F429001

General Info

Members Datasets Scaffolds Average Seq Length
381 202 379 143

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10541550|Ga0307413_105415501
Length 164
Sequence MAQETIGGPAVQLGGEQKEEGMITRTARARYQGMGKDGQGWVSTQSGVLSEQRYAFGTRFENEPGTNPEELIAAAHAGCFTMALSFALAKEGITEGTLETEARVTLEKEGEGFRIGRSDLTLDANVPLDEDRLRELAEEAKANCPVSKLLNAEMALEVRARQAA

Samples

Sample ID Description Type Environment
1 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
126 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
127 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
172 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
173 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
183 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
184 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
185 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
186 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
187 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
188 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
189 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
190 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
193 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
194 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
195 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
196 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
197 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
198 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
199 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
200 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
201 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.52
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.56
Nodule 0
Rhizoplane 0.79
Rhizosphere 89.24
Stem 0
Stem Tuber 0
Unclassified 3.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1032790 3300002739 Unclassified 579
2 rootH2_10217621 3300003320 Bacteria 2422
3 rootL2_10102593 3300003322 Bacteria 2930
4 Ga0070658_10000571 3300005327 Bacteria 32039
5 Ga0070658_10002861 3300005327 Bacteria 14332
6 Ga0070658_10010980 3300005327 Bacteria 7259
7 Ga0070658_10062405 3300005327 Bacteria 3037
8 Ga0070658_10205817 3300005327 Bacteria 1661
9 Ga0070658_10435509 3300005327 Bacteria 1129
10 Ga0070658_10855416 3300005327 Bacteria 790
11 Ga0070658_11364002 3300005327 Bacteria 615
12 Ga0070683_100700441 3300005329 Bacteria 970
13 Ga0070670_100000153 3300005331 Bacteria 63436
14 Ga0068869_100310713 3300005334 Bacteria 1276
15 Ga0070666_10049324 3300005335 Bacteria 2829
16 Ga0070666_10784620 3300005335 Bacteria 701
17 Ga0070680_100523065 3300005336 Bacteria 1016
18 Ga0070682_100645004 3300005337 Bacteria 842
19 Ga0068868_101109339 3300005338 Bacteria 728
20 Ga0070660_100000091 3300005339 Bacteria 54397
21 Ga0070660_100003214 3300005339 Bacteria 11223
22 Ga0070660_100005183 3300005339 Bacteria 9014
23 Ga0070660_100105787 3300005339 Bacteria 2234
24 Ga0070660_100215239 3300005339 Bacteria 1560
25 Ga0070660_100291246 3300005339 Bacteria 1337
26 Ga0070660_100405670 3300005339 Bacteria 1127
27 Ga0070660_100525932 3300005339 Bacteria 985
28 Ga0070660_101554051 3300005339 Bacteria 563
29 Ga0070689_100156299 3300005340 Bacteria 1841
30 Ga0070661_100000114 3300005344 Bacteria 67216
31 Ga0070661_100257482 3300005344 Bacteria 1348
32 Ga0070661_100260882 3300005344 Bacteria 1340
33 Ga0070661_100981028 3300005344 Bacteria 700
34 Ga0070692_10000864 3300005345 Bacteria 10185
35 Ga0070692_10006531 3300005345 Bacteria 5071
36 Ga0070692_10027193 3300005345 Bacteria 2833
37 Ga0070692_10092738 3300005345 Bacteria 1644
38 Ga0070668_100000508 3300005347 Bacteria 25733
39 Ga0070668_100101489 3300005347 Bacteria 2280
40 Ga0070668_100233842 3300005347 Bacteria 1520
41 Ga0070668_100414274 3300005347 Bacteria 1153
42 Ga0070669_100018321 3300005353 Bacteria 5004
43 Ga0070669_100240396 3300005353 Bacteria 1438
44 Ga0070671_100011703 3300005355 Bacteria 7056
45 Ga0070659_100300222 3300005366 Bacteria 1339
46 Ga0070659_100441852 3300005366 Bacteria 1102
47 Ga0070667_100000146 3300005367 Bacteria 88847
48 Ga0070667_100017069 3300005367 Bacteria 6012
49 Ga0070667_100106892 3300005367 Bacteria 2422
50 Ga0070663_100004745 3300005455 Bacteria 8021
51 Ga0070681_10225718 3300005458 Bacteria 1788
52 Ga0070679_100006019 3300005530 Bacteria 11286
53 Ga0070697_100037383 3300005536 Bacteria 3922
54 Ga0070665_100001180 3300005548 Bacteria 31967
55 Ga0070665_100024524 3300005548 Bacteria 6077
56 Ga0070665_100190674 3300005548 Bacteria 2051
57 Ga0070665_100529673 3300005548 Bacteria 1190
58 Ga0070704_100997253 3300005549 Bacteria 757
59 Ga0068855_100000129 3300005563 Bacteria 96519
60 Ga0068855_100015869 3300005563 Bacteria 9063
61 Ga0068855_100365378 3300005563 Bacteria 1587
62 Ga0068855_100406764 3300005563 Bacteria 1491
63 Ga0068855_100454843 3300005563 Bacteria 1396
64 Ga0068855_100630304 3300005563 Bacteria 1153
65 Ga0070664_100090827 3300005564 Bacteria 2643
66 Ga0068857_100942973 3300005577 Bacteria 829
67 Ga0068854_100000359 3300005578 Bacteria 29216
68 Ga0068856_100047623 3300005614 Bacteria 4224
69 Ga0068856_101125973 3300005614 Bacteria 802
70 Ga0068852_100000619 3300005616 Bacteria 23305
71 Ga0068859_100003999 3300005617 Bacteria 15025
72 Ga0068864_100000060 3300005618 Bacteria 124506
73 Ga0068864_100000313 3300005618 Bacteria 42907
74 Ga0068864_100551340 3300005618 Bacteria 1114
75 Ga0068861_100068358 3300005719 Bacteria 2745
76 Ga0068863_100000253 3300005841 Bacteria 56367
