0207647_10019114 | Ga0207647_100191144 | 134 |
| 19 | 3300025904 | Ga0207647_10271435 | Ga0207647_102714352 | 134 |
| 20 | 3300025909 | Ga0207705_10000004 | Ga0207705_10000004356 | 134 |
| 21 | 3300025913 | Ga0207695_10027764 | Ga0207695_100277643 | 134 |
| 22 | 3300025914 | Ga0207671_10940969 | Ga0207671_109409691 | 134 |
| 23 | 3300025924 | Ga0207694_10508710 | Ga0207694_105087102 | 134 |
| 24 | 3300025945 | Ga0207679_10474340 | Ga0207679_104743401 | 134 |
| 25 | 3300025949 | Ga0207667_10188761 | Ga0207667_101887613 | 134 |
| 26 | 3300025949 | Ga0207667_10342442 | Ga0207667_103424422 | 134 |
| 27 | 3300025981 | Ga0207640_10002692 | Ga0207640_100026925 | 134 |
| 28 | 3300026041 | Ga0207639_10742300 | Ga0207639_107423002 | 134 |
| 29 | 3300026078 | Ga0207702_10265264 | Ga0207702_102652642 | 134 |
| 30 | 3300026078 | Ga0207702_12408499 | Ga0207702_124084991 | 134 |
| 31 | 3300026095 | Ga0207676_10857254 | Ga0207676_108572542 | 134 |
| 32 | 3300026116 | Ga0207674_10907915 | Ga0207674_109079152 | 134 |
| 33 | 3300026116 | Ga0207674_11510683 | Ga0207674_115106832 | 134 |
| 34 | 3300026142 | Ga0207698_10000177 | Ga0207698_1000017731 | 134 |
| 35 | 3300005344 | Ga0070661_100981028 | Ga0070661_1009810282 | 135 |
| 36 | 3300005564 | Ga0070664_100090827 | Ga0070664_1000908273 | 135 |
| 37 | 3300006353 | Ga0075370_10890353 | Ga0075370_108903531 | 135 |
| 38 | 3300013297 | Ga0157378_12904182 | Ga0157378_129041821 | 135 |
| 39 | 3300025920 | Ga0207649_11347282 | Ga0207649_113472821 | 135 |
| 40 | 3300031548 | Ga0307408_100028017 | Ga0307408_1000280173 | 135 |
| 41 | 3300031548 | Ga0307408_101401915 | Ga0307408_1014019151 | 135 |
| 42 | 3300031548 | Ga0307408_101469325 | Ga0307408_1014693252 | 135 |
| 43 | 3300031548 | Ga0307408_101559765 | Ga0307408_1015597651 | 135 |
| 44 | 3300031731 | Ga0307405_10036428 | Ga0307405_100364282 | 135 |
| 45 | 3300031824 | Ga0307413_10066875 | Ga0307413_100668752 | 135 |
| 46 | 3300031824 | Ga0307413_10541550 | Ga0307413_105415501 | 135 |
| 47 | 3300031824 | Ga0307413_10647256 | Ga0307413_106472562 | 135 |
| 48 | 3300031852 | Ga0307410_10075371 | Ga0307410_100753712 | 135 |
| 49 | 3300031852 | Ga0307410_10081925 | Ga0307410_100819252 | 135 |
| 50 | 3300031852 | Ga0307410_10123999 | Ga0307410_101239992 | 135 |
| 51 | 3300031852 | Ga0307410_10171356 | Ga0307410_101713561 | 135 |
| 52 | 3300031852 | Ga0307410_11608028 | Ga0307410_116080281 | 135 |
| 53 | 3300031901 | Ga0307406_10030556 | Ga0307406_100305562 | 135 |
| 54 | 3300031901 | Ga0307406_10241758 | Ga0307406_102417582 | 135 |
| 55 | 3300031903 | Ga0307407_10019566 | Ga0307407_100195663 | 135 |
| 56 | 3300031903 | Ga0307407_10076171 | Ga0307407_100761712 | 135 |
| 57 | 3300031903 | Ga0307407_10278331 | Ga0307407_102783311 | 135 |
| 58 | 3300031911 | Ga0307412_10278081 | Ga0307412_102780812 | 135 |
| 59 | 3300031911 | Ga0307412_10449059 | Ga0307412_104490592 | 135 |
| 60 | 3300031911 | Ga0307412_12097707 | Ga0307412_120977071 | 135 |
| 61 | 3300031995 | Ga0307409_100036198 | Ga0307409_1000361982 | 135 |
| 62 | 3300031995 | Ga0307409_100085324 | Ga0307409_1000853242 | 135 |
| 63 | 3300031995 | Ga0307409_100214916 | Ga0307409_1002149162 | 135 |
| 64 | 3300031995 | Ga0307409_100260400 | Ga0307409_1002604002 | 135 |
| 65 | 3300031995 | Ga0307409_101180500 | Ga0307409_1011805001 | 135 |
| 66 | 3300032002 | Ga0307416_100022142 | Ga0307416_1000221424 | 135 |
| 67 | 3300032002 | Ga0307416_101030566 | Ga0307416_1010305662 | 135 |
