F428491

General Info

Members Datasets Scaffolds Average Seq Length
379 229 758 323

Family's Representative Sequence

Representative Sequence 3300050489|nmdc:mga03683_121180_c1|nmdc:mga03683_121180_c1_26_1147
Length 373
Sequence LVFAAWTNSSAPLARGDVGRRCVSVGSVARKQQQHTAARSGLVTLATGVGSHPGDDQRDFDEAVRLVLGEVPDLVYLPEVPGRGVTAGMTGRALATVSGIGVDLQPAGWRLTDAAGVDHRRARSLLAQDLDGFEEQTQGYAGTVKIQVAGPWTLAATVERPRGDKVLGDHGARRDLAQALAEGLRDHVADVRRRVPDAARLVVQVDEPALAAVLDAAIPTASGFGRHRAVHPPEVSQSLEWVLAAIAEAGAEPWVHTCAPGTPLGLLRGAGARGLSVDHAQLSARDHDELGSALEAGETVALGVVASTEPTSPPNDSQVTEAALRWLDMLGLDAEEVGERLVLTPACGLAGATPAWARQSLELLRAAASHLSG

Samples

Sample ID Description Type Environment
1 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
121 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
122 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
123 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
124 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
125 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
126 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
127 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
130 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
131 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
132 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
200 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
201 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
205 2643221561 Nocardioides sp. Root151 Isolate Unclassified
206 2643221576 Nocardioides sp. Root614 Isolate Unclassified
207 2643221590 Nocardioides sp. Root682 Isolate Unclassified
208 2643221604 Nocardioides sp. Root190 Isolate Unclassified
209 2643221615 Nocardioides sp. Root224 Isolate Unclassified
210 2643221617 Nocardioides sp. Root79 Isolate Unclassified
211 2643221620 Nocardioides sp. Root240 Isolate Unclassified
212 2643221641 Nocardioides sp. Root122 Isolate Unclassified
213 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
214 2643221696 Nocardioides sp. Root140 Isolate Unclassified
215 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
216 2738541305 Nocardioides sp. CF167 Isolate Unclassified
217 2739367898 Nocardioides sp. CF479 Isolate Unclassified
218 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
219 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
220 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
221 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
222 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
223 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
224 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
225 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
226 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
227 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
228 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
229 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.4
Metatranscriptomes 0
Isolates 6.6