77 Ga0068863_100029038 3300005841 Bacteria 5282
78 Ga0068863_100155117 3300005841 Bacteria 2192
79 Ga0068858_100006005 3300005842 Bacteria 11860
80 Ga0068858_100015118 3300005842 Bacteria 7259
81 Ga0068860_100000308 3300005843 Bacteria 67784
82 Ga0068862_100000129 3300005844 Bacteria 88141
83 Ga0068862_100033719 3300005844 Bacteria 4330
84 Ga0068862_100036714 3300005844 Bacteria 4153
85 Ga0068862_100380490 3300005844 Bacteria 1316
86 Ga0075370_10890353 3300006353 Bacteria 544
87 Ga0075428_100052052 3300006844 Bacteria 4489
88 Ga0075428_101764058 3300006844 Bacteria 645
89 Ga0097620_100003999 3300006931 Bacteria 15025
90 Ga0105251_10203858 3300009011 Bacteria 891
91 Ga0105250_10276180 3300009092 Bacteria 722
92 Ga0105240_10002841 3300009093 Bacteria 27371
93 Ga0105240_10044710 3300009093 Bacteria 5624
94 Ga0111539_12315632 3300009094 Unclassified 623
95 Ga0105247_10044757 3300009101 Bacteria 2715
96 Ga0114129_10306648 3300009147 Bacteria 2114
97 Ga0105241_10588841 3300009174 Bacteria 1003
98 Ga0105248_10001464 3300009177 Bacteria 26304
99 Ga0105248_10030470 3300009177 Bacteria 6023
100 Ga0105248_10063810 3300009177 Bacteria 4134
101 Ga0105248_10065608 3300009177 Bacteria 4076
102 Ga0105237_10139473 3300009545 Bacteria 2419
103 Ga0105237_10364473 3300009545 Bacteria 1449
104 Ga0105238_10329084 3300009551 Bacteria 1514
105 Ga0105238_10696497 3300009551 Bacteria 1028
106 Ga0105238_10739151 3300009551 Bacteria 997
107 Ga0105238_10944878 3300009551 Bacteria 882
108 Ga0105249_10001621 3300009553 Bacteria 19708
109 Ga0105249_10904149 3300009553 Bacteria 950
110 Ga0105249_10924176 3300009553 Bacteria 940
111 Ga0105239_11035792 3300010375 Bacteria 944
112 Ga0157373_10032797 3300013100 Bacteria 3737
113 Ga0157373_10488764 3300013100 Bacteria 888
114 Ga0157371_10003542 3300013102 Bacteria 14084
115 Ga0157371_10321079 3300013102 Bacteria 1124
116 Ga0157370_10058583 3300013104 Bacteria 3661
117 Ga0157369_10550901 3300013105 Bacteria 1192
118 Ga0157378_12904182 3300013297 Bacteria 531
119 Ga0163162_10060051 3300013306 Bacteria 3835
120 Ga0163162_10067112 3300013306 Bacteria 3637
121 Ga0157372_10712020 3300013307 Bacteria 1168
122 Ga0157379_10001749 3300014968 Bacteria 17962
123 Ga0157379_10053434 3300014968 Bacteria 3608
124 Ga0213876_10000128 3300021384 Bacteria 82771
125 Ga0207713_1182576 3300025735 Bacteria 654
126 Ga0207710_10025644 3300025900 Bacteria 2544
127 Ga0207680_10005545 3300025903 Bacteria 6033
128 Ga0207680_10034433 3300025903 Bacteria 2898
129 Ga0207647_10013059 3300025904 Bacteria 5771
130 Ga0207647_10019114 3300025904 Bacteria 4613
131 Ga0207647_10078597 3300025904 Bacteria 1981
132 Ga0207647_10271435 3300025904 Bacteria 970
133 Ga0207645_10374027 3300025907 Bacteria 955
134 Ga0207705_10000004 3300025909 Bacteria 705756
135 Ga0207705_10000091 3300025909 Bacteria 110768
136 Ga0207705_10002133 3300025909 Bacteria 15351
137 Ga0207705_10031804 3300025909 Bacteria 3769
138 Ga0207705_10046271 3300025909 Bacteria 3126
139 Ga0207705_10155818 3300025909 Bacteria 1714
140 Ga0207705_10390175 3300025909 Bacteria 1076
141 Ga0207705_10978194 3300025909 Bacteria 654
142 Ga0207707_10106417 3300025912 Bacteria 2452
143 Ga0207695_10004342 3300025913 Bacteria 19417
144 Ga0207695_10027764 3300025913 Bacteria 6297
145 Ga0207671_10940969 3300025914 Bacteria 682
146 Ga0207660_10000892 3300025917 Bacteria 19647
147 Ga0207660_10352638 3300025917 Bacteria 1179
148 Ga0207657_10000092 3300025919 Bacteria 85665
149 Ga0207657_10000252 3300025919 Bacteria 57036
150 Ga0207657_10021780 3300025919 Bacteria 6022
151 Ga0207657_10037432 3300025919 Bacteria 4332
152 Ga0207657_10101948 3300025919 Bacteria 2381
153 Ga0207657_10227324 3300025919 Bacteria 1493
154 Ga0207657_10836287 3300025919 Bacteria 711
155 Ga0207649_10000011 3300025920 Bacteria 266219
156 Ga0207649_11347282 3300025920 Bacteria 565
157 Ga0207652_10000001 3300025921 Bacteria 1006643
158 Ga0207652_10000002 3300025921 Bacteria 878035
159 Ga0207681_10032673 3300025923 Bacteria 3408
160 Ga0207694_10508710 3300025924 Bacteria 1009
161 Ga0207694_11006596 3300025924 Bacteria 705
162 Ga0207650_10000064 3300025925 Bacteria 142969
163 Ga0207650_10037913 3300025925 Bacteria 3515
164 Ga0207644_10007618 3300025931 Bacteria 7059
165 Ga0207690_10110247 3300025932 Bacteria 1981
166 Ga0207690_10262857 3300025932 Bacteria 1338
167 Ga0207690_10622155 3300025932 Bacteria 883
168 Ga0207711_10001333 3300025941 Bacteria 23353
169 Ga0207711_10101198 3300025941 Bacteria 2550
170 Ga0207711_10130518 3300025941 Bacteria 2253
171 Ga0207711_10267369 3300025941 Bacteria 1573
172 Ga0207689_10306568 3300025942 Bacteria 1316
173 Ga0207661_10191456 3300025944 Bacteria 1793
174 Ga0207661_11005165 3300025944 Bacteria 768
175 Ga0207679_10474340 3300025945 Bacteria 1113
176 Ga0207679_11958534 3300025945 Bacteria 534
177 Ga0207667_10001226 3300025949 Bacteria 32150
178 Ga0207667_10188761 3300025949 Bacteria 2115
179 Ga0207667_10342442 3300025949 Bacteria 1526
180 Ga0207712_10001631 3300025961 Bacteria 15131
181 Ga0207712_10611739 3300025961 Bacteria 943
182 Ga0207668_10000154 3300025972 Bacteria 47517
183 Ga0207668_10000379 3300025972 Bacteria 28234
184 Ga0207668_10011687 3300025972 Bacteria 5343
185 Ga0207668_10766026 3300025972 Bacteria 852
186 Ga0207640_10002692 3300025981 Bacteria 9510
187 Ga0207658_10000390 3300025986 Bacteria 42467
188 Ga0207658_10011353 3300025986 Bacteria 6061
189 Ga0207658_10013056 3300025986 Bacteria 5673
190 Ga0207677_11330360 3300026023 Bacteria 660
191 Ga0207703_10002812 3300026035 Bacteria 14851