| 68 | 3300032002 | Ga0307416_101246416 | Ga0307416_1012464162 | 135 |
| 69 | 3300032004 | Ga0307414_10046105 | Ga0307414_100461052 | 135 |
| 70 | 3300032004 | Ga0307414_10203196 | Ga0307414_102031962 | 135 |
| 71 | 3300032005 | Ga0307411_10026629 | Ga0307411_100266293 | 135 |
| 72 | 3300032005 | Ga0307411_10249915 | Ga0307411_102499152 | 135 |
| 73 | 3300032005 | Ga0307411_10306206 | Ga0307411_103062061 | 135 |
| 74 | 3300032005 | Ga0307411_10753628 | Ga0307411_107536281 | 135 |
| 75 | 3300032005 | Ga0307411_11273127 | Ga0307411_112731271 | 135 |
| 76 | 3300032005 | Ga0307411_12020968 | Ga0307411_120209681 | 135 |
| 77 | 3300032126 | Ga0307415_100174784 | Ga0307415_1001747842 | 135 |
| 78 | 3300032126 | Ga0307415_100693517 | Ga0307415_1006935172 | 135 |
| 79 | 3300032126 | Ga0307415_101388107 | Ga0307415_1013881071 | 135 |
| 80 | 3300042006 | Ga0439432_158888 | Ga0439432_158888_211_642 | 135 |
| 81 | 3300042007 | Ga0439449_0043099 | Ga0439449_0043099_67_498 | 135 |
| 82 | 3300042007 | Ga0439449_0364700 | Ga0439449_0364700_102_533 | 135 |
| 83 | 3300059421 | Ga0590071_069549 | Ga0590071_069549_242_673 | 135 |
| 84 | 3300002739 | JGI25158J39367_1032790 | JGI25158J39367_10327901 | 136 |
| 85 | 3300003320 | rootH2_10217621 | rootH2_102176213 | 136 |
| 86 | 3300003322 | rootL2_10102593 | rootL2_101025933 | 136 |
| 87 | 3300005327 | Ga0070658_10000571 | Ga0070658_100005719 | 136 |
| 88 | 3300005327 | Ga0070658_10010980 | Ga0070658_100109803 | 136 |
| 89 | 3300005327 | Ga0070658_10062405 | Ga0070658_100624054 | 136 |
| 90 | 3300005327 | Ga0070658_10205817 | Ga0070658_102058171 | 136 |
| 91 | 3300005327 | Ga0070658_10435509 | Ga0070658_104355092 | 136 |
| 92 | 3300005327 | Ga0070658_10855416 | Ga0070658_108554161 | 136 |
| 93 | 3300005327 | Ga0070658_11364002 | Ga0070658_113640021 | 136 |
| 94 | 3300005329 | Ga0070683_100700441 | Ga0070683_1007004412 | 136 |
| 95 | 3300005331 | Ga0070670_100000153 | Ga0070670_10000015333 | 136 |
| 96 | 3300005334 | Ga0068869_100310713 | Ga0068869_1003107131 | 136 |
| 97 | 3300005335 | Ga0070666_10049324 | Ga0070666_100493241 | 136 |
| 98 | 3300005335 | Ga0070666_10784620 | Ga0070666_107846201 | 136 |
| 99 | 3300005336 | Ga0070680_100523065 | Ga0070680_1005230652 | 136 |
| 100 | 3300005337 | Ga0070682_100645004 | Ga0070682_1006450042 | 136 |
| 101 | 3300005338 | Ga0068868_101109339 | Ga0068868_1011093391 | 136 |
| 102 | 3300005339 | Ga0070660_100000091 | Ga0070660_10000009154 | 136 |
| 103 | 3300005339 | Ga0070660_100003214 | Ga0070660_1000032145 | 136 |
| 104 | 3300005339 | Ga0070660_100005183 | Ga0070660_1000051837 | 136 |
| 105 | 3300005339 | Ga0070660_100105787 | Ga0070660_1001057872 | 136 |
| 106 | 3300005339 | Ga0070660_100215239 | Ga0070660_1002152392 | 136 |
| 107 | 3300005339 | Ga0070660_100291246 | Ga0070660_1002912461 | 136 |
| 108 | 3300005339 | Ga0070660_100405670 | Ga0070660_1004056702 | 136 |
| 109 | 3300005339 | Ga0070660_100525932 | Ga0070660_1005259322 | 136 |
| 110 | 3300005339 | Ga0070660_101554051 | Ga0070660_1015540511 | 136 |
| 111 | 3300005340 | Ga0070689_100156299 | Ga0070689_1001562992 | 136 |
| 112 | 3300005344 | Ga0070661_100000114 | Ga0070661_10000011444 | 136 |
| 113 | 3300005344 | Ga0070661_100257482 | Ga0070661_1002574822 | 136 |
| 114 | 3300005344 | Ga0070661_100260882 | Ga0070661_1002608822 | 136 |
| 115 | 3300005345 | Ga0070692_10000864 | Ga0070692_100008648 | 136 |
| 116 | 3300005345 | Ga0070692_10006531 | Ga0070692_100065316 | 136 |