Biome Distribution

Category Percentage (%)
Aerial Root 0.79
Bulb 0
Endosphere 11.35
Nodule 0.26
Rhizoplane 6.6
Rhizosphere 72.82
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03683_121180_c1 3300050489 Bacteria 1163
2 rootH1_10147930 3300003316 Bacteria 1644
3 rootH1_10076249 3300003323 Bacteria 1678
4 rootH1_10120422 3300003323 Bacteria 2875
5 Ga0070683_100010530 3300005329 Bacteria 7951
6 Ga0070683_100103101 3300005329 Bacteria 2688
7 Ga0070683_100127594 3300005329 Bacteria 2405
8 Ga0070683_100197178 3300005329 Bacteria 1912
9 Ga0070683_100258184 3300005329 Bacteria 1657
10 Ga0070670_100154905 3300005331 Bacteria 1984
11 Ga0070670_100201632 3300005331 Bacteria 1729
12 Ga0070680_100228339 3300005336 Bacteria 1572
13 Ga0070682_100147459 3300005337 Bacteria 1611
14 Ga0068868_100156078 3300005338 Bacteria 1882
15 Ga0070660_100062798 3300005339 Bacteria 2887
16 Ga0070660_100118125 3300005339 Bacteria 2115
17 Ga0070691_10034736 3300005341 Bacteria 2374
18 Ga0070692_10000949 3300005345 Bacteria 9852
19 Ga0070674_100412506 3300005356 Bacteria 1106
20 Ga0070659_100052240 3300005366 Bacteria 3214
21 Ga0070659_100185341 3300005366 Bacteria 1709
22 Ga0070667_100073432 3300005367 Bacteria 2916
23 Ga0070714_100019456 3300005435 Bacteria 5533
24 Ga0070701_10002368 3300005438 Bacteria 7243
25 Ga0070700_100010269 3300005441 Bacteria 5167
26 Ga0070700_100018282 3300005441 Bacteria 4028
27 Ga0070681_10134329 3300005458 Bacteria 2405
28 Ga0068867_100134855 3300005459 Bacteria 1923
29 Ga0070685_10102229 3300005466 Bacteria 1752
30 Ga0070698_100033896 3300005471 Bacteria 5289
31 Ga0070684_100263166 3300005535 Bacteria 1578
32 Ga0068853_100126940 3300005539 Bacteria 2279
33 Ga0068853_100134888 3300005539 Bacteria 2212
34 Ga0070672_100094451 3300005543 Bacteria 2417
35 Ga0070686_100064780 3300005544 Bacteria 2372
36 Ga0070665_100001782 3300005548 Bacteria 24532
37 Ga0070665_100499457 3300005548 Bacteria 1228
38 Ga0068857_100001378 3300005577 Bacteria 19178
39 Ga0068857_100202816 3300005577 Bacteria 1808
40 Ga0068854_100135050 3300005578 Bacteria 1888
41 Ga0070702_100028046 3300005615 Bacteria 3047
42 Ga0068852_100012642 3300005616 Bacteria 6418
43 Ga0068864_100085275 3300005618 Bacteria 2777
44 Ga0068861_100005937 3300005719 Bacteria 8296
45 Ga0068861_100180970 3300005719 Bacteria 1755
46 Ga0068861_100235765 3300005719 Bacteria 1554
47 Ga0068870_10006908 3300005840 Bacteria 5035
48 Ga0068858_100334025 3300005842 Bacteria 1450
49 Ga0068860_100299577 3300005843 Bacteria 1575
50 Ga0081455_10000134 3300005937 Bacteria 87309
51 Ga0081455_10003440 3300005937 Bacteria 18194
52 Ga0081455_10008171 3300005937 Bacteria 10914
53 Ga0081455_10014988 3300005937 Bacteria 7550
54 Ga0081538_10000249 3300005981 Bacteria 61087
55 Ga0081538_10041091 3300005981 Bacteria 2940
56 Ga0075365_10002868 3300006038 Bacteria 8669
57 Ga0075365_10011530 3300006038 Bacteria 5200
58 Ga0075365_10037697 3300006038 Bacteria 3139
59 Ga0075365_10106463 3300006038 Bacteria 1924
60 Ga0075365_10128959 3300006038 Bacteria 1749
61 Ga0075365_10137447 3300006038 Bacteria 1694
62 Ga0075365_10158829 3300006038 Bacteria 1574
63 Ga0075368_10000054 3300006042 Bacteria 28035
64 Ga0075363_100010938 3300006048 Bacteria 4329
65 Ga0075363_100155141 3300006048 Bacteria 1294
66 Ga0075364_10071511 3300006051 Bacteria 2285
67 Ga0075364_10079589 3300006051 Bacteria 2165
68 Ga0075364_10083112 3300006051 Bacteria 2119
69 Ga0075364_10147871 3300006051 Bacteria 1582
70 Ga0075432_10001711 3300006058 Bacteria 7217
71 Ga0075362_10053530 3300006177 Bacteria 1812
72 Ga0075367_10029382 3300006178 Bacteria 3143
73 Ga0075370_10040707 3300006353 Bacteria 2622
74 Ga0075370_10057118 3300006353 Bacteria 2218
75 Ga0075370_10230717 3300006353 Bacteria 1095
76 Ga0075428_100000157 3300006844 Bacteria 62029
77 Ga0075428_100005047 3300006844 Bacteria 14673
78 Ga0075430_100019208 3300006846 Bacteria 5811
79 Ga0075430_100300204 3300006846 Bacteria 1328
80 Ga0075431_100003368 3300006847 Bacteria 15495
81 Ga0075431_100012127 3300006847 Bacteria 8695
82 Ga0075433_10000435 3300006852 Bacteria 26924
83 Ga0075434_100006856 3300006871 Bacteria 10490
84 Ga0075429_100045195 3300006880 Bacteria 3831
85 Ga0068865_100056709 3300006881 Bacteria 2730
86 Ga0111539_10000385 3300009094 Bacteria 54507
87 Ga0105245_10006723 3300009098 Bacteria 10088
88 Ga0105245_10033341 3300009098 Bacteria 4564
89 Ga0105245_10539531 3300009098 Bacteria 1187
90 Ga0114129_10001879 3300009147 Bacteria 28641