192 Ga0207703_10013054 3300026035 Bacteria 6474
193 Ga0207639_10742300 3300026041 Bacteria 912
194 Ga0207678_10004734 3300026067 Bacteria 12223
195 Ga0207678_10035640 3300026067 Bacteria 4332
196 Ga0207678_10902949 3300026067 Bacteria 781
197 Ga0207702_10265264 3300026078 Bacteria 1618
198 Ga0207702_12408499 3300026078 Bacteria 513
199 Ga0207641_10000634 3300026088 Bacteria 38355
200 Ga0207641_10325489 3300026088 Bacteria 1458
201 Ga0207676_10000131 3300026095 Bacteria 66092
202 Ga0207676_10857254 3300026095 Bacteria 889
203 Ga0207674_10907915 3300026116 Bacteria 849
204 Ga0207674_11510683 3300026116 Bacteria 641
205 Ga0207675_100555640 3300026118 Bacteria 1147
206 Ga0207698_10000177 3300026142 Bacteria 39133
207 Ga0268266_10000812 3300028379 Bacteria 41107
208 Ga0268266_10039346 3300028379 Bacteria 4027
209 Ga0268266_10873757 3300028379 Bacteria 869
210 Ga0268265_10000933 3300028380 Bacteria 26903
211 Ga0268265_10015897 3300028380 Bacteria 5162
212 Ga0268265_10016310 3300028380 Bacteria 5100
213 Ga0268264_10000360 3300028381 Bacteria 67798
214 Ga0268264_10023875 3300028381 Bacteria 4987
215 Ga0307517_10129466 3300028786 Bacteria 1824
216 Ga0307511_10029315 3300030521 Bacteria 4973
217 Ga0265330_10001406 3300031235 Bacteria 14087
218 Ga0307408_100028017 3300031548 Bacteria 3889
219 Ga0307408_100416516 3300031548 Bacteria 1157
220 Ga0307408_101401915 3300031548 Bacteria 658
221 Ga0307408_101469325 3300031548 Bacteria 644
222 Ga0307408_101559765 3300031548 Bacteria 626
223 Ga0307408_101708080 3300031548 Bacteria 600
224 Ga0316578_10330489 3300031728 Unclassified 909
225 Ga0316578_10859177 3300031728 Unclassified 525
226 Ga0307405_10036428 3300031731 Bacteria 2948
227 Ga0307405_10063635 3300031731 Bacteria 2341
228 Ga0307405_10442970 3300031731 Bacteria 1028
229 Ga0316577_10097213 3300031733 Bacteria 1650
230 Ga0307413_10066875 3300031824 Bacteria 2244
231 Ga0307413_10541550 3300031824 Bacteria 942
232 Ga0307413_10647256 3300031824 Bacteria 871
233 Ga0307413_10942039 3300031824 Bacteria 736
234 Ga0307410_10075371 3300031852 Bacteria 2352
235 Ga0307410_10081925 3300031852 Bacteria 2268
236 Ga0307410_10123999 3300031852 Bacteria 1888
237 Ga0307410_10171356 3300031852 Bacteria 1636
238 Ga0307410_11608028 3300031852 Bacteria 574
239 Ga0307406_10030556 3300031901 Bacteria 3272
240 Ga0307406_10241758 3300031901 Bacteria 1354
241 Ga0307407_10019566 3300031903 Bacteria 3450
242 Ga0307407_10076171 3300031903 Bacteria 2013
243 Ga0307407_10278331 3300031903 Bacteria 1158
244 Ga0307412_10278081 3300031911 Bacteria 1313
245 Ga0307412_10449059 3300031911 Bacteria 1062
246 Ga0307412_12097707 3300031911 Bacteria 525
247 Ga0307409_100036198 3300031995 Bacteria 3625
248 Ga0307409_100085324 3300031995 Bacteria 2566
249 Ga0307409_100214916 3300031995 Bacteria 1731
250 Ga0307409_100260400 3300031995 Bacteria 1591
251 Ga0307409_100353438 3300031995 Bacteria 1388
252 Ga0307409_101180500 3300031995 Bacteria 788
253 Ga0307416_100022142 3300032002 Bacteria 4580
254 Ga0307416_100065406 3300032002 Bacteria 2988
255 Ga0307416_101030566 3300032002 Bacteria 926
256 Ga0307416_101246416 3300032002 Bacteria 849
257 Ga0307416_101684733 3300032002 Bacteria 739
258 Ga0307414_10046105 3300032004 Bacteria 2989
259 Ga0307414_10203196 3300032004 Bacteria 1613
260 Ga0307411_10026629 3300032005 Bacteria 3484
261 Ga0307411_10249915 3300032005 Bacteria 1393
262 Ga0307411_10306206 3300032005 Bacteria 1276
263 Ga0307411_10447155 3300032005 Bacteria 1080
264 Ga0307411_10753628 3300032005 Bacteria 853
265 Ga0307411_11273127 3300032005 Bacteria 669
266 Ga0307411_12020968 3300032005 Unclassified 538
267 Ga0307415_100174784 3300032126 Bacteria 1679
268 Ga0307415_100407272 3300032126 Bacteria 1163
269 Ga0307415_100693517 3300032126 Bacteria 918
270 Ga0307415_101388107 3300032126 Bacteria 668
271 Ga0316593_10151474 3300032168 Bacteria 844
272 Ga0316593_10208232 3300032168 Bacteria 724
273 Ga0373940_0030907 3300035088 Bacteria 1427
274 Ga0373941_0408299 3300035115 Bacteria 563
275 Ga0373953_0036807 3300035117 Bacteria 1929
276 Ga0373954_0025166 3300035118 Bacteria 2719
277 Ga0373957_0168912 3300035120 Bacteria 903
278 Ga0373937_0046952 3300036401 Bacteria 3950
279 Ga0316582_0148275 3300036647 Bacteria 1585
280 Ga0316582_0170156 3300036647 Bacteria 1479
281 Ga0316582_1210130 3300036647 Bacteria 514
282 Ga0316584_0191464 3300036712 Bacteria 1512
283 Ga0316584_0531105 3300036712 Bacteria 823
284 Ga0373925_0147638 3300037068 Bacteria 1844
285 Ga0395899_0000132 3300037312 Bacteria 115455
286 Ga0395899_0066959 3300037312 Bacteria 2636
287 Ga0395899_0601521 3300037312 Bacteria 700
288 Ga0395900_0000477 3300037418 Bacteria 56791
289 Ga0395900_0397263 3300037418 Bacteria 1343
290 Ga0395898_0010152 3300037466 Bacteria 9856
291 Ga0395898_0039484 3300037466 Bacteria 4672
292 Ga0395898_0191401 3300037466 Bacteria 1954
293 Ga0395898_0353269 3300037466 Bacteria 1402
294 Ga0395898_0455357 3300037466 Bacteria 1218
295 Ga0395898_0837604 3300037466 Bacteria 859
296 Ga0395905_0022794 3300037471 Bacteria 5920
297 Ga0395905_0073352 3300037471 Bacteria 3208
298 Ga0395905_0209922 3300037471 Bacteria 1824
299 Ga0395905_0439087 3300037471 Bacteria 1202
300 Ga0395905_0910252 3300037471 Bacteria 782
301 Ga0395905_1371470 3300037471 Bacteria 611
302 Ga0316581_0225646 3300037588 Bacteria 576
303 Ga0436364_1207386 3300037853 Bacteria 826
304 Ga0395901_0000275 3300038443 Bacteria 63659
305 Ga0395901_0016131 3300038443 Bacteria 7609
306 Ga0395901_0060741 3300038443 Bacteria 3933