| 117 | 3300005345 | Ga0070692_10092738 | Ga0070692_100927382 | 136 |
| 118 | 3300005347 | Ga0070668_100000508 | Ga0070668_1000005083 | 136 |
| 119 | 3300005347 | Ga0070668_100101489 | Ga0070668_1001014892 | 136 |
| 120 | 3300005347 | Ga0070668_100233842 | Ga0070668_1002338421 | 136 |
| 121 | 3300005347 | Ga0070668_100414274 | Ga0070668_1004142743 | 136 |
| 122 | 3300005353 | Ga0070669_100018321 | Ga0070669_1000183215 | 136 |
| 123 | 3300005353 | Ga0070669_100240396 | Ga0070669_1002403962 | 136 |
| 124 | 3300005355 | Ga0070671_100011703 | Ga0070671_1000117033 | 136 |
| 125 | 3300005366 | Ga0070659_100300222 | Ga0070659_1003002222 | 136 |
| 126 | 3300005366 | Ga0070659_100441852 | Ga0070659_1004418522 | 136 |
| 127 | 3300005367 | Ga0070667_100000146 | Ga0070667_10000014633 | 136 |
| 128 | 3300005367 | Ga0070667_100017069 | Ga0070667_1000170697 | 136 |
| 129 | 3300005367 | Ga0070667_100106892 | Ga0070667_1001068923 | 136 |
| 130 | 3300005455 | Ga0070663_100004745 | Ga0070663_1000047458 | 136 |
| 131 | 3300005458 | Ga0070681_10225718 | Ga0070681_102257181 | 136 |
| 132 | 3300005530 | Ga0070679_100006019 | Ga0070679_10000601910 | 136 |
| 133 | 3300005536 | Ga0070697_100037383 | Ga0070697_1000373832 | 136 |
| 134 | 3300005548 | Ga0070665_100001180 | Ga0070665_10000118021 | 136 |
| 135 | 3300005548 | Ga0070665_100024524 | Ga0070665_1000245241 | 136 |
| 136 | 3300005548 | Ga0070665_100190674 | Ga0070665_1001906743 | 136 |
| 137 | 3300005548 | Ga0070665_100529673 | Ga0070665_1005296732 | 136 |
| 138 | 3300005549 | Ga0070704_100997253 | Ga0070704_1009972532 | 136 |
| 139 | 3300005563 | Ga0068855_100000129 | Ga0068855_10000012924 | 136 |
| 140 | 3300005563 | Ga0068855_100365378 | Ga0068855_1003653782 | 136 |
| 141 | 3300005563 | Ga0068855_100406764 | Ga0068855_1004067641 | 136 |
| 142 | 3300005617 | Ga0068859_100003999 | Ga0068859_1000039994 | 136 |
| 143 | 3300005618 | Ga0068864_100000060 | Ga0068864_10000006021 | 136 |
| 144 | 3300005618 | Ga0068864_100000313 | Ga0068864_10000031320 | 136 |
| 145 | 3300005618 | Ga0068864_100551340 | Ga0068864_1005513402 | 136 |
| 146 | 3300005719 | Ga0068861_100068358 | Ga0068861_1000683582 | 136 |
| 147 | 3300005841 | Ga0068863_100000253 | Ga0068863_10000025332 | 136 |
| 148 | 3300005841 | Ga0068863_100029038 | Ga0068863_1000290384 | 136 |
| 149 | 3300005841 | Ga0068863_100155117 | Ga0068863_1001551174 | 136 |
| 150 | 3300005842 | Ga0068858_100006005 | Ga0068858_10000600513 | 136 |
| 151 | 3300005842 | Ga0068858_100015118 | Ga0068858_1000151185 | 136 |
| 152 | 3300005843 | Ga0068860_100000308 | Ga0068860_10000030833 | 136 |
| 153 | 3300005844 | Ga0068862_100000129 | Ga0068862_10000012964 | 136 |
| 154 | 3300005844 | Ga0068862_100033719 | Ga0068862_1000337193 | 136 |
| 155 | 3300005844 | Ga0068862_100036714 | Ga0068862_1000367144 | 136 |
| 156 | 3300005844 | Ga0068862_100380490 | Ga0068862_1003804903 | 136 |
| 157 | 3300006844 | Ga0075428_100052052 | Ga0075428_1000520526 | 136 |
| 158 | 3300006844 | Ga0075428_101764058 | Ga0075428_1017640581 | 136 |
| 159 | 3300006931 | Ga0097620_100003999 | Ga0097620_1000039994 | 136 |
| 160 | 3300009011 | Ga0105251_10203858 | Ga0105251_102038581 | 136 |
| 161 | 3300009092 | Ga0105250_10276180 | Ga0105250_102761801 | 136 |
| 162 | 3300009093 | Ga0105240_10002841 | Ga0105240_100028416 | 136 |
| 163 | 3300009094 | Ga0111539_12315632 | Ga0111539_123156321 | 136 |
| 164 | 3300009101 | Ga0105247_10044757 | Ga0105247_100447574 | 136 |