91 Ga0114129_10015788 3300009147 Bacteria 10737
92 Ga0105243_10026014 3300009148 Bacteria 4477
93 Ga0105243_10062268 3300009148 Bacteria 2987
94 Ga0105243_10070018 3300009148 Bacteria 2831
95 Ga0105243_10112880 3300009148 Bacteria 2278
96 Ga0105242_10229213 3300009176 Bacteria 1664
97 Ga0105242_10330769 3300009176 Bacteria 1401
98 Ga0105248_10252304 3300009177 Bacteria 1986
99 Ga0105238_10091553 3300009551 Bacteria 3028
100 Ga0105238_10189785 3300009551 Bacteria 2031
101 Ga0105249_10029419 3300009553 Bacteria 4960
102 Ga0105249_10073410 3300009553 Bacteria 3165
103 Ga0105249_10291352 3300009553 Bacteria 1634
104 Ga0105239_10023375 3300010375 Bacteria 6807
105 Ga0105239_10181990 3300010375 Bacteria 2351
106 Ga0105246_10098082 3300011119 Bacteria 2128
107 Ga0105246_10116978 3300011119 Bacteria 1969
108 Ga0157371_10080042 3300013102 Bacteria 2314
109 Ga0157369_10081282 3300013105 Bacteria 3468
110 Ga0157369_10089490 3300013105 Bacteria 3286
111 Ga0157369_10211787 3300013105 Bacteria 2031
112 Ga0163162_10172455 3300013306 Bacteria 2288
113 Ga0163162_10248424 3300013306 Bacteria 1911
114 Ga0157372_10027087 3300013307 Bacteria 6239
115 Ga0157372_10047817 3300013307 Bacteria 4755
116 Ga0157372_10086537 3300013307 Bacteria 3555
117 Ga0157372_10116577 3300013307 Bacteria 3063
118 Ga0157375_10022051 3300013308 Bacteria 5857
119 Ga0157375_10108142 3300013308 Bacteria 2875
120 Ga0157375_10388768 3300013308 Bacteria 1562
121 Ga0163163_10021282 3300014325 Bacteria 6117
122 Ga0163163_10077622 3300014325 Bacteria 3316
123 Ga0157380_10004780 3300014326 Bacteria 9438
124 Ga0157379_10035921 3300014968 Bacteria 4419
125 Ga0213875_10025120 3300021388 Bacteria 2840
126 Ga0207688_10052527 3300025901 Bacteria 2284
127 Ga0207647_10159948 3300025904 Bacteria 1314
128 Ga0207643_10055872 3300025908 Bacteria 2245
129 Ga0207660_10091545 3300025917 Bacteria 2256
130 Ga0207662_10187487 3300025918 Bacteria 1333
131 Ga0207657_10027634 3300025919 Bacteria 5193
132 Ga0207657_10138293 3300025919 Bacteria 1992
133 Ga0207652_10156342 3300025921 Bacteria 2043
134 Ga0207650_10161677 3300025925 Bacteria 1775
135 Ga0207664_10035283 3300025929 Bacteria 3858
136 Ga0207690_10125064 3300025932 Bacteria 1874
137 Ga0207690_10162086 3300025932 Bacteria 1668
138 Ga0207709_10040125 3300025935 Bacteria 2801
139 Ga0207709_10099207 3300025935 Bacteria 1922
140 Ga0207704_10070841 3300025938 Bacteria 2210
141 Ga0207704_10244224 3300025938 Bacteria 1343
142 Ga0207691_10005138 3300025940 Bacteria 12635
143 Ga0207711_10123997 3300025941 Bacteria 2309
144 Ga0207661_10038389 3300025944 Bacteria 3753
145 Ga0207661_10059924 3300025944 Bacteria 3069
146 Ga0207661_10207582 3300025944 Bacteria 1725
147 Ga0207661_10337328 3300025944 Bacteria 1358
148 Ga0207712_10292309 3300025961 Bacteria 1334
149 Ga0207658_10087050 3300025986 Bacteria 2412
150 Ga0207703_10147818 3300026035 Bacteria 2046
151 Ga0207639_10068933 3300026041 Bacteria 2758
152 Ga0207708_10000180 3300026075 Bacteria 49555
153 Ga0207708_10041644 3300026075 Bacteria 3501
154 Ga0207648_10016593 3300026089 Bacteria 6723
155 Ga0207648_10150642 3300026089 Bacteria 2052
156 Ga0207676_10139901 3300026095 Bacteria 2071
157 Ga0207674_10034112 3300026116 Bacteria 5322
158 Ga0207675_100004600 3300026118 Bacteria 13296
159 Ga0207675_100064680 3300026118 Bacteria 3419
160 Ga0207675_100166305 3300026118 Bacteria 2106
161 Ga0207675_100329536 3300026118 Bacteria 1492
162 Ga0207698_10013086 3300026142 Bacteria 5462
163 Ga0209813_10002774 3300027866 Bacteria 4044
164 Ga0207428_10000187 3300027907 Bacteria 85885
165 Ga0268266_10006026 3300028379 Bacteria 11180
166 Ga0268264_10374169 3300028381 Bacteria 1362
167 Ga0316182_1246057 3300030745 Bacteria 4072
168 Ga0307513_10179683 3300031456 Bacteria 1981
169 Ga0307408_100033314 3300031548 Bacteria 3599
170 Ga0307408_100167037 3300031548 Bacteria 1754
171 Ga0307405_10369214 3300031731 Bacteria 1113
172 Ga0307413_10016535 3300031824 Bacteria 3814
173 Ga0307410_10013860 3300031852 Bacteria 4720
174 Ga0307406_10000015 3300031901 Bacteria 106825
175 Ga0307406_10028307 3300031901 Bacteria 3385
176 Ga0307406_10124269 3300031901 Bacteria 1800
177 Ga0307407_10010006 3300031903 Bacteria 4450
178 Ga0307412_10008838 3300031911 Bacteria 5768
179 Ga0307409_100000006 3300031995 Bacteria 82927
180 Ga0307409_100041988 3300031995 Bacteria 3421
181 Ga0307409_100494379 3300031995 Bacteria 1190
182 Ga0307416_100000465 3300032002 Bacteria 20705
183 Ga0307416_100342078 3300032002 Bacteria 1509
