F428723

General Info

Members Datasets Scaffolds Average Seq Length
380 285 353 73

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0008413|Ga0395899_0008413_2326_2577
Length 83
Sequence LAAPARKQAEEMSDDFKRATQRKASFGATLKAVFWSFFGVRKKSDYEKDTQQLNPVHVVIAGVIGAIIFIVTLLIIVKSVVGK

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
3 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
4 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
5 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
6 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
7 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
8 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
9 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
10 2818991436 Collimonas arenae 515 Isolate Unclassified
11 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
12 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
13 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
14 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
15 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
16 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
17 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
18 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
19 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
20 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
21 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
22 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
23 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
24 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
25 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
26 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
27 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
28 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
29 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
30 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
31 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
32 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
33 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
34 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
35 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
36 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
37 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
38 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
39 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
40 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
41 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
43 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
44 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
45 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
46 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
47 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
48 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
49 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
105 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
163 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
164 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
165 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
168 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
169 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
170 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
196 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
197 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
230 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
231 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
259 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
260 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
267 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
268 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
269 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
270 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
271 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
272 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
273 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.63
Metatranscriptomes 5.26
Isolates 7.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.42
Nodule 0.79
Rhizoplane 4.47
Rhizosphere 74.47
Stem 0
Stem Tuber 0
Unclassified 11.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000388 3300002704 Bacteria 12532
2 JGI25155J39150_1000980 3300002704 Bacteria 3327
3 JGI25156J39149_1000503 3300002705 Bacteria 22887
4 JGI25156J39149_1001960 3300002705 Bacteria 7932
5 JGI25156J39149_1009650 3300002705 Bacteria 2329
6 JGI25162J39368_1000040 3300002737 Bacteria 175938
7 JGI25154J39366_1001102 3300002738 Bacteria 10545
8 JGI25154J39366_1001460 3300002738 Bacteria 8372
9 JGI25157J39369_1000171 3300002741 Bacteria 54600
10 JGI25157J39369_1012328 3300002741 Bacteria 1089
11 JGI25163J39215_1003116 3300002771 Bacteria 1421
12 JGI25164J39214_1003738 3300002772 Bacteria 1860
13 Ga0006759J45824_1048394 3300003163 Bacteria 4825
14 JGI25165J46597_1000051 3300003214 Bacteria 241012
15 Ga0007417J51691_1029706 3300003544 Bacteria 4834
16 Ga0007410J51695_1022210 3300003574 Bacteria 5597
17 Ga0007409J51694_1011163 3300003575 Bacteria 6508
18 Ga0007416J51690_1019288 3300003577 Bacteria 5363
19 Ga0032354_1026799 3300003693 Bacteria 4720
20 Ga0055538_1000025 3300003751 Bacteria 241012
21 Ga0055539_1000032 3300003752 Bacteria 241012
22 Ga0055533_1000042 3300003756 Bacteria 241012
23 Ga0055532_1000044 3300003758 Bacteria 191110