| 165 | 3300009147 | Ga0114129_10306648 | Ga0114129_103066483 | 136 |
| 166 | 3300009174 | Ga0105241_10588841 | Ga0105241_105888412 | 136 |
| 167 | 3300009177 | Ga0105248_10001464 | Ga0105248_1000146423 | 136 |
| 168 | 3300009177 | Ga0105248_10030470 | Ga0105248_100304703 | 136 |
| 169 | 3300009177 | Ga0105248_10063810 | Ga0105248_100638101 | 136 |
| 170 | 3300009177 | Ga0105248_10065608 | Ga0105248_100656081 | 136 |
| 171 | 3300009545 | Ga0105237_10139473 | Ga0105237_101394734 | 136 |
| 172 | 3300009551 | Ga0105238_10329084 | Ga0105238_103290842 | 136 |
| 173 | 3300009551 | Ga0105238_10696497 | Ga0105238_106964972 | 136 |
| 174 | 3300009551 | Ga0105238_10944878 | Ga0105238_109448782 | 136 |
| 175 | 3300009553 | Ga0105249_10001621 | Ga0105249_100016217 | 136 |
| 176 | 3300009553 | Ga0105249_10904149 | Ga0105249_109041491 | 136 |
| 177 | 3300009553 | Ga0105249_10924176 | Ga0105249_109241762 | 136 |
| 178 | 3300010375 | Ga0105239_11035792 | Ga0105239_110357921 | 136 |
| 179 | 3300013100 | Ga0157373_10032797 | Ga0157373_100327974 | 136 |
| 180 | 3300013100 | Ga0157373_10488764 | Ga0157373_104887641 | 136 |
| 181 | 3300013102 | Ga0157371_10003542 | Ga0157371_100035428 | 136 |
| 182 | 3300013102 | Ga0157371_10321079 | Ga0157371_103210791 | 136 |
| 183 | 3300013104 | Ga0157370_10058583 | Ga0157370_100585835 | 136 |
| 184 | 3300013105 | Ga0157369_10550901 | Ga0157369_105509012 | 136 |
| 185 | 3300013306 | Ga0163162_10060051 | Ga0163162_100600513 | 136 |
| 186 | 3300013306 | Ga0163162_10067112 | Ga0163162_100671126 | 136 |
| 187 | 3300013307 | Ga0157372_10712020 | Ga0157372_107120202 | 136 |
| 188 | 3300014968 | Ga0157379_10001749 | Ga0157379_100017493 | 136 |
| 189 | 3300014968 | Ga0157379_10053434 | Ga0157379_100534343 | 136 |
| 190 | 3300021384 | Ga0213876_10000128 | Ga0213876_1000012872 | 136 |
| 191 | 3300025735 | Ga0207713_1182576 | Ga0207713_11825761 | 136 |
| 192 | 3300025900 | Ga0207710_10025644 | Ga0207710_100256444 | 136 |
| 193 | 3300025903 | Ga0207680_10005545 | Ga0207680_100055453 | 136 |
| 194 | 3300025903 | Ga0207680_10034433 | Ga0207680_100344334 | 136 |
| 195 | 3300025904 | Ga0207647_10013059 | Ga0207647_100130597 | 136 |
| 196 | 3300025904 | Ga0207647_10078597 | Ga0207647_100785972 | 136 |
| 197 | 3300025907 | Ga0207645_10374027 | Ga0207645_103740272 | 136 |
| 198 | 3300025909 | Ga0207705_10000091 | Ga0207705_1000009164 | 136 |
| 199 | 3300025909 | Ga0207705_10002133 | Ga0207705_1000213315 | 136 |
| 200 | 3300025909 | Ga0207705_10031804 | Ga0207705_100318043 | 136 |
| 201 | 3300025909 | Ga0207705_10046271 | Ga0207705_100462712 | 136 |
| 202 | 3300025909 | Ga0207705_10155818 | Ga0207705_101558183 | 136 |
| 203 | 3300025909 | Ga0207705_10390175 | Ga0207705_103901752 | 136 |
| 204 | 3300025909 | Ga0207705_10978194 | Ga0207705_109781942 | 136 |
| 205 | 3300025912 | Ga0207707_10106417 | Ga0207707_101064172 | 136 |
| 206 | 3300025913 | Ga0207695_10004342 | Ga0207695_1000434211 | 136 |
| 207 | 3300025917 | Ga0207660_10000892 | Ga0207660_100008923 | 136 |
| 208 | 3300025917 | Ga0207660_10352638 | Ga0207660_103526381 | 136 |
| 209 | 3300025919 | Ga0207657_10000092 | Ga0207657_1000009237 | 136 |
| 210 | 3300025919 | Ga0207657_10000252 | Ga0207657_100002527 | 136 |
| 211 | 3300025919 | Ga0207657_10021780 | Ga0207657_100217802 | 136 |
| 212 | 3300025919 | Ga0207657_10037432 | Ga0207657_100374328 | 136 |
| 213 | 3300025919 | Ga0207657_10101948 | Ga0207657_101019481 | 136 |