184 Ga0307414_10007782 3300032004 Bacteria 6041
185 Ga0307414_10049884 3300032004 Bacteria 2896
186 Ga0307411_10015649 3300032005 Bacteria 4268
187 Ga0307411_10198170 3300032005 Bacteria 1540
188 Ga0307415_100002830 3300032126 Bacteria 8687
189 Ga0307415_100022165 3300032126 Bacteria 3916
190 Ga0373938_0007875 3300034957 Bacteria 1888
191 Ga0395900_0041606 3300037418 Bacteria 4737
192 Ga0395898_0610771 3300037466 Bacteria 1033
193 Ga0436364_1044241 3300037853 Bacteria 2863
194 Ga0395901_0368077 3300038443 Bacteria 1481
195 Ga0439461_0004718 3300041410 Bacteria 2291
196 Ga0439465_0031208 3300041413 Bacteria 1697
197 Ga0451793_0380925 3300041452 Bacteria 3911
198 Ga0451800_0436503 3300041459 Unclassified 1032
199 Ga0451833_0344967 3300041491 Bacteria 5813
200 Ga0451837_0111521 3300041494 Bacteria 2667
201 Ga0451839_0173709 3300041496 Bacteria 1698
202 Ga0451841_0215287 3300041498 Bacteria 1586
203 Ga0451853_2428981 3300041512 Bacteria 8658
204 Ga0451853_2441966 3300041512 Bacteria 1408
205 Ga0439448_0014123 3300042005 Bacteria 2406
206 Ga0439463_001409 3300042016 Bacteria 6383
207 Ga0439463_012872 3300042016 Bacteria 2056
208 Ga0439464_0050410 3300042439 Bacteria 1202
209 Ga0439440_0025717 3300042993 Bacteria 1358
210 Ga0466972_0094096 3300044658 Bacteria 1420
211 Ga0466966_0017954 3300044684 Bacteria 4671
212 Ga0466963_0006003 3300044694 Bacteria 7158
213 Ga0466963_0073052 3300044694 Bacteria 2312
214 Ga0466963_0284583 3300044694 Bacteria 1162
215 Ga0466970_0018642 3300044765 Bacteria 3596
216 Ga0466957_0061051 3300044842 Bacteria 2312
217 Ga0466957_0104779 3300044842 Bacteria 1787
218 Ga0466960_0038996 3300044901 Bacteria 2238
219 Ga0466960_0039306 3300044901 Bacteria 2231
220 Ga0466959_0081729 3300045049 Bacteria 2328
221 Ga0466967_0014125 3300045976 Bacteria 6204
222 Ga0466967_0044368 3300045976 Bacteria 3856
223 Ga0466967_0076484 3300045976 Bacteria 3011
224 Ga0495625_0113457 3300046660 Bacteria 1851
225 Ga0495581_0039405 3300047315 Bacteria 2735
226 Ga0496100_0176600 3300048903 Bacteria 1542
227 Ga0496102_0091185 3300048905 Bacteria 2821
228 Ga0496102_0176830 3300048905 Bacteria 2010
229 Ga0496102_0293224 3300048905 Bacteria 1533
230 Ga0496102_0407301 3300048905 Bacteria 1278
231 Ga0496103_0081728 3300048906 Bacteria 2033
232 Ga0496104_0011220 3300048907 Bacteria 8018
233 Ga0496105_0042630 3300048908 Bacteria 3741
234 Ga0496106_0196187 3300048909 Bacteria 1606
235 Ga0496106_0279661 3300048909 Bacteria 1337
236 Ga0496107_0004467 3300048910 Bacteria 9484
237 Ga0496108_0011627 3300048911 Bacteria 7161
238 Ga0496108_0089218 3300048911 Bacteria 2620
239 Ga0496109_0009492 3300048912 Bacteria 8294
240 Ga0496109_0027405 3300048912 Bacteria 5086
241 Ga0496109_0067302 3300048912 Bacteria 3281
242 Ga0496109_0128000 3300048912 Bacteria 2369
243 Ga0496110_0285148 3300048913 Bacteria 1504
244 Ga0496111_0186437 3300048914 Bacteria 1542
245 Ga0496114_0020354 3300048917 Bacteria 5385
246 Ga0496114_0020751 3300048917 Bacteria 5334
247 Ga0496114_0156909 3300048917 Bacteria 1976
248 Ga0496115_0015736 3300048918 Bacteria 5745
249 Ga0501031_0000088 3300049568 Bacteria 49317
250 Ga0501031_0126318 3300049568 Bacteria 1671
251 Ga0501031_0153579 3300049568 Bacteria 1505
252 Ga0501032_0000473 3300049569 Bacteria 32455
253 Ga0501033_0001814 3300049570 Bacteria 18660
254 Ga0501034_0003170 3300049571 Bacteria 18909
255 Ga0501034_0017702 3300049571 Bacteria 7308
256 Ga0501034_0030009 3300049571 Bacteria 5527
257 Ga0501036_0003938 3300049572 Bacteria 11929
258 Ga0501036_0017027 3300049572 Bacteria 6074
259 Ga0501036_0048580 3300049572 Bacteria 3593
260 Ga0501037_0001051 3300049573 Bacteria 20410
261 Ga0501038_0000311 3300049574 Bacteria 41564
262 Ga0501039_0000286 3300049575 Bacteria 36137
263 Ga0501039_0003707 3300049575 Bacteria 11468
264 Ga0501039_0028408 3300049575 Bacteria 4306
265 Ga0501039_0040854 3300049575 Bacteria 3580
266 Ga0501040_0065324 3300049576 Bacteria 2506
267 Ga0501041_0239429 3300049577 Bacteria 1140
268 Ga0501042_0036745 3300049578 Bacteria 3475
269 Ga0501042_0204496 3300049578 Bacteria 1424
270 Ga0501043_0001106 3300049579 Bacteria 23688
271 Ga0501043_0013438 3300049579 Bacteria 6403
272 Ga0501046_0000052 3300049580 Bacteria 132914
273 Ga0501047_0007698 3300049581 Bacteria 10147
274 Ga0501048_0000012 3300049582 Bacteria 79691
275 Ga0501067_0001547 3300049583 Bacteria 12552
276 Ga0501067_0009787 3300049583 Bacteria 5305
277 Ga0501068_0009816 3300049584 Bacteria 5362