307 Ga0395901_1273440 3300038443 Bacteria 698
308 Ga0436365_1686123 3300039437 Bacteria 49596
309 Ga0436362_1287140 3300039453 Bacteria 68344
310 Ga0439448_0001546 3300042005 Bacteria 6014
311 Ga0439432_009200 3300042006 Bacteria 3449
312 Ga0439432_158888 3300042006 Bacteria 662
313 Ga0439449_0043099 3300042007 Bacteria 1676
314 Ga0439449_0364700 3300042007 Bacteria 547
315 Ga0439458_0000459 3300042157 Bacteria 10339
316 Ga0451577_0934231 3300042876 Bacteria 780
317 Ga0453683_0111208 3300044673 Bacteria 1723
318 Ga0453683_0417518 3300044673 Bacteria 866
319 Ga0466963_0078031 3300044694 Bacteria 2238
320 Ga0451576_0070823 3300045051 Bacteria 3629
321 Ga0466967_1872840 3300045976 Bacteria 597
322 Ga0495629_0166761 3300046459 Bacteria 1529
323 Ga0495584_0194603 3300046491 Bacteria 1031
324 Ga0495585_0065370 3300046492 Bacteria 1993
325 Ga0495620_0069732 3300046515 Bacteria 1441
326 Ga0495637_0135881 3300046520 Bacteria 936
327 Ga0495654_0211350 3300046530 Bacteria 825
328 Ga0495609_0080733 3300046538 Bacteria 1422
329 Ga0495597_0002700 3300046542 Bacteria 10949
330 Ga0495622_0033161 3300046557 Bacteria 2411
331 Ga0495668_0061502 3300046616 Bacteria 2071
332 Ga0495625_0285166 3300046660 Bacteria 1061
333 Ga0495659_0086471 3300046664 Bacteria 1198
334 Ga0495623_0155018 3300046679 Bacteria 1351
335 Ga0495669_0095156 3300046684 Bacteria 1379
336 Ga0495669_0108327 3300046684 Bacteria 1295
337 Ga0495669_0181457 3300046684 Bacteria 1003
338 Ga0495581_0135881 3300047315 Bacteria 1433
339 Ga0495687_010917 3300047443 Bacteria 4930
340 Ga0495593_0208970 3300047673 Bacteria 980
341 Ga0495602_0376970 3300048088 Bacteria 1017
342 Ga0496101_1168677 3300048904 Bacteria 603
343 Ga0496102_0297484 3300048905 Bacteria 1521
344 Ga0496103_0180765 3300048906 Bacteria 1356
345 Ga0496116_0294359 3300048919 Bacteria 777
346 Ga0496117_0041016 3300048920 Bacteria 3397
347 Ga0496118_0002955 3300048921 Bacteria 22041
348 Ga0496119_0023841 3300048922 Bacteria 4325
349 Ga0496120_0094375 3300048923 Bacteria 1593
350 Ga0496121_0000152 3300048924 Bacteria 150767
351 Ga0495682_0073086 3300049460 Bacteria 1234
352 Ga0501033_0771981 3300049570 Bacteria 651
353 Ga0501035_0866030 3300049822 Bacteria 718
354 nmdc:mga05p37_247944_c1 3300050507 Bacteria 2137
355 nmdc:mga09592_644456_c1 3300050508 Bacteria 905
356 Ga0500635_0000208 3300053080 Bacteria 28812
357 Ga0500643_004190 3300053087 Bacteria 6607
358 Ga0500643_011525 3300053087 Bacteria 3223
359 Ga0500651_0386445 3300053093 Bacteria 788
360 Ga0500556_0021116 3300053104 Bacteria 2094
361 Ga0500569_033716 3300053109 Bacteria 1456
362 Ga0500595_001609 3300053119 Bacteria 11894
363 Ga0500595_029670 3300053119 Bacteria 1853
364 Ga0500608_032746 3300053122 Bacteria 2471
365 Ga0500642_0131874 3300053130 Bacteria 1171
366 Ga0500642_0262690 3300053130 Bacteria 789
367 Ga0500642_0311360 3300053130 Bacteria 708
368 Ga0500658_0023853 3300053134 Bacteria 2340
369 Ga0500559_0013592 3300053136 Bacteria 3446
370 Ga0500577_0499962 3300053142 Bacteria 531
371 Ga0500590_027208 3300053148 Bacteria 2965
372 Ga0500619_114286 3300053154 Bacteria 919
373 Ga0500639_096117 3300053163 Bacteria 1467
374 Ga0500636_0034993 3300053177 Bacteria 2973
375 Ga0500637_0052695 3300053178 Bacteria 2321
376 Ga0500576_208614 3300053725 Bacteria 655
377 Ga0500625_006868 3300053729 Bacteria 4893
378 Ga0500596_001848 3300053735 Bacteria 4254
379 Ga0590071_069549 3300059421 Bacteria 867

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0191464 Ga0316584_0191464_419_793 117
2 3300036647 Ga0316582_1210130 Ga0316582_1210130_123_500 118
3 3300005345 Ga0070692_10027193 Ga0070692_100271932 126
4 iso_pu_bacteria 2829745981 2829747562 133
5 iso_pu_bacteria 8054302542 8054304755 133
6 3300005327 Ga0070658_10002861 Ga0070658_100028614 134
7 3300005563 Ga0068855_100015869 Ga0068855_1000158698 134
8 3300005563 Ga0068855_100454843 Ga0068855_1004548432 134
9 3300005563 Ga0068855_100630304 Ga0068855_1006303042 134
10 3300005577 Ga0068857_100942973 Ga0068857_1009429732 134
11 3300005578 Ga0068854_100000359 Ga0068854_10000035924 134
12 3300005614 Ga0068856_100047623 Ga0068856_1000476233 134
13 3300005614 Ga0068856_101125973 Ga0068856_1011259732 134
14 3300005616 Ga0068852_100000619 Ga0068852_10000061916 134
15 3300009093 Ga0105240_10044710 Ga0105240_100447103 134
16 3300009545 Ga0105237_10364473 Ga0105237_103644732 134
17 3300009551 Ga0105238_10739151 Ga0105238_107391512 134
18 3300025904 Ga0207647_10019114 Ga0207647_100191144 134
19 3300025904 Ga0207647_10271435 Ga0207647_102714352 134
20 3300025909 Ga0207705_10000004 Ga0207705_10000004356 134
21 3300025913 Ga0207695_10027764 Ga0207695_100277643 134
22 3300025914 Ga0207671_10940969 Ga0207671_109409691 134
23 3300025924 Ga0207694_10508710 Ga0207694_105087102 134
24 3300025945 Ga0207679_10474340 Ga0207679_104743401 134
25 3300025949 Ga0207667_10188761 Ga0207667_101887613 134
26 3300025949 Ga0207667_10342442 Ga0207667_103424422 134
27 3300025981 Ga0207640_10002692 Ga0207640_100026925 134
28 3300026041 Ga0207639_10742300 Ga0207639_107423002 134
29 3300026078 Ga0207702_10265264 Ga0207702_102652642 134
30 3300026078 Ga0207702_12408499 Ga0207702_124084991 134
31 3300026095 Ga0207676_10857254 Ga0207676_108572542 134
32 3300026116 Ga0207674_10907915 Ga0207674_109079152 134
33 3300026116 Ga0207674_11510683 Ga0207674_115106832 134
34 3300026142 Ga0207698_10000177 Ga0207698_1000017731 134
35 3300005344 Ga0070661_100981028 Ga0070661_1009810282 135
36 3300005564 Ga0070664_100090827 Ga0070664_1000908273 135
37 3300006353 Ga0075370_10890353 Ga0075370_108903531 135
38 3300013297 Ga0157378_12904182 Ga0157378_129041821 135
39 3300025920 Ga0207649_11347282 Ga0207649_113472821 135
40 3300031548 Ga0307408_100028017 Ga0307408_1000280173 135
41 3300031548 Ga0307408_101401915 Ga0307408_1014019151 135
42 3300031548 Ga0307408_101469325 Ga0307408_1014693252 135
43 3300031548 Ga0307408_101559765 Ga0307408_1015597651 135
44 3300031731 Ga0307405_10036428 Ga0307405_100364282 135
45 3300031824 Ga0307413_10066875 Ga0307413_100668752 135
46 3300031824 Ga0307413_10541550 Ga0307413_105415501 135
47 3300031824 Ga0307413_10647256 Ga0307413_106472562 135
48 3300031852 Ga0307410_10075371 Ga0307410_100753712 135
49 3300031852 Ga0307410_10081925 Ga0307410_100819252 135
50 3300031852 Ga0307410_10123999 Ga0307410_101239992 135
51 3300031852 Ga0307410_10171356 Ga0307410_101713561 135
52 3300031852 Ga0307410_11608028 Ga0307410_116080281 135
53 3300031901 Ga0307406_10030556 Ga0307406_100305562 135
54 3300031901 Ga0307406_10241758 Ga0307406_102417582 135
55 3300031903 Ga0307407_10019566 Ga0307407_100195663 135
56 3300031903 Ga0307407_10076171 Ga0307407_100761712 135
57 3300031903 Ga0307407_10278331 Ga0307407_102783311 135
58 3300031911 Ga0307412_10278081 Ga0307412_102780812 135
59 3300031911 Ga0307412_10449059 Ga0307412_104490592 135
60 3300031911 Ga0307412_12097707 Ga0307412_120977071 135
61 3300031995 Ga0307409_100036198 Ga0307409_1000361982 135
62 3300031995 Ga0307409_100085324 Ga0307409_1000853242 135
63 3300031995 Ga0307409_100214916 Ga0307409_1002149162 135
64 3300031995 Ga0307409_100260400 Ga0307409_1002604002 135
65 3300031995 Ga0307409_101180500 Ga0307409_1011805001 135
66 3300032002 Ga0307416_100022142 Ga0307416_1000221424 135
67 3300032002 Ga0307416_101030566 Ga0307416_1010305662 135
68 3300032002 Ga0307416_101246416 Ga0307416_1012464162 135
69 3300032004 Ga0307414_10046105 Ga0307414_100461052 135
70 3300032004 Ga0307414_10203196 Ga0307414_102031962 135
71 3300032005 Ga0307411_10026629 Ga0307411_100266293 135
72 3300032005 Ga0307411_10249915 Ga0307411_102499152 135
73 3300032005 Ga0307411_10306206 Ga0307411_103062061 135
74 3300032005 Ga0307411_10753628 Ga0307411_107536281 135
75 3300032005 Ga0307411_11273127 Ga0307411_112731271 135
76 3300032005 Ga0307411_12020968 Ga0307411_120209681 135
77 3300032126 Ga0307415_100174784 Ga0307415_1001747842 135
78 3300032126 Ga0307415_100693517 Ga0307415_1006935172 135
79 3300032126 Ga0307415_101388107 Ga0307415_1013881071 135
80 3300042006 Ga0439432_158888 Ga0439432_158888_211_642 135
81 3300042007 Ga0439449_0043099 Ga0439449_0043099_67_498 135
82 3300042007 Ga0439449_0364700 Ga0439449_0364700_102_533 135
83 3300059421 Ga0590071_069549 Ga0590071_069549_242_673 135
84 3300002739 JGI25158J39367_1032790 JGI25158J39367_10327901 136
85 3300003320 rootH2_10217621 rootH2_102176213 136
86 3300003322 rootL2_10102593 rootL2_101025933 136
87 3300005327 Ga0070658_10000571 Ga0070658_100005719 136
88 3300005327 Ga0070658_10010980 Ga0070658_100109803 136
89 3300005327 Ga0070658_10062405 Ga0070658_100624054 136
90 3300005327 Ga0070658_10205817 Ga0070658_102058171 136
91 3300005327 Ga0070658_10435509 Ga0070658_104355092 136
92 3300005327 Ga0070658_10855416 Ga0070658_108554161 136
93 3300005327 Ga0070658_11364002 Ga0070658_113640021 136
94 3300005329 Ga0070683_100700441 Ga0070683_1007004412 136
95 3300005331 Ga0070670_100000153 Ga0070670_10000015333 136
96 3300005334 Ga0068869_100310713 Ga0068869_1003107131 136
97 3300005335 Ga0070666_10049324 Ga0070666_100493241 136
98 3300005335 Ga0070666_10784620 Ga0070666_107846201 136
99 3300005336 Ga0070680_100523065 Ga0070680_1005230652 136
100 3300005337 Ga0070682_100645004 Ga0070682_1006450042 136
101 3300005338 Ga0068868_101109339 Ga0068868_1011093391 136
102 3300005339 Ga0070660_100000091 Ga0070660_10000009154 136
103 3300005339 Ga0070660_100003214 Ga0070660_1000032145 136
104 3300005339 Ga0070660_100005183 Ga0070660_1000051837 136
105 3300005339 Ga0070660_100105787 Ga0070660_1001057872 136
106 3300005339 Ga0070660_100215239 Ga0070660_1002152392 136
107 3300005339 Ga0070660_100291246 Ga0070660_1002912461 136
108 3300005339 Ga0070660_100405670 Ga0070660_1004056702 136
109 3300005339 Ga0070660_100525932 Ga0070660_1005259322 136
110 3300005339 Ga0070660_101554051 Ga0070660_1015540511 136
111 3300005340 Ga0070689_100156299 Ga0070689_1001562992 136
112 3300005344 Ga0070661_100000114 Ga0070661_10000011444 136
113 3300005344 Ga0070661_100257482 Ga0070661_1002574822 136
114 3300005344 Ga0070661_100260882 Ga0070661_1002608822 136
115 3300005345 Ga0070692_10000864 Ga0070692_100008648 136
116 3300005345 Ga0070692_10006531 Ga0070692_100065316 136
117 3300005345 Ga0070692_10092738 Ga0070692_100927382 136
118 3300005347 Ga0070668_100000508 Ga0070668_1000005083 136
119 3300005347 Ga0070668_100101489 Ga0070668_1001014892 136
120 3300005347 Ga0070668_100233842 Ga0070668_1002338421 136
121 3300005347 Ga0070668_100414274 Ga0070668_1004142743 136
122 3300005353 Ga0070669_100018321 Ga0070669_1000183215 136
123 3300005353 Ga0070669_100240396 Ga0070669_1002403962 136
124 3300005355 Ga0070671_100011703 Ga0070671_1000117033 136
125 3300005366 Ga0070659_100300222 Ga0070659_1003002222 136
126 3300005366 Ga0070659_100441852 Ga0070659_1004418522 136
127 3300005367 Ga0070667_100000146 Ga0070667_10000014633 136
128 3300005367 Ga0070667_100017069 Ga0070667_1000170697 136
129 3300005367 Ga0070667_100106892 Ga0070667_1001068923 136
130 3300005455 Ga0070663_100004745 Ga0070663_1000047458 136
131 3300005458 Ga0070681_10225718 Ga0070681_102257181 136
132 3300005530 Ga0070679_100006019 Ga0070679_10000601910 136
133 3300005536 Ga0070697_100037383 Ga0070697_1000373832 136
134 3300005548 Ga0070665_100001180 Ga0070665_10000118021 136
135 3300005548 Ga0070665_100024524 Ga0070665_1000245241 136
136 3300005548 Ga0070665_100190674 Ga0070665_1001906743 136
137 3300005548 Ga0070665_100529673 Ga0070665_1005296732 136
138 3300005549 Ga0070704_100997253 Ga0070704_1009972532 136
139 3300005563 Ga0068855_100000129 Ga0068855_10000012924 136
140 3300005563 Ga0068855_100365378 Ga0068855_1003653782 136
141 3300005563 Ga0068855_100406764 Ga0068855_1004067641 136
142 3300005617 Ga0068859_100003999 Ga0068859_1000039994 136
143 3300005618 Ga0068864_100000060 Ga0068864_10000006021 136
144 3300005618 Ga0068864_100000313 Ga0068864_10000031320 136
145 3300005618 Ga0068864_100551340 Ga0068864_1005513402 136
146 3300005719 Ga0068861_100068358 Ga0068861_1000683582 136
147 3300005841 Ga0068863_100000253 Ga0068863_10000025332 136
148 3300005841 Ga0068863_100029038 Ga0068863_1000290384 136
149 3300005841 Ga0068863_100155117 Ga0068863_1001551174 136
150 3300005842 Ga0068858_100006005 Ga0068858_10000600513 136
151 3300005842 Ga0068858_100015118 Ga0068858_1000151185 136
152 3300005843 Ga0068860_100000308 Ga0068860_10000030833 136
153 3300005844 Ga0068862_100000129 Ga0068862_10000012964 136
154 3300005844 Ga0068862_100033719 Ga0068862_1000337193 136
155 3300005844 Ga0068862_100036714 Ga0068862_1000367144 136
156 3300005844 Ga0068862_100380490 Ga0068862_1003804903 136
157 3300006844 Ga0075428_100052052 Ga0075428_1000520526 136
158 3300006844 Ga0075428_101764058 Ga0075428_1017640581 136
159 3300006931 Ga0097620_100003999 Ga0097620_1000039994 136
160 3300009011 Ga0105251_10203858 Ga0105251_102038581 136
161 3300009092 Ga0105250_10276180 Ga0105250_102761801 136
162 3300009093 Ga0105240_10002841 Ga0105240_100028416 136
163 3300009094 Ga0111539_12315632 Ga0111539_123156321 136
164 3300009101 Ga0105247_10044757 Ga0105247_100447574 136
165 3300009147 Ga0114129_10306648 Ga0114129_103066483 136
166 3300009174 Ga0105241_10588841 Ga0105241_105888412 136
167 3300009177 Ga0105248_10001464 Ga0105248_1000146423 136
168 3300009177 Ga0105248_10030470 Ga0105248_100304703 136
169 3300009177 Ga0105248_10063810 Ga0105248_100638101 136
170 3300009177 Ga0105248_10065608 Ga0105248_100656081 136
171 3300009545 Ga0105237_10139473 Ga0105237_101394734 136
172 3300009551 Ga0105238_10329084 Ga0105238_103290842 136
173 3300009551 Ga0105238_10696497 Ga0105238_106964972 136
174 3300009551 Ga0105238_10944878 Ga0105238_109448782 136
175 3300009553 Ga0105249_10001621 Ga0105249_100016217 136
176 3300009553 Ga0105249_10904149 Ga0105249_109041491 136
177 3300009553 Ga0105249_10924176 Ga0105249_109241762 136
178 3300010375 Ga0105239_11035792 Ga0105239_110357921 136
179 3300013100 Ga0157373_10032797 Ga0157373_100327974 136
180 3300013100 Ga0157373_10488764 Ga0157373_104887641 136
181 3300013102 Ga0157371_10003542 Ga0157371_100035428 136
182 3300013102 Ga0157371_10321079 Ga0157371_103210791 136
183 3300013104 Ga0157370_10058583 Ga0157370_100585835 136
184 3300013105 Ga0157369_10550901 Ga0157369_105509012 136
185 3300013306 Ga0163162_10060051 Ga0163162_100600513 136
186 3300013306 Ga0163162_10067112 Ga0163162_100671126 136
187 3300013307 Ga0157372_10712020 Ga0157372_107120202 136
188 3300014968 Ga0157379_10001749 Ga0157379_100017493 136
189 3300014968 Ga0157379_10053434 Ga0157379_100534343 136
190 3300021384 Ga0213876_10000128 Ga0213876_1000012872 136
191 3300025735 Ga0207713_1182576 Ga0207713_11825761 136
192 3300025900 Ga0207710_10025644 Ga0207710_100256444 136
193 3300025903 Ga0207680_10005545 Ga0207680_100055453 136
194 3300025903 Ga0207680_10034433 Ga0207680_100344334 136
195 3300025904 Ga0207647_10013059 Ga0207647_100130597 136
196 3300025904 Ga0207647_10078597 Ga0207647_100785972 136
197 3300025907 Ga0207645_10374027 Ga0207645_103740272 136
198 3300025909 Ga0207705_10000091 Ga0207705_1000009164 136
199 3300025909 Ga0207705_10002133 Ga0207705_1000213315 136
200 3300025909 Ga0207705_10031804 Ga0207705_100318043 136
201 3300025909 Ga0207705_10046271 Ga0207705_100462712 136
202 3300025909 Ga0207705_10155818 Ga0207705_101558183 136
203 3300025909 Ga0207705_10390175 Ga0207705_103901752 136
204 3300025909 Ga0207705_10978194 Ga0207705_109781942 136
205 3300025912 Ga0207707_10106417 Ga0207707_101064172 136
206 3300025913 Ga0207695_10004342 Ga0207695_1000434211 136
207 3300025917 Ga0207660_10000892 Ga0207660_100008923 136
208 3300025917 Ga0207660_10352638 Ga0207660_103526381 136
209 3300025919 Ga0207657_10000092 Ga0207657_1000009237 136
210 3300025919 Ga0207657_10000252 Ga0207657_100002527 136
211 3300025919 Ga0207657_10021780 Ga0207657_100217802 136
212 3300025919 Ga0207657_10037432 Ga0207657_100374328 136
213 3300025919 Ga0207657_10101948 Ga0207657_101019481 136
214 3300025919 Ga0207657_10227324 Ga0207657_102273242 136
215 3300025919 Ga0207657_10836287 Ga0207657_108362871 136
216 3300025920 Ga0207649_10000011 Ga0207649_1000001118 136
217 3300025921 Ga0207652_10000001 Ga0207652_10000001505 136
218 3300025921 Ga0207652_10000002 Ga0207652_10000002223 136
219 3300025923 Ga0207681_10032673 Ga0207681_100326733 136
220 3300025924 Ga0207694_11006596 Ga0207694_110065961 136
221 3300025925 Ga0207650_10000064 Ga0207650_10000064110 136
222 3300025925 Ga0207650_10037913 Ga0207650_100379133 136
223 3300025931 Ga0207644_10007618 Ga0207644_100076183 136
224 3300025932 Ga0207690_10110247 Ga0207690_101102472 136
225 3300025932 Ga0207690_10262857 Ga0207690_102628571 136
226 3300025932 Ga0207690_10622155 Ga0207690_106221552 136
227 3300025941 Ga0207711_10001333 Ga0207711_1000133323 136
228 3300025941 Ga0207711_10101198 Ga0207711_101011983 136
229 3300025941 Ga0207711_10130518 Ga0207711_101305182 136
230 3300025941 Ga0207711_10267369 Ga0207711_102673693 136
231 3300025942 Ga0207689_10306568 Ga0207689_103065683 136
232 3300025944 Ga0207661_10191456 Ga0207661_101914562 136
233 3300025944 Ga0207661_11005165 Ga0207661_110051652 136
234 3300025945 Ga0207679_11958534 Ga0207679_119585341 136
235 3300025949 Ga0207667_10001226 Ga0207667_1000122629 136
236 3300025961 Ga0207712_10001631 Ga0207712_1000163114 136
237 3300025961 Ga0207712_10611739 Ga0207712_106117392 136
238 3300025972 Ga0207668_10000154 Ga0207668_1000015423 136
239 3300025972 Ga0207668_10000379 Ga0207668_100003794 136
240 3300025972 Ga0207668_10011687 Ga0207668_100116875 136
241 3300025972 Ga0207668_10766026 Ga0207668_107660261 136
242 3300025986 Ga0207658_10000390 Ga0207658_1000039039 136
243 3300025986 Ga0207658_10011353 Ga0207658_100113536 136
244 3300025986 Ga0207658_10013056 Ga0207658_100130563 136
245 3300026023 Ga0207677_11330360 Ga0207677_113303601 136
246 3300026035 Ga0207703_10002812 Ga0207703_100028126 136
247 3300026035 Ga0207703_10013054 Ga0207703_100130544 136
248 3300026067 Ga0207678_10004734 Ga0207678_100047349 136
249 3300026067 Ga0207678_10035640 Ga0207678_100356402 136
250 3300026067 Ga0207678_10902949 Ga0207678_109029492 136
251 3300026088 Ga0207641_10000634 Ga0207641_1000063432 136
252 3300026088 Ga0207641_10325489 Ga0207641_103254893 136
253 3300026095 Ga0207676_10000131 Ga0207676_1000013141 136
254 3300026118 Ga0207675_100555640 Ga0207675_1005556401 136
255 3300028379 Ga0268266_10000812 Ga0268266_1000081231 136
256 3300028379 Ga0268266_10039346 Ga0268266_100393462 136
257 3300028379 Ga0268266_10873757 Ga0268266_108737572 136
258 3300028380 Ga0268265_10000933 Ga0268265_1000093313 136
259 3300028380 Ga0268265_10015897 Ga0268265_100158973 136
260 3300028380 Ga0268265_10016310 Ga0268265_100163105 136
261 3300028381 Ga0268264_10000360 Ga0268264_1000036032 136
262 3300028381 Ga0268264_10023875 Ga0268264_100238752 136
263 3300028786 Ga0307517_10129466 Ga0307517_101294662 136
264 3300030521 Ga0307511_10029315 Ga0307511_100293154 136
265 3300031235 Ga0265330_10001406 Ga0265330_100014065 136
266 3300031548 Ga0307408_100416516 Ga0307408_1004165162 136
267 3300031548 Ga0307408_101708080 Ga0307408_1017080801 136
268 3300031728 Ga0316578_10330489 Ga0316578_103304892 136
269 3300031728 Ga0316578_10859177 Ga0316578_108591771 136
270 3300031731 Ga0307405_10063635 Ga0307405_100636352 136
271 3300031731 Ga0307405_10442970 Ga0307405_104429702 136
272 3300031733 Ga0316577_10097213 Ga0316577_100972131 136
273 3300031824 Ga0307413_10942039 Ga0307413_109420392 136
274 3300031995 Ga0307409_100353438 Ga0307409_1003534382 136
275 3300032002 Ga0307416_100065406 Ga0307416_1000654061 136
276 3300032002 Ga0307416_101684733 Ga0307416_1016847332 136
277 3300032005 Ga0307411_10447155 Ga0307411_104471553 136
278 3300032126 Ga0307415_100407272 Ga0307415_1004072722 136
279 3300032168 Ga0316593_10151474 Ga0316593_101514742 136
280 3300032168 Ga0316593_10208232 Ga0316593_102082321 136
281 3300035088 Ga0373940_0030907 Ga0373940_0030907_627_1052 136
282 3300035115 Ga0373941_0408299 Ga0373941_0408299_47_472 136
283 3300035117 Ga0373953_0036807 Ga0373953_0036807_738_1175 136
284 3300035118 Ga0373954_0025166 Ga0373954_0025166_834_1271 136
285 3300035120 Ga0373957_0168912 Ga0373957_0168912_453_890 136
286 3300036401 Ga0373937_0046952 Ga0373937_0046952_2637_3074 136
287 3300036647 Ga0316582_0148275 Ga0316582_0148275_123_560 136
288 3300036647 Ga0316582_0170156 Ga0316582_0170156_496_936 136
289 3300036712 Ga0316584_0531105 Ga0316584_0531105_301_741 136
290 3300037068 Ga0373925_0147638 Ga0373925_0147638_227_652 136
291 3300037312 Ga0395899_0000132 Ga0395899_0000132_59306_59761 136
292 3300037312 Ga0395899_0066959 Ga0395899_0066959_1757_2194 136
293 3300037312 Ga0395899_0601521 Ga0395899_0601521_151_594 136
294 3300037418 Ga0395900_0000477 Ga0395900_0000477_11784_12239 136
295 3300037418 Ga0395900_0397263 Ga0395900_0397263_90_527 136
296 3300037466 Ga0395898_0010152 Ga0395898_0010152_1639_2094 136
297 3300037466 Ga0395898_0039484 Ga0395898_0039484_2220_2705 136
298 3300037466 Ga0395898_0191401 Ga0395898_0191401_172_609 136
299 3300037466 Ga0395898_0353269 Ga0395898_0353269_251_694 136
300 3300037466 Ga0395898_0455357 Ga0395898_0455357_139_576 136
301 3300037466 Ga0395898_0837604 Ga0395898_0837604_93_530 136
302 3300037471 Ga0395905_0022794 Ga0395905_0022794_3576_4016 136
303 3300037471 Ga0395905_0073352 Ga0395905_0073352_278_721 136
304 3300037471 Ga0395905_0209922 Ga0395905_0209922_265_720 136
305 3300037471 Ga0395905_0439087 Ga0395905_0439087_430_915 136
306 3300037471 Ga0395905_0910252 Ga0395905_0910252_145_582 136
307 3300037471 Ga0395905_1371470 Ga0395905_1371470_149_592 136
308 3300037588 Ga0316581_0225646 Ga0316581_0225646_60_500 136
309 3300037853 Ga0436364_1207386 Ga0436364_1207386_295_735 136
310 3300038443 Ga0395901_0000275 Ga0395901_0000275_52405_52860 136
311 3300038443 Ga0395901_0016131 Ga0395901_0016131_5860_6303 136
312 3300038443 Ga0395901_0060741 Ga0395901_0060741_3094_3579 136
313 3300038443 Ga0395901_1273440 Ga0395901_1273440_221_661 136
314 3300039437 Ga0436365_1686123 Ga0436365_1686123_29063_29488 136
315 3300039453 Ga0436362_1287140 Ga0436362_1287140_5662_6087 136
316 3300042005 Ga0439448_0001546 Ga0439448_0001546_4991_5434 136
317 3300042006 Ga0439432_009200 Ga0439432_009200_2655_3092 136
318 3300042157 Ga0439458_0000459 Ga0439458_0000459_6641_7084 136
319 3300042876 Ga0451577_0934231 Ga0451577_0934231_321_734 136
320 3300044673 Ga0453683_0111208 Ga0453683_0111208_1166_1579 136
321 3300044673 Ga0453683_0417518 Ga0453683_0417518_250_663 136
322 3300044694 Ga0466963_0078031 Ga0466963_0078031_1193_1630 136
323 3300045051 Ga0451576_0070823 Ga0451576_0070823_2180_2593 136
324 3300045976 Ga0466967_1872840 Ga0466967_1872840_31_468 136
325 3300046459 Ga0495629_0166761 Ga0495629_0166761_548_976 136
326 3300046491 Ga0495584_0194603 Ga0495584_0194603_328_864 136
327 3300046492 Ga0495585_0065370 Ga0495585_0065370_932_1375 136
328 3300046515 Ga0495620_0069732 Ga0495620_0069732_527_955 136
329 3300046520 Ga0495637_0135881 Ga0495637_0135881_421_849 136
330 3300046530 Ga0495654_0211350 Ga0495654_0211350_292_720 136
331 3300046538 Ga0495609_0080733 Ga0495609_0080733_370_798 136
332 3300046542 Ga0495597_0002700 Ga0495597_0002700_1107_1535 136
333 3300046557 Ga0495622_0033161 Ga0495622_0033161_652_1080 136
334 3300046616 Ga0495668_0061502 Ga0495668_0061502_233_655 136
335 3300046660 Ga0495625_0285166 Ga0495625_0285166_394_822 136
336 3300046664 Ga0495659_0086471 Ga0495659_0086471_460_903 136
337 3300046679 Ga0495623_0155018 Ga0495623_0155018_213_650 136
338 3300046684 Ga0495669_0095156 Ga0495669_0095156_758_1183 136
339 3300046684 Ga0495669_0108327 Ga0495669_0108327_377_817 136
340 3300046684 Ga0495669_0181457 Ga0495669_0181457_231_674 136
341 3300047315 Ga0495581_0135881 Ga0495581_0135881_821_1261 136
342 3300047443 Ga0495687_010917 Ga0495687_010917_3992_4420 136
343 3300047673 Ga0495593_0208970 Ga0495593_0208970_536_964 136
344 3300048088 Ga0495602_0376970 Ga0495602_0376970_84_521 136
345 3300048904 Ga0496101_1168677 Ga0496101_1168677_57_494 136
346 3300048905 Ga0496102_0297484 Ga0496102_0297484_73_501 136
347 3300048906 Ga0496103_0180765 Ga0496103_0180765_725_1204 136
348 3300048919 Ga0496116_0294359 Ga0496116_0294359_260_739 136
349 3300048920 Ga0496117_0041016 Ga0496117_0041016_935_1414 136
350 3300048921 Ga0496118_0002955 Ga0496118_0002955_5907_6386 136
351 3300048922 Ga0496119_0023841 Ga0496119_0023841_3610_4089 136
352 3300048923 Ga0496120_0094375 Ga0496120_0094375_1024_1503 136
353 3300048924 Ga0496121_0000152 Ga0496121_0000152_101880_102359 136
354 3300049460 Ga0495682_0073086 Ga0495682_0073086_499_927 136
355 3300049570 Ga0501033_0771981 Ga0501033_0771981_195_620 136
356 3300049822 Ga0501035_0866030 Ga0501035_0866030_127_549 136
357 3300050507 nmdc:mga05p37_247944_c1 nmdc:mga05p37_247944_c1_244_681 136
358 3300050508 nmdc:mga09592_644456_c1 nmdc:mga09592_644456_c1_13_450 136
359 3300053080 Ga0500635_0000208 Ga0500635_0000208_8858_9286 136
360 3300053087 Ga0500643_004190 Ga0500643_004190_68_490 136
361 3300053087 Ga0500643_011525 Ga0500643_011525_32_454 136
362 3300053093 Ga0500651_0386445 Ga0500651_0386445_16_444 136
363 3300053104 Ga0500556_0021116 Ga0500556_0021116_100_522 136
364 3300053109 Ga0500569_033716 Ga0500569_033716_825_1253 136
365 3300053119 Ga0500595_001609 Ga0500595_001609_11278_11706 136
366 3300053119 Ga0500595_029670 Ga0500595_029670_49_471 136
367 3300053122 Ga0500608_032746 Ga0500608_032746_206_634 136
368 3300053130 Ga0500642_0131874 Ga0500642_0131874_69_491 136
369 3300053130 Ga0500642_0262690 Ga0500642_0262690_204_632 136
370 3300053130 Ga0500642_0311360 Ga0500642_0311360_261_689 136
371 3300053134 Ga0500658_0023853 Ga0500658_0023853_1618_2046 136
372 3300053136 Ga0500559_0013592 Ga0500559_0013592_1521_1949 136
373 3300053142 Ga0500577_0499962 Ga0500577_0499962_90_518 136
374 3300053148 Ga0500590_027208 Ga0500590_027208_2124_2552 136
375 3300053154 Ga0500619_114286 Ga0500619_114286_364_792 136
376 3300053163 Ga0500639_096117 Ga0500639_096117_106_534 136
377 3300053177 Ga0500636_0034993 Ga0500636_0034993_849_1277 136
378 3300053178 Ga0500637_0052695 Ga0500637_0052695_36_464 136
379 3300053725 Ga0500576_208614 Ga0500576_208614_25_453 136
380 3300053729 Ga0500625_006868 Ga0500625_006868_3982_4410 136
381 3300053735 Ga0500596_001848 Ga0500596_001848_3434_3862 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

60

159

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9585 1 136
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9529 1 136
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9517 1 136
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9508 1 135
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.947 1 135
ID Description Score Start End Superfamily
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9554 1 135 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9418 1 135 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9119 4 136 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9009 45 136 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8932 1 136 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A257KYW8-F1-model_v4 OsmC family peroxiredoxin 0.988 42 136 GO:0004601
GO:0006979
AF-A0A4Q3U8V3-F1-model_v4 deleted 0.9865 1 64
AF-A0A4R5CUL2-F1-model_v4 OsmC family peroxiredoxin 0.9842 1 136 GO:0004601
GO:0006979
AF-A0A520BIH8-F1-model_v4 OsmC family peroxiredoxin 0.9841 54 136 GO:0004601
GO:0006979
AF-A0A2W5FXT9-F1-model_v4 OsmC family peroxiredoxin 0.9833 43 136 GO:0004601
GO:0006979

Feature Viewer

pLDDT pTM Quality
95.64 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map