| 214 | 3300025919 | Ga0207657_10227324 | Ga0207657_102273242 | 136 |
| 215 | 3300025919 | Ga0207657_10836287 | Ga0207657_108362871 | 136 |
| 216 | 3300025920 | Ga0207649_10000011 | Ga0207649_1000001118 | 136 |
| 217 | 3300025921 | Ga0207652_10000001 | Ga0207652_10000001505 | 136 |
| 218 | 3300025921 | Ga0207652_10000002 | Ga0207652_10000002223 | 136 |
| 219 | 3300025923 | Ga0207681_10032673 | Ga0207681_100326733 | 136 |
| 220 | 3300025924 | Ga0207694_11006596 | Ga0207694_110065961 | 136 |
| 221 | 3300025925 | Ga0207650_10000064 | Ga0207650_10000064110 | 136 |
| 222 | 3300025925 | Ga0207650_10037913 | Ga0207650_100379133 | 136 |
| 223 | 3300025931 | Ga0207644_10007618 | Ga0207644_100076183 | 136 |
| 224 | 3300025932 | Ga0207690_10110247 | Ga0207690_101102472 | 136 |
| 225 | 3300025932 | Ga0207690_10262857 | Ga0207690_102628571 | 136 |
| 226 | 3300025932 | Ga0207690_10622155 | Ga0207690_106221552 | 136 |
| 227 | 3300025941 | Ga0207711_10001333 | Ga0207711_1000133323 | 136 |
| 228 | 3300025941 | Ga0207711_10101198 | Ga0207711_101011983 | 136 |
| 229 | 3300025941 | Ga0207711_10130518 | Ga0207711_101305182 | 136 |
| 230 | 3300025941 | Ga0207711_10267369 | Ga0207711_102673693 | 136 |
| 231 | 3300025942 | Ga0207689_10306568 | Ga0207689_103065683 | 136 |
| 232 | 3300025944 | Ga0207661_10191456 | Ga0207661_101914562 | 136 |
| 233 | 3300025944 | Ga0207661_11005165 | Ga0207661_110051652 | 136 |
| 234 | 3300025945 | Ga0207679_11958534 | Ga0207679_119585341 | 136 |
| 235 | 3300025949 | Ga0207667_10001226 | Ga0207667_1000122629 | 136 |
| 236 | 3300025961 | Ga0207712_10001631 | Ga0207712_1000163114 | 136 |
| 237 | 3300025961 | Ga0207712_10611739 | Ga0207712_106117392 | 136 |
| 238 | 3300025972 | Ga0207668_10000154 | Ga0207668_1000015423 | 136 |
| 239 | 3300025972 | Ga0207668_10000379 | Ga0207668_100003794 | 136 |
| 240 | 3300025972 | Ga0207668_10011687 | Ga0207668_100116875 | 136 |
| 241 | 3300025972 | Ga0207668_10766026 | Ga0207668_107660261 | 136 |
| 242 | 3300025986 | Ga0207658_10000390 | Ga0207658_1000039039 | 136 |
| 243 | 3300025986 | Ga0207658_10011353 | Ga0207658_100113536 | 136 |
| 244 | 3300025986 | Ga0207658_10013056 | Ga0207658_100130563 | 136 |
| 245 | 3300026023 | Ga0207677_11330360 | Ga0207677_113303601 | 136 |
| 246 | 3300026035 | Ga0207703_10002812 | Ga0207703_100028126 | 136 |
| 247 | 3300026035 | Ga0207703_10013054 | Ga0207703_100130544 | 136 |
| 248 | 3300026067 | Ga0207678_10004734 | Ga0207678_100047349 | 136 |
| 249 | 3300026067 | Ga0207678_10035640 | Ga0207678_100356402 | 136 |
| 250 | 3300026067 | Ga0207678_10902949 | Ga0207678_109029492 | 136 |
| 251 | 3300026088 | Ga0207641_10000634 | Ga0207641_1000063432 | 136 |
| 252 | 3300026088 | Ga0207641_10325489 | Ga0207641_103254893 | 136 |
| 253 | 3300026095 | Ga0207676_10000131 | Ga0207676_1000013141 | 136 |
| 254 | 3300026118 | Ga0207675_100555640 | Ga0207675_1005556401 | 136 |
| 255 | 3300028379 | Ga0268266_10000812 | Ga0268266_1000081231 | 136 |
| 256 | 3300028379 | Ga0268266_10039346 | Ga0268266_100393462 | 136 |
| 257 | 3300028379 | Ga0268266_10873757 | Ga0268266_108737572 | 136 |
| 258 | 3300028380 | Ga0268265_10000933 | Ga0268265_1000093313 | 136 |
| 259 | 3300028380 | Ga0268265_10015897 | Ga0268265_100158973 | 136 |
| 260 | 3300028380 | Ga0268265_10016310 | Ga0268265_100163105 | 136 |
| 261 | 3300028381 | Ga0268264_10000360 | Ga0268264_1000036032 | 136 |
| 262 | 3300028381 | Ga0268264_10023875 | Ga0268264_100238752 | 136 |