278 Ga0501068_0015456 3300049584 Bacteria 4384
279 Ga0501069_0001434 3300049585 Bacteria 11695
280 Ga0501070_0006753 3300049586 Bacteria 9769
281 Ga0501070_0008112 3300049586 Bacteria 8889
282 Ga0501070_0024252 3300049586 Bacteria 5087
283 Ga0501070_0106560 3300049586 Bacteria 2317
284 Ga0501071_0029955 3300049587 Bacteria 3846
285 Ga0501071_0031475 3300049587 Bacteria 3761
286 Ga0501071_0071185 3300049587 Bacteria 2535
287 Ga0501071_0370112 3300049587 Bacteria 1092
288 Ga0501072_0039002 3300049588 Bacteria 3729
289 Ga0501072_0040913 3300049588 Bacteria 3640
290 Ga0501072_0124816 3300049588 Bacteria 2051
291 Ga0501073_0011432 3300049589 Bacteria 6495
292 Ga0501073_0020163 3300049589 Bacteria 4808
293 Ga0501074_0000071 3300049590 Bacteria 48728
294 Ga0501074_0000822 3300049590 Bacteria 19680
295 Ga0501074_0001409 3300049590 Bacteria 16006
296 Ga0501075_0135678 3300049591 Bacteria 1875
297 Ga0501076_0006744 3300049592 Bacteria 8330
298 Ga0501076_0206917 3300049592 Bacteria 1603
299 Ga0501077_0005154 3300049593 Bacteria 7938
300 Ga0501077_0071770 3300049593 Bacteria 2194
301 Ga0501079_0091791 3300049741 Bacteria 2353
302 Ga0501080_0000415 3300049742 Bacteria 32692
303 Ga0501080_0005076 3300049742 Bacteria 11727
304 Ga0501080_0009465 3300049742 Bacteria 8886
305 Ga0501080_0010583 3300049742 Bacteria 8442
306 Ga0501080_0031952 3300049742 Bacteria 4907
307 Ga0501083_0006459 3300049744 Bacteria 8318
308 Ga0501083_0009292 3300049744 Bacteria 6940
309 Ga0501083_0011086 3300049744 Bacteria 6332
310 Ga0501083_0206601 3300049744 Bacteria 1281
311 Ga0501035_0001182 3300049822 Bacteria 27177
312 Ga0501035_0035571 3300049822 Bacteria 4519
313 Ga0501035_0251711 3300049822 Bacteria 1500
314 Ga0501044_0001157 3300049823 Bacteria 31240
315 Ga0501044_0160529 3300049823 Bacteria 2225
316 nmdc:mga03683_39431_c1 3300050489 Bacteria 1934
317 nmdc:mga00v17_158815_c1 3300050491 Bacteria 1454
318 nmdc:mga00v17_193164_c1 3300050491 Bacteria 1315
319 nmdc:mga00v17_26529_c1 3300050491 Bacteria 3377
320 nmdc:mga00v17_30431_c1 3300050491 Bacteria 3177
321 nmdc:mga0yw44_106184_c1 3300050492 Bacteria 1794
322 nmdc:mga0yw44_112365_c1 3300050492 Bacteria 1747
323 nmdc:mga0yw44_112762_c1 3300050492 Bacteria 1744
324 nmdc:mga0yw44_53967_c1 3300050492 Bacteria 2441
325 nmdc:mga0yw44_56509_c1 3300050492 Bacteria 2391
326 nmdc:mga0yw44_58011_c1 3300050492 Bacteria 2363
327 nmdc:mga0yw44_62689_c1 3300050492 Bacteria 2284
328 nmdc:mga0yw44_90518_c1 3300050492 Bacteria 1933
329 nmdc:mga06z11_123419_c1 3300050494 Bacteria 1447
330 nmdc:mga06z11_53822_c1 3300050494 Bacteria 2072
331 nmdc:mga06z11_68823_c1 3300050494 Bacteria 1867
332 nmdc:mga04h51_516_c1 3300050495 Bacteria 7077
333 nmdc:mga07m45_123170_c1 3300050496 Bacteria 1498
334 nmdc:mga07m45_362_c1 3300050496 Bacteria 17810
335 nmdc:mga05p37_1355_c1 3300050507 Bacteria 28485
336 nmdc:mga05p37_17557_c1 3300050507 Bacteria 8639
337 nmdc:mga09592_1034_c1 3300050508 Bacteria 22111
338 nmdc:mga0qj67_19371_c1 3300050509 Bacteria 5198
339 nmdc:mga0qj67_216787_c1 3300050509 Bacteria 1554
340 nmdc:mga06r32_543094_c1 3300050510 Bacteria 1137
341 nmdc:mga06r32_902_c1 3300050510 Bacteria 26465
342 nmdc:mga08y16_110413_c1 3300050511 Bacteria 2864
343 nmdc:mga08y16_187199_c1 3300050511 Bacteria 2148
344 nmdc:mga08y16_8882_c1 3300050511 Bacteria 10548
345 nmdc:mga0a205_15260_c1 3300050515 Bacteria 7178
346 Ga0495595_0107415 3300053084 Bacteria 1351
347 Ga0500644_0000128 3300053088 Bacteria 46307
348 Ga0500654_062433 3300053099 Bacteria 1894
349 Ga0500556_0001673 3300053104 Bacteria 8585
350 Ga0501084_0001016 3300054114 Bacteria 21740
351 Ga0501084_0039132 3300054114 Bacteria 3966
352 Ga0501082_0066891 3300060353 Bacteria 3094
353 Ga0501082_0126708 3300060353 Bacteria 2214
354 Ga0530510_0290994 3300061734 Bacteria 1221
355 2643828140 2643221561 Bacteria 4984412
356 2643893283 2643221576 Bacteria 5214352
357 2643961658 2643221590 Bacteria 5214697
358 2644033990 2643221604 Bacteria 5014917
359 2644090061 2643221615 Bacteria 5487866
360 2644102707 2643221617 Bacteria 5139111
361 2644118369 2643221620 Bacteria 5134593
362 2644231327 2643221641 Bacteria 4490190
363 2644319906 2643221657 Bacteria 5490246
364 2644531229 2643221696 Bacteria 5431823
365 2644537980 2643221697 Bacteria 3575694
366 2738871585 2738541305 Bacteria 4910150
367 2740166654 2739367898 Bacteria 4367674
368 2774393748 2773857762 Bacteria 5971770
369 2809195375 2808606439 Bacteria 5952208
370 2812333961 2811994874 Bacteria 5367947