24 Ga0055525_1000050 3300003759 Bacteria 241012
25 Ga0055535_1009469 3300003761 Bacteria 1677
26 Ga0055529_1007471 3300003763 Bacteria 1485
27 Ga0055541_1000023 3300003841 Bacteria 241012
28 Ga0070676_10123452 3300005328 Bacteria 1628
29 Ga0070670_100265682 3300005331 Bacteria 1496
30 Ga0070677_10008129 3300005333 Bacteria 3522
31 Ga0068869_100742317 3300005334 Bacteria 840
32 Ga0070666_10089762 3300005335 Bacteria 2110
33 Ga0070666_10457163 3300005335 Bacteria 922
34 Ga0070682_100047452 3300005337 Bacteria 2670
35 Ga0070682_100107229 3300005337 Bacteria 1855
36 Ga0070660_100000635 3300005339 Bacteria 23370
37 Ga0070661_100012425 3300005344 Bacteria 5956
38 Ga0070668_100896274 3300005347 Bacteria 793
39 Ga0070669_100026644 3300005353 Bacteria 4160
40 Ga0070675_100009273 3300005354 Bacteria 7649
41 Ga0070671_100007158 3300005355 Bacteria 8919
42 Ga0070671_100725987 3300005355 Bacteria 863
43 Ga0070674_100075398 3300005356 Bacteria 2395
44 Ga0070673_100105779 3300005364 Bacteria 2325
45 Ga0070688_100254406 3300005365 Bacteria 1252
46 Ga0070659_100000846 3300005366 Bacteria 22322
47 Ga0070667_100134776 3300005367 Bacteria 2159
48 Ga0070678_100004379 3300005456 Bacteria 7998
49 Ga0070662_100227346 3300005457 Bacteria 1491
50 Ga0068867_100001941 3300005459 Bacteria 14401
51 Ga0068853_101678607 3300005539 Bacteria 616
52 Ga0070672_100005168 3300005543 Bacteria 8627
53 Ga0068855_100000702 3300005563 Bacteria 40994
54 Ga0068855_100012982 3300005563 Bacteria 10051
55 Ga0068855_100423896 3300005563 Bacteria 1455
56 Ga0068855_100568295 3300005563 Bacteria 1226
57 Ga0070664_100024701 3300005564 Bacteria 4974
58 Ga0068857_100520774 3300005577 Bacteria 1118
59 Ga0068854_100115551 3300005578 Bacteria 2030
60 Ga0068854_100665303 3300005578 Bacteria 895
61 Ga0068856_100879597 3300005614 Bacteria 915
62 Ga0068852_100012314 3300005616 Bacteria 6488
63 Ga0068864_100248084 3300005618 Bacteria 1652
64 Ga0068851_10114159 3300005834 Bacteria 1445
65 Ga0068851_10206900 3300005834 Bacteria 1097
66 Ga0068870_10186243 3300005840 Bacteria 1250
67 Ga0068863_100467181 3300005841 Bacteria 1239
68 Ga0097621_100052565 3300006237 Bacteria 3319
69 Ga0068871_100082131 3300006358 Bacteria 2671
70 Ga0068865_100085871 3300006881 Bacteria 2271
71 Ga0105251_10054785 3300009011 Bacteria 1892
72 Ga0105251_10088662 3300009011 Bacteria 1423
73 Ga0105244_10204635 3300009036 Bacteria 930
74 Ga0105240_10008038 3300009093 Bacteria 15180
75 Ga0105240_10068872 3300009093 Bacteria 4382
76 Ga0105240_11273159 3300009093 Bacteria 776
77 Ga0105248_11407201 3300009177 Bacteria 789
78 Ga0105237_10077284 3300009545 Bacteria 3319
79 Ga0105237_10180994 3300009545 Bacteria 2108
80 Ga0105237_10229152 3300009545 Bacteria 1859
81 Ga0105238_10000037 3300009551 Bacteria 163954
82 Ga0105238_10109420 3300009551 Bacteria 2745
83 Ga0105239_10090894 3300010375 Bacteria 3368
84 Ga0105239_11034676 3300010375 Bacteria 945
85 Ga0157371_10000077 3300013102 Bacteria 157429
86 Ga0157374_10123609 3300013296 Bacteria 2500
87 Ga0163162_10148095 3300013306 Bacteria 2464
88 Ga0157375_10143413 3300013308 Bacteria 2517
89 Ga0182008_10141546 3300014497 Bacteria 1203
90 Ga0157377_11261913 3300014745 Bacteria 575
91 Ga0157376_10292276 3300014969 Bacteria 1539
92 Ga0182006_1007985 3300015261 Bacteria 4810
93 Ga0182006_1025239 3300015261 Bacteria 2443
94 Ga0182006_1039161 3300015261 Bacteria 1872
95 Ga0182007_10050118 3300015262 Bacteria 1379
96 Ga0182005_1000072 3300015265 Bacteria 84500
97 Ga0163161_10021384 3300017792 Bacteria 4547
98 Ga0163161_10760096 3300017792 Bacteria 811
99 Ga0213872_10224906 3300021361 Bacteria 798
100 Ga0209435_100004 3300025206 Bacteria 633417
101 Ga0209435_100212 3300025206 Bacteria 16554
102 Ga0209760_100816 3300025207 Bacteria 4198
103 Ga0209784_100010 3300025224 Bacteria 683664
104 Ga0209566_100008 3300025225 Bacteria 683664
105 Ga0209674_100019 3300025226 Bacteria 683664
106 Ga0209672_102568 3300025228 Bacteria 4340
107 Ga0209147_100011 3300025229 Bacteria 702140
108 Ga0209563_100021 3300025230 Bacteria 683764
109 Ga0207427_100412 3300025231 Bacteria 24713
110 Ga0209437_100019 3300025233 Bacteria 683764
111 Ga0209258_100279 3300025242 Bacteria 86008
112 Ga0209646_1000140 3300025246 Bacteria 111155
113 Ga0209646_1000141 3300025246 Bacteria 107030
114 Ga0209026_1000066 3300025250 Bacteria 207691
115 Ga0209026_1003704 3300025250 Bacteria 4885
116 Ga0209026_1007405 3300025250 Bacteria 2478
117 Ga0209677_100011 3300025253 Bacteria 683664
118 Ga0209759_1000072 3300025256 Bacteria 178206
119 Ga0209759_1000114 3300025256 Bacteria 142233
120 Ga0209233_1000025 3300025261 Bacteria 683764
121 Ga0209455_1001763 3300025272 Bacteria 9173
122 Ga0207656_10068314 3300025321 Bacteria 1574
123 Ga0207656_10245498 3300025321 Bacteria 876
124 Ga0207655_1143297 3300025728 Bacteria 764
125 Ga0207713_1138168 3300025735 Bacteria 798
126 Ga0207682_10011022 3300025893 Bacteria 3538
127 Ga0207642_10197679 3300025899 Bacteria 1108
128 Ga0207688_10070573 3300025901 Bacteria 1981
129 Ga0207645_10098849 3300025907 Bacteria 1882
130 Ga0207643_10037664 3300025908 Bacteria 2714
131 Ga0207695_10004485 3300025913 Bacteria 19001
132 Ga0207695_10031442 3300025913 Bacteria 5821
133 Ga0207695_10176679 3300025913 Bacteria 2057
134 Ga0207671_10050147 3300025914 Bacteria 3091
135 Ga0207671_10271791 3300025914 Bacteria 1335
136 Ga0207657_10002555 3300025919 Bacteria 19691
137 Ga0207649_10047964 3300025920 Bacteria 2632
138 Ga0207681_10035624 3300025923 Bacteria 3280