| 263 | 3300028786 | Ga0307517_10129466 | Ga0307517_101294662 | 136 |
| 264 | 3300030521 | Ga0307511_10029315 | Ga0307511_100293154 | 136 |
| 265 | 3300031235 | Ga0265330_10001406 | Ga0265330_100014065 | 136 |
| 266 | 3300031548 | Ga0307408_100416516 | Ga0307408_1004165162 | 136 |
| 267 | 3300031548 | Ga0307408_101708080 | Ga0307408_1017080801 | 136 |
| 268 | 3300031728 | Ga0316578_10330489 | Ga0316578_103304892 | 136 |
| 269 | 3300031728 | Ga0316578_10859177 | Ga0316578_108591771 | 136 |
| 270 | 3300031731 | Ga0307405_10063635 | Ga0307405_100636352 | 136 |
| 271 | 3300031731 | Ga0307405_10442970 | Ga0307405_104429702 | 136 |
| 272 | 3300031733 | Ga0316577_10097213 | Ga0316577_100972131 | 136 |
| 273 | 3300031824 | Ga0307413_10942039 | Ga0307413_109420392 | 136 |
| 274 | 3300031995 | Ga0307409_100353438 | Ga0307409_1003534382 | 136 |
| 275 | 3300032002 | Ga0307416_100065406 | Ga0307416_1000654061 | 136 |
| 276 | 3300032002 | Ga0307416_101684733 | Ga0307416_1016847332 | 136 |
| 277 | 3300032005 | Ga0307411_10447155 | Ga0307411_104471553 | 136 |
| 278 | 3300032126 | Ga0307415_100407272 | Ga0307415_1004072722 | 136 |
| 279 | 3300032168 | Ga0316593_10151474 | Ga0316593_101514742 | 136 |
| 280 | 3300032168 | Ga0316593_10208232 | Ga0316593_102082321 | 136 |
| 281 | 3300035088 | Ga0373940_0030907 | Ga0373940_0030907_627_1052 | 136 |
| 282 | 3300035115 | Ga0373941_0408299 | Ga0373941_0408299_47_472 | 136 |
| 283 | 3300035117 | Ga0373953_0036807 | Ga0373953_0036807_738_1175 | 136 |
| 284 | 3300035118 | Ga0373954_0025166 | Ga0373954_0025166_834_1271 | 136 |
| 285 | 3300035120 | Ga0373957_0168912 | Ga0373957_0168912_453_890 | 136 |
| 286 | 3300036401 | Ga0373937_0046952 | Ga0373937_0046952_2637_3074 | 136 |
| 287 | 3300036647 | Ga0316582_0148275 | Ga0316582_0148275_123_560 | 136 |
| 288 | 3300036647 | Ga0316582_0170156 | Ga0316582_0170156_496_936 | 136 |
| 289 | 3300036712 | Ga0316584_0531105 | Ga0316584_0531105_301_741 | 136 |
| 290 | 3300037068 | Ga0373925_0147638 | Ga0373925_0147638_227_652 | 136 |
| 291 | 3300037312 | Ga0395899_0000132 | Ga0395899_0000132_59306_59761 | 136 |
| 292 | 3300037312 | Ga0395899_0066959 | Ga0395899_0066959_1757_2194 | 136 |
| 293 | 3300037312 | Ga0395899_0601521 | Ga0395899_0601521_151_594 | 136 |
| 294 | 3300037418 | Ga0395900_0000477 | Ga0395900_0000477_11784_12239 | 136 |
| 295 | 3300037418 | Ga0395900_0397263 | Ga0395900_0397263_90_527 | 136 |
| 296 | 3300037466 | Ga0395898_0010152 | Ga0395898_0010152_1639_2094 | 136 |
| 297 | 3300037466 | Ga0395898_0039484 | Ga0395898_0039484_2220_2705 | 136 |
| 298 | 3300037466 | Ga0395898_0191401 | Ga0395898_0191401_172_609 | 136 |
| 299 | 3300037466 | Ga0395898_0353269 | Ga0395898_0353269_251_694 | 136 |
| 300 | 3300037466 | Ga0395898_0455357 | Ga0395898_0455357_139_576 | 136 |
| 301 | 3300037466 | Ga0395898_0837604 | Ga0395898_0837604_93_530 | 136 |
| 302 | 3300037471 | Ga0395905_0022794 | Ga0395905_0022794_3576_4016 | 136 |
| 303 | 3300037471 | Ga0395905_0073352 | Ga0395905_0073352_278_721 | 136 |
| 304 | 3300037471 | Ga0395905_0209922 | Ga0395905_0209922_265_720 | 136 |
| 305 | 3300037471 | Ga0395905_0439087 | Ga0395905_0439087_430_915 | 136 |
| 306 | 3300037471 | Ga0395905_0910252 | Ga0395905_0910252_145_582 | 136 |
| 307 | 3300037471 | Ga0395905_1371470 | Ga0395905_1371470_149_592 | 136 |
| 308 | 3300037588 | Ga0316581_0225646 | Ga0316581_0225646_60_500 | 136 |
| 309 | 3300037853 | Ga0436364_1207386 | Ga0436364_1207386_295_735 | 136 |