371 2812350248 2811994878 Bacteria 5992952
372 2816427403 2816332119 Bacteria 8120218
373 2857483502 2857481737 Bacteria 4761446
374 2883824865 2883821847 Bacteria 5121194
375 2891972129 2891968417 Bacteria 5821697
376 2984579146 2984576629 Bacteria 4248407
377 2984595214 2984592036 Bacteria 3670284
378 2990259960 2990256926 Bacteria 4252839
379 8054612387 8054609563 Bacteria 5170090
380 nmdc:mga03683_121180_c1
381 rootH1_10147930
382 rootH1_10076249
383 rootH1_10120422
384 Ga0070683_100010530
385 Ga0070683_100103101
386 Ga0070683_100127594
387 Ga0070683_100197178
388 Ga0070683_100258184
389 Ga0070670_100154905
390 Ga0070670_100201632
391 Ga0070680_100228339
392 Ga0070682_100147459
393 Ga0068868_100156078
394 Ga0070660_100062798
395 Ga0070660_100118125
396 Ga0070691_10034736
397 Ga0070692_10000949
398 Ga0070674_100412506
399 Ga0070659_100052240
400 Ga0070659_100185341
401 Ga0070667_100073432
402 Ga0070714_100019456
403 Ga0070701_10002368
404 Ga0070700_100010269
405 Ga0070700_100018282
406 Ga0070681_10134329
407 Ga0068867_100134855
408 Ga0070685_10102229
409 Ga0070698_100033896
410 Ga0070684_100263166
411 Ga0068853_100126940
412 Ga0068853_100134888
413 Ga0070672_100094451
414 Ga0070686_100064780
415 Ga0070665_100001782
416 Ga0070665_100499457
417 Ga0068857_100001378
418 Ga0068857_100202816
419 Ga0068854_100135050
420 Ga0070702_100028046
421 Ga0068852_100012642
422 Ga0068864_100085275
423 Ga0068861_100005937
424 Ga0068861_100180970
425 Ga0068861_100235765
426 Ga0068870_10006908
427 Ga0068858_100334025
428 Ga0068860_100299577
429 Ga0081455_10000134
430 Ga0081455_10003440
431 Ga0081455_10008171
432 Ga0081455_10014988
433 Ga0081538_10000249
434 Ga0081538_10041091
435 Ga0075365_10002868
436 Ga0075365_10011530
437 Ga0075365_10037697
438 Ga0075365_10106463
439 Ga0075365_10128959
440 Ga0075365_10137447
441 Ga0075365_10158829
442 Ga0075368_10000054
443 Ga0075363_100010938
444 Ga0075363_100155141
445 Ga0075364_10071511
446 Ga0075364_10079589
447 Ga0075364_10083112
448 Ga0075364_10147871
449 Ga0075432_10001711
450 Ga0075362_10053530
451 Ga0075367_10029382
452 Ga0075370_10040707
453 Ga0075370_10057118
454 Ga0075370_10230717
455 Ga0075428_100000157
456 Ga0075428_100005047
457 Ga0075430_100019208
458 Ga0075430_100300204
459 Ga0075431_100003368
460 Ga0075431_100012127
461 Ga0075433_10000435
462 Ga0075434_100006856
463 Ga0075429_100045195
464 Ga0068865_100056709
465 Ga0111539_10000385
466 Ga0105245_10006723
467 Ga0105245_10033341
468 Ga0105245_10539531
469 Ga0114129_10001879
470 Ga0114129_10015788
471 Ga0105243_10026014
472 Ga0105243_10062268
473 Ga0105243_10070018
474 Ga0105243_10112880
475 Ga0105242_10229213
476 Ga0105242_10330769
477 Ga0105248_10252304
478 Ga0105238_10091553
479 Ga0105238_10189785
480 Ga0105249_10029419
481 Ga0105249_10073410
482 Ga0105249_10291352
483 Ga0105239_10023375
484 Ga0105239_10181990
485 Ga0105246_10098082
486 Ga0105246_10116978
487 Ga0157371_10080042
488 Ga0157369_10081282
489 Ga0157369_10089490
490 Ga0157369_10211787
491 Ga0163162_10172455
492 Ga0163162_10248424
493 Ga0157372_10027087
494 Ga0157372_10047817
495 Ga0157372_10086537
496 Ga0157372_10116577
497 Ga0157375_10022051
498 Ga0157375_10108142
499 Ga0157375_10388768
500 Ga0163163_10021282
501 Ga0163163_10077622
502 Ga0157380_10004780
503 Ga0157379_10035921
504 Ga0213875_10025120
505 Ga0207688_10052527
506 Ga0207647_10159948
507 Ga0207643_10055872
508 Ga0207660_10091545
509 Ga0207662_10187487
510 Ga0207657_10027634
511 Ga0207657_10138293
512 Ga0207652_10156342
513 Ga0207650_10161677
514 Ga0207664_10035283
515 Ga0207690_10125064
516 Ga0207690_10162086
517 Ga0207709_10040125
518 Ga0207709_10099207
519 Ga0207704_10070841
520 Ga0207704_10244224
521 Ga0207691_10005138
522 Ga0207711_10123997
523 Ga0207661_10038389
524 Ga0207661_10059924
525 Ga0207661_10207582
526 Ga0207661_10337328
527 Ga0207712_10292309
528 Ga0207658_10087050
529 Ga0207703_10147818
530 Ga0207639_10068933
531 Ga0207708_10000180
532 Ga0207708_10041644
533 Ga0207648_10016593
534 Ga0207648_10150642
535 Ga0207676_10139901
536 Ga0207674_10034112
537 Ga0207675_100004600
538 Ga0207675_100064680
539 Ga0207675_100166305
540 Ga0207675_100329536
541 Ga0207698_10013086
542 Ga0209813_10002774
543 Ga0207428_10000187
544 Ga0268266_10006026
545 Ga0268264_10374169
546 Ga0316182_1246057
547 Ga0307513_10179683
548 Ga0307408_100033314
549 Ga0307408_100167037
550 Ga0307405_10369214
551 Ga0307413_10016535
552 Ga0307410_10013860
553 Ga0307406_10000015
554 Ga0307406_10028307
555 Ga0307406_10124269
556 Ga0307407_10010006
557 Ga0307412_10008838
558 Ga0307409_100000006
559 Ga0307409_100041988
560 Ga0307409_100494379
561 Ga0307416_100000465
562 Ga0307416_100342078
563 Ga0307414_10007782
564 Ga0307414_10049884
565 Ga0307411_10015649
566 Ga0307411_10198170
567 Ga0307415_100002830
568 Ga0307415_100022165
569 Ga0373938_0007875
570 Ga0395900_0041606
571 Ga0395898_0610771
572 Ga0436364_1044241
573 Ga0395901_0368077
574 Ga0439461_0004718
575 Ga0439465_0031208
576 Ga0451793_0380925
577 Ga0451800_0436503
578 Ga0451833_0344967
579 Ga0451837_0111521
580 Ga0451839_0173709
581 Ga0451841_0215287
582 Ga0451853_2428981
583 Ga0451853_2441966
584 Ga0439448_0014123
585 Ga0439463_001409
586 Ga0439463_012872
587 Ga0439464_0050410
588 Ga0439440_0025717
589 Ga0466972_0094096
590 Ga0466966_0017954
591 Ga0466963_0006003
592 Ga0466963_0073052
593 Ga0466963_0284583
594 Ga0466970_0018642
595 Ga0466957_0061051
596 Ga0466957_0104779
597 Ga0466960_0038996
598 Ga0466960_0039306
599 Ga0466959_0081729
600 Ga0466967_0014125
601 Ga0466967_0044368
602 Ga0466967_0076484
603 Ga0495625_0113457
604 Ga0495581_0039405
605 Ga0496100_0176600
606 Ga0496102_0091185
607 Ga0496102_0176830
608 Ga0496102_0293224
609 Ga0496102_0407301
610 Ga0496103_0081728
611 Ga0496104_0011220
612 Ga0496105_0042630
613 Ga0496106_0196187
614 Ga0496106_0279661
615 Ga0496107_0004467
616 Ga0496108_0011627
617 Ga0496108_0089218
618 Ga0496109_0009492
619 Ga0496109_0027405
620 Ga0496109_0067302
621 Ga0496109_0128000
622 Ga0496110_0285148
623 Ga0496111_0186437
624 Ga0496114_0020354
625 Ga0496114_0020751
626 Ga0496114_0156909
627 Ga0496115_0015736
628 Ga0501031_0000088
629 Ga0501031_0126318
630 Ga0501031_0153579
631 Ga0501032_0000473
632 Ga0501033_0001814
633 Ga0501034_0003170
634 Ga0501034_0017702
635 Ga0501034_0030009
636 Ga0501036_0003938
637 Ga0501036_0017027
638 Ga0501036_0048580
639 Ga0501037_0001051
640 Ga0501038_0000311
641 Ga0501039_0000286
642 Ga0501039_0003707
643 Ga0501039_0028408
644 Ga0501039_0040854
645 Ga0501040_0065324
646 Ga0501041_0239429
647 Ga0501042_0036745
648 Ga0501042_0204496
649 Ga0501043_0001106
650 Ga0501043_0013438
651 Ga0501046_0000052
652 Ga0501047_0007698
653 Ga0501048_0000012
654 Ga0501067_0001547
655 Ga0501067_0009787
656 Ga0501068_0009816
657 Ga0501068_0015456
658 Ga0501069_0001434
659 Ga0501070_0006753
660 Ga0501070_0008112
661 Ga0501070_0024252
662 Ga0501070_0106560
663 Ga0501071_0029955
664 Ga0501071_0031475
665 Ga0501071_0071185
666 Ga0501071_0370112
667 Ga0501072_0039002
668 Ga0501072_0040913
669 Ga0501072_0124816
670 Ga0501073_0011432
671 Ga0501073_0020163
672 Ga0501074_0000071
673 Ga0501074_0000822
674 Ga0501074_0001409
675 Ga0501075_0135678
676 Ga0501076_0006744
677 Ga0501076_0206917
678 Ga0501077_0005154
679 Ga0501077_0071770
680 Ga0501079_0091791
681 Ga0501080_0000415
682 Ga0501080_0005076
683 Ga0501080_0009465
684 Ga0501080_0010583
685 Ga0501080_0031952
686 Ga0501083_0006459
687 Ga0501083_0009292
688 Ga0501083_0011086
689 Ga0501083_0206601
690 Ga0501035_0001182
691 Ga0501035_0035571
692 Ga0501035_0251711
693 Ga0501044_0001157
694 Ga0501044_0160529
695 nmdc:mga03683_39431_c1
696 nmdc:mga00v17_158815_c1
697 nmdc:mga00v17_193164_c1
698 nmdc:mga00v17_26529_c1
699 nmdc:mga00v17_30431_c1
700 nmdc:mga0yw44_106184_c1
701 nmdc:mga0yw44_112365_c1
702 nmdc:mga0yw44_112762_c1
703 nmdc:mga0yw44_53967_c1
704 nmdc:mga0yw44_56509_c1
705 nmdc:mga0yw44_58011_c1
706 nmdc:mga0yw44_62689_c1
707 nmdc:mga0yw44_90518_c1
708 nmdc:mga06z11_123419_c1
709 nmdc:mga06z11_53822_c1
710 nmdc:mga06z11_68823_c1
711 nmdc:mga04h51_516_c1
712 nmdc:mga07m45_123170_c1
713 nmdc:mga07m45_362_c1
714 nmdc:mga05p37_1355_c1
715 nmdc:mga05p37_17557_c1
716 nmdc:mga09592_1034_c1
717 nmdc:mga0qj67_19371_c1
718 nmdc:mga0qj67_216787_c1
719 nmdc:mga06r32_543094_c1
720 nmdc:mga06r32_902_c1
721 nmdc:mga08y16_110413_c1
722 nmdc:mga08y16_187199_c1
723 nmdc:mga08y16_8882_c1
724 nmdc:mga0a205_15260_c1
725 Ga0495595_0107415
726 Ga0500644_0000128
727 Ga0500654_062433
728 Ga0500556_0001673
729 Ga0501084_0001016
730 Ga0501084_0039132
731 Ga0501082_0066891
732 Ga0501082_0126708
733 Ga0530510_0290994
734 2643828140
735 2643893283
736 2643961658
737 2644033990
738 2644090061
739 2644102707
740 2644118369
741 2644231327
742 2644319906
743 2644531229
744 2644537980
745 2738871585
746 2740166654
747 2774393748
748 2809195375
749 2812333961
750 2812350248
751 2816427403
752 2857483502
753 2883824865
754 2891972129
755 2984579146
756 2984595214
757 2990259960
758 8054612387

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01717

Meth_synt_2

Cobalamin-independent synthase, Catalytic domain

135

370

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xr2-assembly2.cif.gz_B crystal structure of oxidized t. maritima cobalamin-independent methionine synthase complexed with methyltetrahydrofolate 0.747 78 302
1t7l-assembly1.cif.gz_A crystal structure of cobalamin-independent methionine synthase from t. maritima 0.7381 78 305
4l61-assembly1.cif.gz_A crystal structure of the candida albicans methionine synthase in complex with methionine 0.7378 78 301
3bq5-assembly2.cif.gz_B crystal structure of t. maritima cobalamin-independent methionine synthase complexed with zn2+ and homocysteine (monoclinic) 0.7044 78 301
4zty-assembly1.cif.gz_A neurospora crassa cobalamin-independent methionine synthase complexed with cd2+ 0.7012 78 308
ID Description Score Start End Superfamily
af_I6YAW3_46_332_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9481 22 301 3.20.20.210
af_I6YAW3_46_332_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9226 22 301 3.20.20.210
af_P25665_3_315_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.7347 78 262 3.20.20.210
af_Q2G122_4_310_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.6995 80 258 3.20.20.210
af_Q54X49_2_360_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.6961 80 257 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A838G4N5-F1-model_v4 Methionine synthase 0.9696 207 300 GO:0003871
GO:0008270
GO:0009086
AF-A0A4Q3IVF1-F1-model_v4 deleted 0.9681 58 300
AF-A0A4R1CHA1-F1-model_v4 Methionine synthase 0.9677 23 300 GO:0003871
GO:0008270
GO:0009086
AF-A0A6B3CHK1-F1-model_v4 Methionine synthase 0.9602 102 212
AF-A0A4R1CHA1-F1-model_v4 Methionine synthase 0.9509 23 300 GO:0003871
GO:0008270
GO:0009086

Map