139 Ga0207694_10000054 3300025924 Bacteria 152124
140 Ga0207650_10017584 3300025925 Bacteria 5007
141 Ga0207650_10078390 3300025925 Bacteria 2499
142 Ga0207659_10001102 3300025926 Bacteria 16008
143 Ga0207644_10000537 3300025931 Bacteria 24617
144 Ga0207690_10001840 3300025932 Bacteria 13029
145 Ga0207669_10076629 3300025937 Bacteria 2123
146 Ga0207704_10449315 3300025938 Bacteria 1028
147 Ga0207691_10002343 3300025940 Bacteria 18561
148 Ga0207689_10443705 3300025942 Bacteria 1084
149 Ga0207679_10007419 3300025945 Bacteria 6953
150 Ga0207667_10000043 3300025949 Bacteria 261426
151 Ga0207667_10048321 3300025949 Bacteria 4500
152 Ga0207651_10099185 3300025960 Bacteria 2156
153 Ga0207668_11158546 3300025972 Bacteria 694
154 Ga0207668_11181032 3300025972 Bacteria 687
155 Ga0207640_10098805 3300025981 Bacteria 2041
156 Ga0207640_10496011 3300025981 Bacteria 1016
157 Ga0207658_10060560 3300025986 Bacteria 2825
158 Ga0207702_10028447 3300026078 Bacteria 4646
159 Ga0207641_10052852 3300026088 Bacteria 3442
160 Ga0207648_10013271 3300026089 Bacteria 7676
161 Ga0207676_10041554 3300026095 Bacteria 3531
162 Ga0207674_10606031 3300026116 Bacteria 1058
163 Ga0207683_10093004 3300026121 Bacteria 2687
164 Ga0307411_11546318 3300032005 Bacteria 611
165 Ga0395899_0002374 3300037312 Bacteria 15317
166 Ga0395899_0002465 3300037312 Bacteria 15014
167 Ga0395899_0008413 3300037312 Bacteria 7944
168 Ga0395899_0036357 3300037312 Bacteria 3694
169 Ga0395900_0003078 3300037418 Bacteria 18133
170 Ga0395900_0148369 3300037418 Bacteria 2397
171 Ga0395900_0156850 3300037418 Bacteria 2324
172 Ga0395900_0386075 3300037418 Bacteria 1367
173 Ga0395898_1227227 3300037466 Bacteria 680
174 Ga0395898_1306872 3300037466 Bacteria 654
175 Ga0395898_1319663 3300037466 Bacteria 651
176 Ga0395905_0002518 3300037471 Bacteria 20235
177 Ga0395905_0007129 3300037471 Bacteria 11173
178 Ga0395905_0184633 3300037471 Bacteria 1958
179 Ga0395905_0763577 3300037471 Bacteria 869
180 Ga0395901_0010285 3300038443 Bacteria 9476
181 Ga0395901_0023816 3300038443 Bacteria 6278
182 Ga0395901_0065039 3300038443 Bacteria 3797
183 Ga0395901_0381636 3300038443 Bacteria 1450
184 Ga0436361_1216743 3300039447 Bacteria 2430
185 Ga0439465_0194014 3300041413 Bacteria 738
186 Ga0451793_1574030 3300041452 Bacteria 567
187 Ga0451845_0759000 3300041501 Bacteria 564
188 Ga0451843_0253130 3300041509 Bacteria 600
189 Ga0451853_3735907 3300041512 Bacteria 520
190 Ga0439432_069561 3300042006 Bacteria 1075
191 Ga0450898_027237 3300042134 Bacteria 1033
192 Ga0450904_001894 3300042139 Bacteria 2698
193 Ga0439446_0026724 3300042156 Bacteria 1655
194 Ga0451577_0588948 3300042876 Bacteria 1009
195 Ga0466969_0263114 3300044656 Bacteria 781
196 Ga0466972_0057435 3300044658 Bacteria 1869
197 Ga0466965_0135679 3300044683 Bacteria 1278
198 Ga0466966_0014380 3300044684 Bacteria 5239
199 Ga0466971_0036334 3300044719 Bacteria 2210
200 Ga0466957_0591922 3300044842 Unclassified 776
201 Ga0466959_0186037 3300045049 Bacteria 1451
202 Ga0495627_013250 3300046453 Bacteria 2903
203 Ga0495592_0031701 3300046454 Bacteria 3993
204 Ga0495592_0449300 3300046454 Bacteria 808
205 Ga0495629_0329857 3300046459 Bacteria 1042
206 Ga0495651_0127219 3300046462 Bacteria 1864
207 Ga0495651_0135006 3300046462 Bacteria 1796
208 Ga0495653_0128191 3300046463 Bacteria 1799
209 Ga0495653_0151378 3300046463 Bacteria 1620
210 Ga0495650_0244125 3300046471 Bacteria 612
211 Ga0495639_0629026 3300046475 Bacteria 553
212 Ga0495584_0113579 3300046491 Bacteria 1370
213 Ga0495585_0060697 3300046492 Bacteria 2080
214 Ga0495585_0536440 3300046492 Bacteria 553
215 Ga0495594_0435592 3300046499 Bacteria 745
216 Ga0495583_0000102 3300046506 Bacteria 143105
217 Ga0495583_0050617 3300046506 Bacteria 1897
218 Ga0495606_0007881 3300046507 Bacteria 9397
219 Ga0495606_0300161 3300046507 Bacteria 871
220 Ga0495608_0004824 3300046511 Bacteria 9639
221 Ga0495618_0028162 3300046514 Bacteria 3501
222 Ga0495628_0017457 3300046516 Bacteria 5974
223 Ga0495628_0031791 3300046516 Bacteria 4266
224 Ga0495628_0298758 3300046516 Bacteria 1192
225 Ga0495628_1004658 3300046516 Bacteria 574
226 Ga0495630_0068226 3300046517 Bacteria 2674
227 Ga0495631_0012598 3300046518 Bacteria 4126
228 Ga0495644_0104526 3300046523 Bacteria 1072
229 Ga0495663_0004508 3300046525 Bacteria 3911
230 Ga0495663_0070446 3300046525 Bacteria 1112
231 Ga0495642_0042609 3300046528 Bacteria 1849
232 Ga0495642_0105190 3300046528 Bacteria 1204
233 Ga0495652_0018822 3300046529 Bacteria 6154
234 Ga0495652_0069934 3300046529 Bacteria 2936
235 Ga0495652_0417255 3300046529 Bacteria 946
236 Ga0495654_0092566 3300046530 Bacteria 1401
237 Ga0495586_0133319 3300046535 Bacteria 1391
238 Ga0495587_0031687 3300046536 Bacteria 3199
239 Ga0495598_0015811 3300046537 Bacteria 1913
240 Ga0495621_0003724 3300046539 Bacteria 4224
241 Ga0495621_0180859 3300046539 Bacteria 842
242 Ga0495597_0012223 3300046542 Bacteria 4148
243 Ga0495645_0081466 3300046543 Bacteria 2322
244 Ga0495645_0180354 3300046543 Bacteria 1447
245 Ga0495622_0061436 3300046557 Bacteria 1739
246 Ga0495633_0007916 3300046558 Bacteria 6061
247 Ga0495633_0029783 3300046558 Bacteria 2654
248 Ga0495656_0072745 3300046615 Bacteria 1531
249 Ga0495656_0099705 3300046615 Bacteria 1341
250 Ga0495656_0238557 3300046615 Bacteria 915
251 Ga0495668_0038924 3300046616 Bacteria 2655
252 Ga0495634_0147459 3300046642 Bacteria 1490
253 Ga0495625_0025223 3300046660 Bacteria 4512
254 Ga0495625_0070587 3300046660 Bacteria 2452
255 Ga0495625_0698629 3300046660 Bacteria 599
256 Ga0495635_0020175 3300046663 Bacteria 4645
257 Ga0495659_0010867 3300046664 Bacteria 2930
258 Ga0495659_0073412 3300046664 Bacteria 1286
259 Ga0495659_0301841 3300046664 Bacteria 677
260 Ga0495661_0078709 3300046665 Bacteria 1906
261 Ga0495661_0087775 3300046665 Bacteria 1777
262 Ga0495588_0035447 3300046674 Bacteria 2528
263 Ga0495588_0051973 3300046674 Bacteria 2111
264 Ga0495588_0483780 3300046674 Bacteria 649
265 Ga0495588_0725886 3300046674 Bacteria 519
266 Ga0495599_0017037 3300046678 Bacteria 4514
267 Ga0495623_0115516 3300046679 Bacteria 1622
268 Ga0495623_0123467 3300046679 Bacteria 1556
269 Ga0495623_0559874 3300046679 Bacteria 597
270 Ga0495646_0075656 3300046680 Bacteria 1973
271 Ga0495646_0111464 3300046680 Bacteria 1557
272 Ga0495646_0487464 3300046680 Bacteria 634
273 Ga0495613_0163322 3300046689 Bacteria 1583
274 Ga0495624_0149993 3300046690 Bacteria 1426
275 Ga0495624_0574843 3300046690 Bacteria 672
276 Ga0495670_0004764 3300046691 Bacteria 6664
277 Ga0495670_0054501 3300046691 Bacteria 2003
278 Ga0495670_0189210 3300046691 Bacteria 1088
279 Ga0495670_0344205 3300046691 Bacteria 802
280 Ga0495671_0097324 3300046692 Bacteria 1439
281 Ga0495589_0065538 3300046794 Bacteria 1780
282 Ga0495600_0021710 3300046809 Bacteria 4116
283 Ga0495600_0048876 3300046809 Bacteria 2759
284 Ga0495581_0101384 3300047315 Bacteria 1672
285 Ga0495604_0051540 3300047317 Bacteria 3189
286 Ga0495636_0004232 3300047318 Bacteria 5632
287 Ga0495636_0251714 3300047318 Bacteria 817
288 Ga0495677_0064387 3300047445 Bacteria 1362
289 Ga0495685_062150 3300047447 Bacteria 1257
290 Ga0495685_241225 3300047447 Bacteria 574
291 Ga0495681_0030147 3300047470 Bacteria 2766
292 Ga0495684_0309877 3300047471 Bacteria 1132
293 Ga0495686_0001521 3300047472 Bacteria 24957
294 Ga0495593_0093666 3300047673 Bacteria 1545
295 Ga0495602_0067657 3300048088 Bacteria 3071
296 Ga0495602_0262484 3300048088 Bacteria 1280
297 Ga0495614_0074517 3300048089 Bacteria 1466
298 Ga0495615_0053606 3300048090 Bacteria 1045
299 Ga0495615_0158962 3300048090 Bacteria 677
300 Ga0496101_0057083 3300048904 Bacteria 2823
301 Ga0496102_0062327 3300048905 Bacteria 3414
302 Ga0496102_0254853 3300048905 Bacteria 1654
303 Ga0496102_0853942 3300048905 Bacteria 832
304 Ga0496103_0124614 3300048906 Bacteria 1642
305 Ga0496103_0325543 3300048906 Bacteria 988
306 Ga0496105_0201617 3300048908 Bacteria 1624
307 Ga0496106_0145810 3300048909 Bacteria 1865
308 Ga0496106_1203409 3300048909 Bacteria 591
309 Ga0496107_0206537 3300048910 Bacteria 1460
310 Ga0496108_1802553 3300048911 Bacteria 501
311 Ga0496109_0191799 3300048912 Bacteria 1920
312 Ga0496110_0033076 3300048913 Bacteria 4471
313 Ga0496111_0178471 3300048914 Bacteria 1578
314 Ga0496112_0791496 3300048915 Bacteria 873
315 Ga0496115_0238432 3300048918 Bacteria 1499
316 Ga0496116_0023448 3300048919 Bacteria 4594
317 Ga0496117_0106702 3300048920 Bacteria 1757
318 Ga0496118_0169420 3300048921 Bacteria 1337
319 Ga0496121_0076995 3300048924 Bacteria 2658
320 Ga0496121_0186954 3300048924 Bacteria 1489
321 Ga0496122_0003152 3300048925 Bacteria 22065
322 Ga0496123_0020210 3300048926 Bacteria 5216
323 Ga0496124_0797670 3300048927 Bacteria 585
324 Ga0496125_0008330 3300048928 Bacteria 10876
325 Ga0495678_003447 3300049459 Bacteria 9798
326 Ga0501291_049614 3300049514 Bacteria 761
327 Ga0501311_002656 3300049527 Bacteria 1739
328 Ga0501321_011919 3300049537 Bacteria 977
329 Ga0501034_0899634 3300049571 Bacteria 773
330 Ga0501068_1194590 3300049584 Bacteria 504
331 Ga0501283_096337 3300049779 Bacteria 572
332 Ga0495601_0125298 3300053077 Bacteria 1671
333 Ga0495601_0175666 3300053077 Bacteria 1400
334 Ga0500583_0421310 3300053092 Bacteria 638
335 Ga0500595_005237 3300053119 Bacteria 5683
336 Ga0500618_007632 3300053125 Bacteria 3068
337 Ga0500573_0516393 3300053140 Bacteria 536
338 Ga0500574_000366 3300053141 Bacteria 5590
339 Ga0500619_000448 3300053154 Bacteria 7395
340 Ga0500634_0120160 3300053161 Bacteria 1280
341 Ga0587066_068611 3300059490 Bacteria 741
342 Ga0587077_016292 3300059493 Bacteria 1250
343 Ga0587080_111673 3300059503 Bacteria 596
344 Ga0587082_061538 3300059504 Bacteria 741
345 Ga0587086_046446 3300059507 Bacteria 688
346 Ga0587094_037496 3300059513 Bacteria 777
347 Ga0587062_032756 3300059639 Bacteria 805
348 Ga0587068_052176 3300059641 Bacteria 768
349 Ga0587076_143932 3300059645 Bacteria 573
350 Ga0587078_027944 3300059646 Bacteria 747
351 Ga0587071_014054 3300060344 Bacteria 1388
352 Ga0587111_0089821 3300060346 Bacteria 748
353 Ga0466962_0057349 3300061719 Bacteria 1859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0244125 Ga0495650_0244125_340_543 60
2 3300046506 Ga0495583_0000102 Ga0495583_0000102_141010_141213 60
3 iso_pu_bacteria 2511231003 2511249652 60
4 iso_pu_bacteria 2643221603 2644027102 60
5 iso_pu_bacteria 2818991436 2819543759 60
6 3300005335 Ga0070666_10457163 Ga0070666_104571632 61
7 3300042134 Ga0450898_027237 Ga0450898_027237_158_364 61
8 3300048915 Ga0496112_0791496 Ga0496112_0791496_49_255 61
9 3300049459 Ga0495678_003447 Ga0495678_003447_1715_1921 61
10 3300013102 Ga0157371_10000077 Ga0157371_1000007750 62
11 3300015261 Ga0182006_1039161 Ga0182006_10391612 62
12 3300015262 Ga0182007_10050118 Ga0182007_100501182 62
13 3300037312 Ga0395899_0036357 Ga0395899_0036357_2545_2766 62
14 3300037418 Ga0395900_0003078 Ga0395900_0003078_17268_17489 62
15 3300037466 Ga0395898_1306872 Ga0395898_1306872_250_471 62
16 3300037471 Ga0395905_0763577 Ga0395905_0763577_257_478 62
17 3300038443 Ga0395901_0023816 Ga0395901_0023816_5413_5634 62
18 3300042139 Ga0450904_001894 Ga0450904_001894_1532_1741 62
19 3300047472 Ga0495686_0001521 Ga0495686_0001521_23377_23592 62
20 3300048089 Ga0495614_0074517 Ga0495614_0074517_415_624 62
21 3300049514 Ga0501291_049614 Ga0501291_049614_266_475 62
22 3300046459 Ga0495629_0329857 Ga0495629_0329857_26_244 63
23 3300046463 Ga0495653_0151378 Ga0495653_0151378_115_333 63
24 3300046492 Ga0495585_0060697 Ga0495585_0060697_738_950 63
25 3300046499 Ga0495594_0435592 Ga0495594_0435592_262_480 63
26 3300046516 Ga0495628_1004658 Ga0495628_1004658_12_230 63
27 3300046517 Ga0495630_0068226 Ga0495630_0068226_1464_1682 63
28 3300046535 Ga0495586_0133319 Ga0495586_0133319_391_609 63
29 3300046536 Ga0495587_0031687 Ga0495587_0031687_1346_1564 63
30 3300046557 Ga0495622_0061436 Ga0495622_0061436_348_566 63
31 3300046558 Ga0495633_0029783 Ga0495633_0029783_1609_1821 63
32 3300046642 Ga0495634_0147459 Ga0495634_0147459_469_687 63
33 3300046660 Ga0495625_0070587 Ga0495625_0070587_1146_1364 63
34 3300046660 Ga0495625_0698629 Ga0495625_0698629_272_484 63
35 3300046664 Ga0495659_0010867 Ga0495659_0010867_1140_1364 63
36 3300046665 Ga0495661_0087775 Ga0495661_0087775_1331_1543 63
37 3300046674 Ga0495588_0051973 Ga0495588_0051973_1544_1762 63
38 3300046679 Ga0495623_0559874 Ga0495623_0559874_306_524 63
39 3300046689 Ga0495613_0163322 Ga0495613_0163322_556_774 63
40 3300046690 Ga0495624_0574843 Ga0495624_0574843_155_373 63
41 3300046691 Ga0495670_0004764 Ga0495670_0004764_912_1124 63
42 3300046809 Ga0495600_0021710 Ga0495600_0021710_3040_3258 63
43 3300047315 Ga0495581_0101384 Ga0495581_0101384_327_545 63
44 3300047318 Ga0495636_0251714 Ga0495636_0251714_26_250 63
45 3300047471 Ga0495684_0309877 Ga0495684_0309877_194_412 63
46 3300047673 Ga0495593_0093666 Ga0495593_0093666_72_290 63
47 3300048088 Ga0495602_0262484 Ga0495602_0262484_384_602 63
48 3300048090 Ga0495615_0158962 Ga0495615_0158962_194_406 63
49 3300002737 JGI25162J39368_1000040 JGI25162J39368_100004073 64
50 3300002771 JGI25163J39215_1003116 JGI25163J39215_10031162 64
51 3300002772 JGI25164J39214_1003738 JGI25164J39214_10037382 64
52 3300003163 Ga0006759J45824_1048394 Ga0006759J45824_10483944 64
53 3300003214 JGI25165J46597_1000051 JGI25165J46597_1000051126 64
54 3300003544 Ga0007417J51691_1029706 Ga0007417J51691_10297064 64
55 3300003574 Ga0007410J51695_1022210 Ga0007410J51695_10222105 64
56 3300003575 Ga0007409J51694_1011163 Ga0007409J51694_10111635 64
57 3300003577 Ga0007416J51690_1019288 Ga0007416J51690_10192885 64
58 3300003693 Ga0032354_1026799 Ga0032354_10267994 64
59 3300003751 Ga0055538_1000025 Ga0055538_1000025107 64
60 3300003752 Ga0055539_1000032 Ga0055539_1000032126 64
61 3300003756 Ga0055533_1000042 Ga0055533_1000042107 64
62 3300003759 Ga0055525_1000050 Ga0055525_1000050107 64
63 3300003841 Ga0055541_1000023 Ga0055541_1000023106 64
64 3300005337 Ga0070682_100047452 Ga0070682_1000474521 64
65 3300005337 Ga0070682_100107229 Ga0070682_1001072291 64
66 3300005339 Ga0070660_100000635 Ga0070660_10000063522 64
67 3300005344 Ga0070661_100012425 Ga0070661_1000124258 64
68 3300005355 Ga0070671_100725987 Ga0070671_1007259872 64
69 3300005366 Ga0070659_100000846 Ga0070659_1000008465 64
70 3300005457 Ga0070662_100227346 Ga0070662_1002273463 64
71 3300005563 Ga0068855_100423896 Ga0068855_1004238963 64
72 3300005564 Ga0070664_100024701 Ga0070664_1000247014 64
73 3300005578 Ga0068854_100665303 Ga0068854_1006653032 64
74 3300009093 Ga0105240_10068872 Ga0105240_100688726 64
75 3300014497 Ga0182008_10141546 Ga0182008_101415464 64
76 3300015261 Ga0182006_1025239 Ga0182006_10252394 64
77 3300015265 Ga0182005_1000072 Ga0182005_10000728 64
78 3300017792 Ga0163161_10760096 Ga0163161_107600962 64
79 3300021361 Ga0213872_10224906 Ga0213872_102249062 64
80 3300025207 Ga0209760_100816 Ga0209760_1008162 64
81 3300025224 Ga0209784_100010 Ga0209784_100010484 64
82 3300025225 Ga0209566_100008 Ga0209566_100008484 64
83 3300025226 Ga0209674_100019 Ga0209674_100019484 64
84 3300025228 Ga0209672_102568 Ga0209672_1025684 64
85 3300025230 Ga0209563_100021 Ga0209563_100021484 64
86 3300025231 Ga0207427_100412 Ga0207427_1004128 64
87 3300025233 Ga0209437_100019 Ga0209437_100019484 64
88 3300025250 Ga0209026_1003704 Ga0209026_10037044 64
89 3300025253 Ga0209677_100011 Ga0209677_100011484 64
90 3300025261 Ga0209233_1000025 Ga0209233_1000025484 64
91 3300025913 Ga0207695_10176679 Ga0207695_101766794 64
92 3300025919 Ga0207657_10002555 Ga0207657_100025555 64
93 3300025920 Ga0207649_10047964 Ga0207649_100479642 64
94 3300025932 Ga0207690_10001840 Ga0207690_1000184013 64
95 3300025945 Ga0207679_10007419 Ga0207679_100074199 64
96 3300025981 Ga0207640_10496011 Ga0207640_104960111 64
97 3300032005 Ga0307411_11546318 Ga0307411_115463182 64
98 3300037312 Ga0395899_0002374 Ga0395899_0002374_12744_12992 64
99 3300037312 Ga0395899_0002465 Ga0395899_0002465_216_431 64
100 3300037312 Ga0395899_0008413 Ga0395899_0008413_2326_2577 64
101 3300037418 Ga0395900_0148369 Ga0395900_0148369_935_1150 64
102 3300037418 Ga0395900_0156850 Ga0395900_0156850_1693_1944 64
103 3300037418 Ga0395900_0386075 Ga0395900_0386075_101_349 64
104 3300037466 Ga0395898_1227227 Ga0395898_1227227_332_550 64
105 3300037466 Ga0395898_1319663 Ga0395898_1319663_108_323 64
106 3300037471 Ga0395905_0002518 Ga0395905_0002518_319_534 64
107 3300037471 Ga0395905_0007129 Ga0395905_0007129_463_678 64
108 3300037471 Ga0395905_0184633 Ga0395905_0184633_1340_1555 64
109 3300038443 Ga0395901_0010285 Ga0395901_0010285_567_818 64
110 3300038443 Ga0395901_0065039 Ga0395901_0065039_3290_3538 64
111 3300038443 Ga0395901_0381636 Ga0395901_0381636_267_482 64
112 3300039447 Ga0436361_1216743 Ga0436361_1216743_2203_2418 64
113 3300041413 Ga0439465_0194014 Ga0439465_0194014_315_530 64
114 3300041501 Ga0451845_0759000 Ga0451845_0759000_338_553 64
115 3300041509 Ga0451843_0253130 Ga0451843_0253130_66_281 64
116 3300041512 Ga0451853_3735907 Ga0451853_3735907_231_446 64
117 3300042006 Ga0439432_069561 Ga0439432_069561_627_842 64
118 3300042156 Ga0439446_0026724 Ga0439446_0026724_328_543 64
119 3300042876 Ga0451577_0588948 Ga0451577_0588948_599_817 64
120 3300044656 Ga0466969_0263114 Ga0466969_0263114_492_707 64
121 3300044658 Ga0466972_0057435 Ga0466972_0057435_87_302 64
122 3300044683 Ga0466965_0135679 Ga0466965_0135679_562_777 64
123 3300044684 Ga0466966_0014380 Ga0466966_0014380_1493_1708 64
124 3300044719 Ga0466971_0036334 Ga0466971_0036334_205_420 64
125 3300044842 Ga0466957_0591922 Ga0466957_0591922_535_750 64
126 3300045049 Ga0466959_0186037 Ga0466959_0186037_1214_1429 64
127 3300046453 Ga0495627_013250 Ga0495627_013250_1700_1915 64
128 3300046454 Ga0495592_0031701 Ga0495592_0031701_3541_3756 64
129 3300046454 Ga0495592_0449300 Ga0495592_0449300_475_690 64
130 3300046462 Ga0495651_0127219 Ga0495651_0127219_1450_1665 64
131 3300046462 Ga0495651_0135006 Ga0495651_0135006_307_522 64
132 3300046463 Ga0495653_0128191 Ga0495653_0128191_1300_1515 64
133 3300046475 Ga0495639_0629026 Ga0495639_0629026_146_361 64
134 3300046491 Ga0495584_0113579 Ga0495584_0113579_383_598 64
135 3300046492 Ga0495585_0536440 Ga0495585_0536440_209_424 64
136 3300046506 Ga0495583_0050617 Ga0495583_0050617_516_731 64
137 3300046507 Ga0495606_0007881 Ga0495606_0007881_7769_7984 64
138 3300046507 Ga0495606_0300161 Ga0495606_0300161_210_425 64
139 3300046511 Ga0495608_0004824 Ga0495608_0004824_3346_3561 64
140 3300046514 Ga0495618_0028162 Ga0495618_0028162_1312_1527 64
141 3300046516 Ga0495628_0017457 Ga0495628_0017457_1402_1617 64
142 3300046516 Ga0495628_0031791 Ga0495628_0031791_2574_2789 64
143 3300046516 Ga0495628_0298758 Ga0495628_0298758_646_861 64
144 3300046518 Ga0495631_0012598 Ga0495631_0012598_1185_1400 64
145 3300046523 Ga0495644_0104526 Ga0495644_0104526_261_476 64
146 3300046525 Ga0495663_0004508 Ga0495663_0004508_2445_2660 64
147 3300046525 Ga0495663_0070446 Ga0495663_0070446_578_793 64
148 3300046528 Ga0495642_0042609 Ga0495642_0042609_968_1183 64
149 3300046528 Ga0495642_0105190 Ga0495642_0105190_728_943 64
150 3300046529 Ga0495652_0018822 Ga0495652_0018822_204_419 64
151 3300046529 Ga0495652_0069934 Ga0495652_0069934_1455_1670 64
152 3300046529 Ga0495652_0417255 Ga0495652_0417255_447_662 64
153 3300046537 Ga0495598_0015811 Ga0495598_0015811_916_1137 64
154 3300046539 Ga0495621_0003724 Ga0495621_0003724_2985_3212 64
155 3300046539 Ga0495621_0180859 Ga0495621_0180859_454_669 64
156 3300046542 Ga0495597_0012223 Ga0495597_0012223_3253_3468 64
157 3300046543 Ga0495645_0081466 Ga0495645_0081466_297_512 64
158 3300046543 Ga0495645_0180354 Ga0495645_0180354_88_303 64
159 3300046558 Ga0495633_0007916 Ga0495633_0007916_4642_4857 64
160 3300046615 Ga0495656_0072745 Ga0495656_0072745_80_304 64
161 3300046615 Ga0495656_0099705 Ga0495656_0099705_839_1054 64
162 3300046615 Ga0495656_0238557 Ga0495656_0238557_409_624 64
163 3300046616 Ga0495668_0038924 Ga0495668_0038924_1427_1642 64
164 3300046663 Ga0495635_0020175 Ga0495635_0020175_1075_1290 64
165 3300046664 Ga0495659_0073412 Ga0495659_0073412_278_493 64
166 3300046664 Ga0495659_0301841 Ga0495659_0301841_316_543 64
167 3300046665 Ga0495661_0078709 Ga0495661_0078709_1234_1449 64
168 3300046674 Ga0495588_0035447 Ga0495588_0035447_1145_1360 64
169 3300046674 Ga0495588_0483780 Ga0495588_0483780_26_241 64
170 3300046674 Ga0495588_0725886 Ga0495588_0725886_62_283 64
171 3300046678 Ga0495599_0017037 Ga0495599_0017037_1489_1704 64
172 3300046679 Ga0495623_0115516 Ga0495623_0115516_28_243 64
173 3300046679 Ga0495623_0123467 Ga0495623_0123467_917_1132 64
174 3300046680 Ga0495646_0075656 Ga0495646_0075656_314_529 64
175 3300046680 Ga0495646_0111464 Ga0495646_0111464_319_534 64
176 3300046680 Ga0495646_0487464 Ga0495646_0487464_225_440 64
177 3300046690 Ga0495624_0149993 Ga0495624_0149993_528_743 64
178 3300046691 Ga0495670_0054501 Ga0495670_0054501_563_778 64
179 3300046691 Ga0495670_0189210 Ga0495670_0189210_362_577 64
180 3300046691 Ga0495670_0344205 Ga0495670_0344205_276_491 64
181 3300046692 Ga0495671_0097324 Ga0495671_0097324_79_294 64
182 3300046794 Ga0495589_0065538 Ga0495589_0065538_907_1122 64
183 3300046809 Ga0495600_0048876 Ga0495600_0048876_870_1085 64
184 3300047317 Ga0495604_0051540 Ga0495604_0051540_1682_1897 64
185 3300047318 Ga0495636_0004232 Ga0495636_0004232_1035_1250 64
186 3300047445 Ga0495677_0064387 Ga0495677_0064387_698_913 64
187 3300047447 Ga0495685_062150 Ga0495685_062150_821_1036 64
188 3300047447 Ga0495685_241225 Ga0495685_241225_152_367 64
189 3300047470 Ga0495681_0030147 Ga0495681_0030147_1366_1581 64
190 3300048088 Ga0495602_0067657 Ga0495602_0067657_870_1085 64
191 3300048090 Ga0495615_0053606 Ga0495615_0053606_794_1021 64
192 3300048904 Ga0496101_0057083 Ga0496101_0057083_1825_2052 64
193 3300048905 Ga0496102_0062327 Ga0496102_0062327_158_385 64
194 3300048905 Ga0496102_0254853 Ga0496102_0254853_712_927 64
195 3300048905 Ga0496102_0853942 Ga0496102_0853942_85_300 64
196 3300048906 Ga0496103_0124614 Ga0496103_0124614_804_1028 64
197 3300048906 Ga0496103_0325543 Ga0496103_0325543_85_300 64
198 3300048908 Ga0496105_0201617 Ga0496105_0201617_980_1207 64
199 3300048909 Ga0496106_0145810 Ga0496106_0145810_510_737 64
200 3300048909 Ga0496106_1203409 Ga0496106_1203409_358_573 64
201 3300048910 Ga0496107_0206537 Ga0496107_0206537_212_439 64
202 3300048912 Ga0496109_0191799 Ga0496109_0191799_994_1221 64
203 3300048913 Ga0496110_0033076 Ga0496110_0033076_1156_1383 64
204 3300048914 Ga0496111_0178471 Ga0496111_0178471_316_543 64
205 3300048918 Ga0496115_0238432 Ga0496115_0238432_971_1198 64
206 3300048924 Ga0496121_0076995 Ga0496121_0076995_1016_1231 64
207 3300049527 Ga0501311_002656 Ga0501311_002656_963_1178 64
208 3300049537 Ga0501321_011919 Ga0501321_011919_34_249 64
209 3300049571 Ga0501034_0899634 Ga0501034_0899634_33_248 64
210 3300049584 Ga0501068_1194590 Ga0501068_1194590_228_446 64
211 3300049779 Ga0501283_096337 Ga0501283_096337_197_412 64
212 3300053077 Ga0495601_0125298 Ga0495601_0125298_1149_1364 64
213 3300053077 Ga0495601_0175666 Ga0495601_0175666_714_929 64
214 3300053092 Ga0500583_0421310 Ga0500583_0421310_290_505 64
215 3300053119 Ga0500595_005237 Ga0500595_005237_1419_1664 64
216 3300053140 Ga0500573_0516393 Ga0500573_0516393_297_512 64
217 3300053141 Ga0500574_000366 Ga0500574_000366_4407_4622 64
218 3300053154 Ga0500619_000448 Ga0500619_000448_5817_6032 64
219 3300053161 Ga0500634_0120160 Ga0500634_0120160_584_808 64
220 3300059490 Ga0587066_068611 Ga0587066_068611_80_298 64
221 3300059493 Ga0587077_016292 Ga0587077_016292_821_1036 64
222 3300059503 Ga0587080_111673 Ga0587080_111673_77_292 64
223 3300059504 Ga0587082_061538 Ga0587082_061538_363_611 64
224 3300059507 Ga0587086_046446 Ga0587086_046446_453_668 64
225 3300059513 Ga0587094_037496 Ga0587094_037496_446_661 64
226 3300059639 Ga0587062_032756 Ga0587062_032756_15_230 64
227 3300059641 Ga0587068_052176 Ga0587068_052176_13_228 64
228 3300059645 Ga0587076_143932 Ga0587076_143932_337_552 64
229 3300059646 Ga0587078_027944 Ga0587078_027944_352_567 64
230 3300060344 Ga0587071_014054 Ga0587071_014054_844_1059 64
231 3300060346 Ga0587111_0089821 Ga0587111_0089821_101_316 64
232 3300061719 Ga0466962_0057349 Ga0466962_0057349_941_1156 64
233 iso_pu_bacteria 2548876994 2550695215 64
234 iso_pu_bacteria 2808606386 2808982553 64
235 iso_pu_bacteria 2808606415 2809129620 64
236 iso_pu_bacteria 2808606419 2809149325 64
237 iso_pu_bacteria 2818991445 2819592814 64
238 iso_pu_bacteria 2852618963 2852619467 64
239 iso_pu_bacteria 2884811622 2884815639 64
240 iso_pu_bacteria 2884836552 2884838619 64
241 iso_pu_bacteria 2884852848 2884854910 64
242 iso_pu_bacteria 2896154374 2896156421 64
243 iso_pu_bacteria 2904439833 2904440835 64
244 3300002704 JGI25155J39150_1000980 JGI25155J39150_10009803 65
245 3300002705 JGI25156J39149_1009650 JGI25156J39149_10096503 65
246 3300002738 JGI25154J39366_1001460 JGI25154J39366_10014603 65
247 3300002741 JGI25157J39369_1012328 JGI25157J39369_10123282 65
248 3300005328 Ga0070676_10123452 Ga0070676_101234522 65
249 3300005331 Ga0070670_100265682 Ga0070670_1002656822 65
250 3300005333 Ga0070677_10008129 Ga0070677_100081294 65
251 3300005334 Ga0068869_100742317 Ga0068869_1007423172 65
252 3300005335 Ga0070666_10089762 Ga0070666_100897622 65
253 3300005347 Ga0070668_100896274 Ga0070668_1008962742 65
254 3300005353 Ga0070669_100026644 Ga0070669_1000266444 65
255 3300005354 Ga0070675_100009273 Ga0070675_10000927310 65
256 3300005355 Ga0070671_100007158 Ga0070671_1000071583 65
257 3300005356 Ga0070674_100075398 Ga0070674_1000753983 65
258 3300005364 Ga0070673_100105779 Ga0070673_1001057793 65
259 3300005365 Ga0070688_100254406 Ga0070688_1002544062 65
260 3300005367 Ga0070667_100134776 Ga0070667_1001347763 65
261 3300005456 Ga0070678_100004379 Ga0070678_1000043793 65
262 3300005459 Ga0068867_100001941 Ga0068867_1000019414 65
263 3300005539 Ga0068853_101678607 Ga0068853_1016786071 65
264 3300005543 Ga0070672_100005168 Ga0070672_10000516810 65
265 3300005618 Ga0068864_100248084 Ga0068864_1002480842 65
266 3300005834 Ga0068851_10206900 Ga0068851_102069003 65
267 3300005840 Ga0068870_10186243 Ga0068870_101862433 65
268 3300005841 Ga0068863_100467181 Ga0068863_1004671812 65
269 3300006237 Ga0097621_100052565 Ga0097621_1000525654 65
270 3300006358 Ga0068871_100082131 Ga0068871_1000821315 65
271 3300006881 Ga0068865_100085871 Ga0068865_1000858712 65
272 3300009177 Ga0105248_11407201 Ga0105248_114072011 65
273 3300013296 Ga0157374_10123609 Ga0157374_101236092 65
274 3300013306 Ga0163162_10148095 Ga0163162_101480954 65
275 3300013308 Ga0157375_10143413 Ga0157375_101434134 65
276 3300014745 Ga0157377_11261913 Ga0157377_112619132 65
277 3300014969 Ga0157376_10292276 Ga0157376_102922764 65
278 3300017792 Ga0163161_10021384 Ga0163161_100213844 65
279 3300025206 Ga0209435_100212 Ga0209435_1002123 65
280 3300025246 Ga0209646_1000141 Ga0209646_100014128 65
281 3300025250 Ga0209026_1007405 Ga0209026_10074054 65
282 3300025256 Ga0209759_1000072 Ga0209759_1000072155 65
283 3300025321 Ga0207656_10245498 Ga0207656_102454982 65
284 3300025893 Ga0207682_10011022 Ga0207682_100110224 65
285 3300025899 Ga0207642_10197679 Ga0207642_101976792 65
286 3300025901 Ga0207688_10070573 Ga0207688_100705734 65
287 3300025907 Ga0207645_10098849 Ga0207645_100988494 65
288 3300025908 Ga0207643_10037664 Ga0207643_100376642 65
289 3300025923 Ga0207681_10035624 Ga0207681_100356244 65
290 3300025925 Ga0207650_10017584 Ga0207650_100175843 65
291 3300025926 Ga0207659_10001102 Ga0207659_100011024 65
292 3300025931 Ga0207644_10000537 Ga0207644_1000053723 65
293 3300025937 Ga0207669_10076629 Ga0207669_100766294 65
294 3300025938 Ga0207704_10449315 Ga0207704_104493152 65
295 3300025940 Ga0207691_10002343 Ga0207691_1000234322 65
296 3300025942 Ga0207689_10443705 Ga0207689_104437052 65
297 3300025960 Ga0207651_10099185 Ga0207651_100991853 65
298 3300025972 Ga0207668_11158546 Ga0207668_111585461 65
299 3300025972 Ga0207668_11181032 Ga0207668_111810322 65
300 3300025986 Ga0207658_10060560 Ga0207658_100605604 65
301 3300026088 Ga0207641_10052852 Ga0207641_100528522 65
302 3300026089 Ga0207648_10013271 Ga0207648_100132719 65
303 3300026095 Ga0207676_10041554 Ga0207676_100415544 65
304 3300026121 Ga0207683_10093004 Ga0207683_100930044 65
305 3300041452 Ga0451793_1574030 Ga0451793_1574030_11_256 65
306 3300048911 Ga0496108_1802553 Ga0496108_1802553_36_281 65
307 3300053125 Ga0500618_007632 Ga0500618_007632_972_1199 65
308 iso_pu_bacteria 2521172590 2521560133 65
309 iso_pu_bacteria 2551306416 2553004918 65
310 iso_pu_bacteria 2765235838 2765571281 65
311 iso_pu_bacteria 2818991449 2819616485 65
312 iso_pu_bacteria 2839094727 2839099122 65
313 iso_pu_bacteria 2904530477 2904535443 65
314 iso_pu_bacteria 2904584206 2904588417 65
315 iso_pu_bacteria 2904589729 2904594695 65
316 iso_pu_bacteria 2904601388 2904605924 65
317 iso_pu_bacteria 2919046199 2919049013 65
318 iso_pu_bacteria 2919079590 2919084616 65
319 iso_pu_bacteria 2923510766 2923513862 65
320 iso_pu_bacteria 2928130867 2928134295 65
321 3300005578 Ga0068854_100115551 Ga0068854_1001155512 67
322 3300009093 Ga0105240_11273159 Ga0105240_112731591 67
323 3300009551 Ga0105238_10000037 Ga0105238_1000003788 67
324 3300010375 Ga0105239_10090894 Ga0105239_100908944 67
325 3300025913 Ga0207695_10004485 Ga0207695_1000448514 67
326 3300025924 Ga0207694_10000054 Ga0207694_1000005489 67
327 3300025981 Ga0207640_10098805 Ga0207640_100988052 67
328 3300002704 JGI25155J39150_1000388 JGI25155J39150_10003883 68
329 3300002705 JGI25156J39149_1000503 JGI25156J39149_10005033 68
330 3300002705 JGI25156J39149_1001960 JGI25156J39149_10019607 68
331 3300002738 JGI25154J39366_1001102 JGI25154J39366_10011025 68
332 3300002741 JGI25157J39369_1000171 JGI25157J39369_100017163 68
333 3300003758 Ga0055532_1000044 Ga0055532_100004467 68
334 3300003761 Ga0055535_1009469 Ga0055535_10094692 68
335 3300003763 Ga0055529_1007471 Ga0055529_10074712 68
336 3300005563 Ga0068855_100000702 Ga0068855_10000070240 68
337 3300005563 Ga0068855_100012982 Ga0068855_1000129827 68
338 3300005563 Ga0068855_100568295 Ga0068855_1005682952 68
339 3300005577 Ga0068857_100520774 Ga0068857_1005207742 68
340 3300005614 Ga0068856_100879597 Ga0068856_1008795971 68
341 3300005616 Ga0068852_100012314 Ga0068852_1000123147 68
342 3300005834 Ga0068851_10114159 Ga0068851_101141593 68
343 3300009011 Ga0105251_10054785 Ga0105251_100547854 68
344 3300009011 Ga0105251_10088662 Ga0105251_100886621 68
345 3300009036 Ga0105244_10204635 Ga0105244_102046352 68
346 3300009093 Ga0105240_10008038 Ga0105240_100080384 68
347 3300009545 Ga0105237_10077284 Ga0105237_100772843 68
348 3300009545 Ga0105237_10180994 Ga0105237_101809942 68
349 3300009545 Ga0105237_10229152 Ga0105237_102291524 68
350 3300009551 Ga0105238_10109420 Ga0105238_101094204 68
351 3300010375 Ga0105239_11034676 Ga0105239_110346762 68
352 3300015261 Ga0182006_1007985 Ga0182006_10079853 68
353 3300025206 Ga0209435_100004 Ga0209435_100004475 68
354 3300025229 Ga0209147_100011 Ga0209147_100011544 68
355 3300025242 Ga0209258_100279 Ga0209258_10027934 68
356 3300025246 Ga0209646_1000140 Ga0209646_100014086 68
357 3300025250 Ga0209026_1000066 Ga0209026_1000066101 68
358 3300025256 Ga0209759_1000114 Ga0209759_100011436 68
359 3300025272 Ga0209455_1001763 Ga0209455_10017635 68
360 3300025321 Ga0207656_10068314 Ga0207656_100683142 68
361 3300025728 Ga0207655_1143297 Ga0207655_11432972 68
362 3300025735 Ga0207713_1138168 Ga0207713_11381682 68
363 3300025913 Ga0207695_10031442 Ga0207695_100314424 68
364 3300025914 Ga0207671_10050147 Ga0207671_100501472 68
365 3300025914 Ga0207671_10271791 Ga0207671_102717911 68
366 3300025925 Ga0207650_10078390 Ga0207650_100783901 68
367 3300025949 Ga0207667_10000043 Ga0207667_1000004394 68
368 3300025949 Ga0207667_10048321 Ga0207667_100483214 68
369 3300026078 Ga0207702_10028447 Ga0207702_100284478 68
370 3300026116 Ga0207674_10606031 Ga0207674_106060313 68
371 3300046530 Ga0495654_0092566 Ga0495654_0092566_422_649 68
372 3300046660 Ga0495625_0025223 Ga0495625_0025223_2658_2885 68
373 3300048919 Ga0496116_0023448 Ga0496116_0023448_1194_1421 68
374 3300048920 Ga0496117_0106702 Ga0496117_0106702_829_1056 68
375 3300048921 Ga0496118_0169420 Ga0496118_0169420_611_838 68
376 3300048924 Ga0496121_0186954 Ga0496121_0186954_1058_1285 68
377 3300048925 Ga0496122_0003152 Ga0496122_0003152_20636_20863 68
378 3300048926 Ga0496123_0020210 Ga0496123_0020210_3924_4151 68
379 3300048927 Ga0496124_0797670 Ga0496124_0797670_247_477 68
380 3300048928 Ga0496125_0008330 Ga0496125_0008330_1218_1445 68

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11174

DUF2970

Protein of unknown function (DUF2970)

26

81

0.97

Feature Viewer

pLDDT pTM Quality
69.3 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map