| 310 | 3300038443 | Ga0395901_0000275 | Ga0395901_0000275_52405_52860 | 136 |
| 311 | 3300038443 | Ga0395901_0016131 | Ga0395901_0016131_5860_6303 | 136 |
| 312 | 3300038443 | Ga0395901_0060741 | Ga0395901_0060741_3094_3579 | 136 |
| 313 | 3300038443 | Ga0395901_1273440 | Ga0395901_1273440_221_661 | 136 |
| 314 | 3300039437 | Ga0436365_1686123 | Ga0436365_1686123_29063_29488 | 136 |
| 315 | 3300039453 | Ga0436362_1287140 | Ga0436362_1287140_5662_6087 | 136 |
| 316 | 3300042005 | Ga0439448_0001546 | Ga0439448_0001546_4991_5434 | 136 |
| 317 | 3300042006 | Ga0439432_009200 | Ga0439432_009200_2655_3092 | 136 |
| 318 | 3300042157 | Ga0439458_0000459 | Ga0439458_0000459_6641_7084 | 136 |
| 319 | 3300042876 | Ga0451577_0934231 | Ga0451577_0934231_321_734 | 136 |
| 320 | 3300044673 | Ga0453683_0111208 | Ga0453683_0111208_1166_1579 | 136 |
| 321 | 3300044673 | Ga0453683_0417518 | Ga0453683_0417518_250_663 | 136 |
| 322 | 3300044694 | Ga0466963_0078031 | Ga0466963_0078031_1193_1630 | 136 |
| 323 | 3300045051 | Ga0451576_0070823 | Ga0451576_0070823_2180_2593 | 136 |
| 324 | 3300045976 | Ga0466967_1872840 | Ga0466967_1872840_31_468 | 136 |
| 325 | 3300046459 | Ga0495629_0166761 | Ga0495629_0166761_548_976 | 136 |
| 326 | 3300046491 | Ga0495584_0194603 | Ga0495584_0194603_328_864 | 136 |
| 327 | 3300046492 | Ga0495585_0065370 | Ga0495585_0065370_932_1375 | 136 |
| 328 | 3300046515 | Ga0495620_0069732 | Ga0495620_0069732_527_955 | 136 |
| 329 | 3300046520 | Ga0495637_0135881 | Ga0495637_0135881_421_849 | 136 |
| 330 | 3300046530 | Ga0495654_0211350 | Ga0495654_0211350_292_720 | 136 |
| 331 | 3300046538 | Ga0495609_0080733 | Ga0495609_0080733_370_798 | 136 |
| 332 | 3300046542 | Ga0495597_0002700 | Ga0495597_0002700_1107_1535 | 136 |
| 333 | 3300046557 | Ga0495622_0033161 | Ga0495622_0033161_652_1080 | 136 |
| 334 | 3300046616 | Ga0495668_0061502 | Ga0495668_0061502_233_655 | 136 |
| 335 | 3300046660 | Ga0495625_0285166 | Ga0495625_0285166_394_822 | 136 |
| 336 | 3300046664 | Ga0495659_0086471 | Ga0495659_0086471_460_903 | 136 |
| 337 | 3300046679 | Ga0495623_0155018 | Ga0495623_0155018_213_650 | 136 |
| 338 | 3300046684 | Ga0495669_0095156 | Ga0495669_0095156_758_1183 | 136 |
| 339 | 3300046684 | Ga0495669_0108327 | Ga0495669_0108327_377_817 | 136 |
| 340 | 3300046684 | Ga0495669_0181457 | Ga0495669_0181457_231_674 | 136 |
| 341 | 3300047315 | Ga0495581_0135881 | Ga0495581_0135881_821_1261 | 136 |
| 342 | 3300047443 | Ga0495687_010917 | Ga0495687_010917_3992_4420 | 136 |
| 343 | 3300047673 | Ga0495593_0208970 | Ga0495593_0208970_536_964 | 136 |
| 344 | 3300048088 | Ga0495602_0376970 | Ga0495602_0376970_84_521 | 136 |
| 345 | 3300048904 | Ga0496101_1168677 | Ga0496101_1168677_57_494 | 136 |
| 346 | 3300048905 | Ga0496102_0297484 | Ga0496102_0297484_73_501 | 136 |
| 347 | 3300048906 | Ga0496103_0180765 | Ga0496103_0180765_725_1204 | 136 |
| 348 | 3300048919 | Ga0496116_0294359 | Ga0496116_0294359_260_739 | 136 |
| 349 | 3300048920 | Ga0496117_0041016 | Ga0496117_0041016_935_1414 | 136 |
| 350 | 3300048921 | Ga0496118_0002955 | Ga0496118_0002955_5907_6386 | 136 |
| 351 | 3300048922 | Ga0496119_0023841 | Ga0496119_0023841_3610_4089 | 136 |
| 352 | 3300048923 | Ga0496120_0094375 | Ga0496120_0094375_1024_1503 | 136 |
| 353 | 3300048924 | Ga0496121_0000152 | Ga0496121_0000152_101880_102359 | 136 |
| 354 | 3300049460 | Ga0495682_0073086 | Ga0495682_0073086_499_927 | 136 |
| 355 | 3300049570 | Ga0501033_0771981 | Ga0501033_0771981_195_620 | 136 |
| 356 | 3300049822 | Ga0501035_0866030 | Ga0501035_0866030_127_549 | 136 |
| 357 | 3300050507 | nmdc:mga05p37_247944_c1 | nmdc:mga05p37_247944_c1_244_681 | 136 |
| 358 | 3300050508 | nmdc:mga09592_644456_c1 | nmdc:mga09592_644456_c1_13_450 | 136 |
| 359 | 3300053080 | Ga0500635_0000208 | Ga0500635_0000208_8858_9286 | 136 |
| 360 | 3300053087 | Ga0500643_004190 | Ga0500643_004190_68_490 | 136 |
| 361 | 3300053087 | Ga0500643_011525 | Ga0500643_011525_32_454 | 136 |
| 362 | 3300053093 | Ga0500651_0386445 | Ga0500651_0386445_16_444 | 136 |
| 363 | 3300053104 | Ga0500556_0021116 | Ga0500556_0021116_100_522 | 136 |
| 364 | 3300053109 | Ga0500569_033716 | Ga0500569_033716_825_1253 | 136 |
| 365 | 3300053119 | Ga0500595_001609 | Ga0500595_001609_11278_11706 | 136 |
| 366 | 3300053119 | Ga0500595_029670 | Ga0500595_029670_49_471 | 136 |
| 367 | 3300053122 | Ga0500608_032746 | Ga0500608_032746_206_634 | 136 |
| 368 | 3300053130 | Ga0500642_0131874 | Ga0500642_0131874_69_491 | 136 |
| 369 | 3300053130 | Ga0500642_0262690 | Ga0500642_0262690_204_632 | 136 |
| 370 | 3300053130 | Ga0500642_0311360 | Ga0500642_0311360_261_689 | 136 |
| 371 | 3300053134 | Ga0500658_0023853 | Ga0500658_0023853_1618_2046 | 136 |
| 372 | 3300053136 | Ga0500559_0013592 | Ga0500559_0013592_1521_1949 | 136 |
| 373 | 3300053142 | Ga0500577_0499962 | Ga0500577_0499962_90_518 | 136 |
| 374 | 3300053148 | Ga0500590_027208 | Ga0500590_027208_2124_2552 | 136 |
| 375 | 3300053154 | Ga0500619_114286 | Ga0500619_114286_364_792 | 136 |
| 376 | 3300053163 | Ga0500639_096117 | Ga0500639_096117_106_534 | 136 |
| 377 | 3300053177 | Ga0500636_0034993 | Ga0500636_0034993_849_1277 | 136 |
| 378 | 3300053178 | Ga0500637_0052695 | Ga0500637_0052695_36_464 | 136 |
| 379 | 3300053725 | Ga0500576_208614 | Ga0500576_208614_25_453 | 136 |
| 380 | 3300053729 | Ga0500625_006868 | Ga0500625_006868_3982_4410 | 136 |
| 381 | 3300053735 | Ga0500596_001848 | Ga0500596_001848_3434_3862 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nye-assembly1.cif.gz_A | crystal structure of osmc from e. coli | 0.9585 | 1 | 136 |
| 1nye-assembly2.cif.gz_C | crystal structure of osmc from e. coli | 0.9529 | 1 | 136 |
| 1nye-assembly1.cif.gz_A | crystal structure of osmc from e. coli | 0.9517 | 1 | 136 |
| 1nye-assembly2.cif.gz_D | crystal structure of osmc from e. coli | 0.9508 | 1 | 135 |
| 1qwi-assembly1.cif.gz_B | crystal structure of e. coli osmc | 0.947 | 1 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9554 | 1 | 135 | 3.30.300.20 |
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9418 | 1 | 135 | 3.30.300.20 |
| af_Q55EI4_11_156_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9119 | 4 | 136 | 3.30.300.20 |
| 1ml8A02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9009 | 45 | 136 | 3.30.300.20 |
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8932 | 1 | 136 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257KYW8-F1-model_v4 | OsmC family peroxiredoxin | 0.988 | 42 | 136 |
GO:0004601
GO:0006979 |
| AF-A0A4Q3U8V3-F1-model_v4 | deleted | 0.9865 | 1 | 64 |
|
| AF-A0A4R5CUL2-F1-model_v4 | OsmC family peroxiredoxin | 0.9842 | 1 | 136 |
GO:0004601
GO:0006979 |
| AF-A0A520BIH8-F1-model_v4 | OsmC family peroxiredoxin | 0.9841 | 54 | 136 |
GO:0004601
GO:0006979 |
| AF-A0A2W5FXT9-F1-model_v4 | OsmC family peroxiredoxin | 0.9833 | 43 | 136 |
GO:0004601
GO:0006979 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar