metagRoot

F428457

General Info

Members	Datasets	Scaffolds	Average Seq Length
379	237	379	62

Family's Representative Sequence

Representative Sequence	3300046678\|Ga0495599_0427392\|Ga0495599_0427392_541_744
Length	67
Sequence	MEVSMANHLTPAELADQLRMKRQEVIGKCVEMGVPIFHGRIDRTLFETSLRQLSSGPGVRSGASAQH

Samples

	Sample ID	Description	Type	Environment
1	3300000546	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled	Metagenome	Rhizosphere
2	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
3	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
4	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
5	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
6	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
7	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
8	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
9	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
10	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
11	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
12	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
13	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
14	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
15	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
16	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
17	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
18	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
19	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
20	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
21	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
22	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
23	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
24	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
25	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
26	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
27	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
28	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
29	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
30	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
31	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
32	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
33	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
34	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
35	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
36	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
37	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
38	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
39	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
40	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
41	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
42	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
43	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
44	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
45	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
46	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
47	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
48	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
49	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
50	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
51	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
52	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
53	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
54	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
55	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
56	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
57	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
58	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
59	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
60	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
61	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
62	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
63	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
64	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
65	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
66	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
67	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
68	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
69	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
70	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
71	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
72	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
73	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
74	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
75	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
76	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
77	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
78	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
115	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
116	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
117	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
118	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
119	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
120	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
121	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
122	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
123	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
124	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
125	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
126	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
127	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
128	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
129	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
130	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
131	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
132	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
133	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
134	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
135	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
136	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
137	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
138	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
139	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
140	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
141	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
142	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
143	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
144	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
145	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
146	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
147	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
148	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
149	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
150	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
151	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
152	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
153	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
154	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
155	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
156	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
157	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
158	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
159	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
160	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
161	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
162	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
163	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
164	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
165	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
166	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
167	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
168	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
169	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
170	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
171	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
172	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
173	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
174	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
175	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
176	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
177	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
178	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
179	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
180	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
181	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
182	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
183	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
184	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
185	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
186	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
187	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
188	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
189	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
190	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
191	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
192	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
193	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
194	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
195	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
196	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
197	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
198	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
199	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
200	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
201	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
202	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
203	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
204	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
205	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
206	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
207	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
208	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
209	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
210	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
211	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
212	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
213	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
214	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
215	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
216	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
217	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
218	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
219	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
220	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
221	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
222	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
223	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
224	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
225	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
226	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
227	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
228	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
229	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
230	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
231	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
232	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
233	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
234	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
235	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
236	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
237	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.63
Metatranscriptomes	2.37
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.85
Nodule	0
Rhizoplane	9.76
Rhizosphere	82.32
Stem	0
Stem Tuber	0
Unclassified	6.07

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	LJNas_1007082	3300000546	Unclassified	1213
2	JGI24740J21852_10002623	3300001979	Bacteria	8098
3	JGI24034J26672_10000086	3300002239	Bacteria	17704
4	JGI24742J22300_10007450	3300002244	Bacteria	1807
5	Ga0065707_10568376	3300005295	Bacteria	710
6	Ga0070658_10638150	3300005327	Unclassified	924
7	Ga0070683_100799278	3300005329	Bacteria	904
8	Ga0070666_10048502	3300005335	Bacteria	2854
9	Ga0070666_10177286	3300005335	Bacteria	1494
10	Ga0070680_100304769	3300005336	Bacteria	1351
11	Ga0070682_100000032	3300005337	Bacteria	155141
12	Ga0068868_100000978	3300005338	Bacteria	19469
13	Ga0070691_10000003	3300005341	Bacteria	86538
14	Ga0070661_100000236	3300005344	Bacteria	45535
15	Ga0070661_100697942	3300005344	Unclassified	827
16	Ga0070668_100757496	3300005347	Bacteria	860
17	Ga0070659_101262881	3300005366	Bacteria	654
18	Ga0070667_100019543	3300005367	Bacteria	5621
19	Ga0070667_100301090	3300005367	Bacteria	1444
20	Ga0070714_100141426	3300005435	Bacteria	2161
21	Ga0070714_100349720	3300005435	Bacteria	1388
22	Ga0070711_100002459	3300005439	Bacteria	10566
23	Ga0070711_100437839	3300005439	Bacteria	1068
24	Ga0070700_100281446	3300005441	Bacteria	1206
25	Ga0070663_100001455	3300005455	Bacteria	13013
26	Ga0070663_101215313	3300005455	Unclassified	663
27	Ga0070678_100113504	3300005456	Bacteria	2124
28	Ga0070678_100673810	3300005456	Unclassified	929
29	Ga0070678_100884123	3300005456	Bacteria	816
30	Ga0070685_10145908	3300005466	Bacteria	1495
31	Ga0070685_11129742	3300005466	Bacteria	593
32	Ga0070679_100000527	3300005530	Bacteria	32553
33	Ga0070684_100144007	3300005535	Bacteria	2156
34	Ga0070684_100180405	3300005535	Bacteria	1920
35	Ga0070684_101277393	3300005535	Bacteria	691
36	Ga0070684_102301903	3300005535	Bacteria	508
37	Ga0070686_100462022	3300005544	Bacteria	978
38	Ga0070695_100127441	3300005545	Bacteria	1750
39	Ga0070665_100002631	3300005548	Bacteria	19567
40	Ga0070665_100214316	3300005548	Bacteria	1927
41	Ga0070665_100422131	3300005548	Bacteria	1342
42	Ga0070665_101068607	3300005548	Bacteria	819
43	Ga0070665_101576676	3300005548	Bacteria	665
44	Ga0070704_100339647	3300005549	Bacteria	1264
45	Ga0068855_100583554	3300005563	Bacteria	1207
46	Ga0068855_101776336	3300005563	Bacteria	627
47	Ga0070664_101032123	3300005564	Bacteria	773
48	Ga0068857_101091208	3300005577	Bacteria	770
49	Ga0068854_100000133	3300005578	Bacteria	51376
50	Ga0068856_100632060	3300005614	Bacteria	1091
51	Ga0070702_100023007	3300005615	Bacteria	3305
52	Ga0068852_100725510	3300005616	Bacteria	1005
53	Ga0068859_100764402	3300005617	Bacteria	1055
54	Ga0068866_10026919	3300005718	Bacteria	2722
55	Ga0068851_10000247	3300005834	Bacteria	25479
56	Ga0068870_11210945	3300005840	Unclassified	547
57	Ga0068863_100000110	3300005841	Bacteria	86415
58	Ga0068863_100012362	3300005841	Bacteria	8244
59	Ga0068863_100018968	3300005841	Bacteria	6583
60	Ga0068858_100505445	3300005842	Bacteria	1168
61	Ga0081455_10063268	3300005937	Bacteria	3105
62	Ga0081455_10691362	3300005937	Unclassified	651
63	Ga0075363_100257916	3300006048	Archaea	1005
64	Ga0075364_10782044	3300006051	Unclassified	651
65	Ga0070715_10016760	3300006163	Bacteria	2760
66	Ga0075433_10004466	3300006852	Bacteria	10896
67	Ga0097620_100764269	3300006931	Bacteria	1055
68	Ga0105240_10363786	3300009093	Bacteria	1638
69	Ga0105240_11248332	3300009093	Unclassified	785
70	Ga0105245_10003467	3300009098	Bacteria	14119
71	Ga0105247_10000064	3300009101	Bacteria	123994
72	Ga0105247_10248293	3300009101	Bacteria	1215
73	Ga0105247_10352259	3300009101	Bacteria	1036
74	Ga0114129_11852371	3300009147	Unclassified	733
75	Ga0105241_10330924	3300009174	Bacteria	1316
76	Ga0105241_11422553	3300009174	Unclassified	665
77	Ga0105242_10000123	3300009176	Bacteria	56900
78	Ga0105242_10000589	3300009176	Bacteria	28679
79	Ga0105242_11044905	3300009176	Unclassified	827
80	Ga0105248_10304496	3300009177	Bacteria	1795
81	Ga0105248_11179549	3300009177	Bacteria	866
82	Ga0105237_10313935	3300009545	Bacteria	1571
83	Ga0105238_10058293	3300009551	Bacteria	3871
84	Ga0105249_10293973	3300009553	Bacteria	1627
85	Ga0105239_10060890	3300010375	Bacteria	4143
86	Ga0105239_10929053	3300010375	Bacteria	999
87	Ga0157370_10003648	3300013104	Bacteria	17997
88	Ga0157374_10002241	3300013296	Bacteria	16284
89	Ga0157374_10041123	3300013296	Bacteria	4258
90	Ga0157374_11235930	3300013296	Unclassified	768
91	Ga0163162_10119144	3300013306	Bacteria	2742
92	Ga0157372_10000809	3300013307	Bacteria	33940
93	Ga0157375_10000126	3300013308	Bacteria	75410
94	Ga0157375_10093081	3300013308	Bacteria	3079
95	Ga0157375_10427037	3300013308	Unclassified	1491
96	Ga0157375_13032656	3300013308	Unclassified	561
97	Ga0163163_10304838	3300014325	Bacteria	1645
98	Ga0163163_11073051	3300014325	Bacteria	868
99	Ga0163163_12378225	3300014325	Bacteria	588
100	Ga0163163_12931804	3300014325	Unclassified	532
101	Ga0157380_10079655	3300014326	Bacteria	2675
102	Ga0157377_11753899	3300014745	Bacteria	503
103	Ga0157379_10154872	3300014968	Bacteria	2067
104	Ga0157379_10186020	3300014968	Bacteria	1877
105	Ga0157379_11527924	3300014968	Unclassified	650
106	Ga0157379_11761467	3300014968	Unclassified	608
107	Ga0157376_10739481	3300014969	Bacteria	992
108	Ga0163161_10000013	3300017792	Bacteria	258747
109	Ga0163161_10320251	3300017792	Bacteria	1226
110	Ga0197907_10969773	3300020069	Unclassified	630
111	Ga0206356_10517561	3300020070	Bacteria	662
112	Ga0206351_10315475	3300020077	Unclassified	763
113	Ga0206352_10925360	3300020078	Unclassified	523
114	Ga0206350_11335362	3300020080	Bacteria	515
115	Ga0206350_11567552	3300020080	Unclassified	527
116	Ga0206354_10274994	3300020081	Bacteria	1143
117	Ga0154015_1094621	3300020610	Unclassified	815
118	Ga0224712_10125227	3300022467	Bacteria	1117
119	Ga0207656_10002300	3300025321	Bacteria	6417
120	Ga0207710_10000165	3300025900	Bacteria	69714
121	Ga0207710_10046349	3300025900	Unclassified	1941
122	Ga0207710_10128391	3300025900	Bacteria	1216
123	Ga0207680_10023163	3300025903	Bacteria	3387
124	Ga0207680_10103719	3300025903	Bacteria	1832
125	Ga0207680_10280830	3300025903	Bacteria	1157
126	Ga0207685_10030940	3300025905	Bacteria	1911
127	Ga0207643_10405537	3300025908	Unclassified	862
128	Ga0207705_11127868	3300025909	Unclassified	603
129	Ga0207654_10491552	3300025911	Unclassified	865
130	Ga0207707_10267104	3300025912	Bacteria	1483
131	Ga0207695_10378132	3300025913	Unclassified	1302
132	Ga0207695_10568144	3300025913	Unclassified	1015
133	Ga0207671_10092850	3300025914	Bacteria	2276
134	Ga0207663_10000767	3300025916	Bacteria	14344
135	Ga0207660_10271501	3300025917	Bacteria	1344
136	Ga0207649_10000166	3300025920	Bacteria	53758
137	Ga0207652_10000437	3300025921	Bacteria	43281
138	Ga0207694_10124879	3300025924	Bacteria	2058
139	Ga0207687_10187896	3300025927	Bacteria	1605
140	Ga0207664_10219603	3300025929	Bacteria	1648
141	Ga0207686_10000066	3300025934	Bacteria	95095
142	Ga0207686_10000967	3300025934	Bacteria	17098
143	Ga0207704_10138369	3300025938	Unclassified	1699
144	Ga0207661_10013529	3300025944	Bacteria	5959
145	Ga0207661_10748389	3300025944	Bacteria	899
146	Ga0207667_11550357	3300025949	Bacteria	632
147	Ga0207712_10474897	3300025961	Bacteria	1065
148	Ga0207668_10608692	3300025972	Bacteria	952
149	Ga0207640_10000147	3300025981	Bacteria	51462
150	Ga0207658_10141837	3300025986	Unclassified	1945
151	Ga0207658_10251695	3300025986	Bacteria	1501
152	Ga0207677_10005583	3300026023	Bacteria	6833
153	Ga0207703_10000122	3300026035	Bacteria	92656
154	Ga0207703_10649398	3300026035	Bacteria	1001
155	Ga0207678_10003762	3300026067	Bacteria	13646
156	Ga0207678_10376604	3300026067	Bacteria	1227
157	Ga0207708_10316049	3300026075	Bacteria	1273
158	Ga0207702_10495230	3300026078	Unclassified	1191
159	Ga0207702_10937704	3300026078	Bacteria	858
160	Ga0207641_10000065	3300026088	Bacteria	156066
161	Ga0207641_10008293	3300026088	Bacteria	8586
162	Ga0207641_10013865	3300026088	Bacteria	6612
163	Ga0207676_10000025	3300026095	Bacteria	261714
164	Ga0207675_102724976	3300026118	Unclassified	502
165	Ga0207683_10069565	3300026121	Bacteria	3109
166	Ga0207698_10197572	3300026142	Bacteria	1798
167	Ga0207698_11176069	3300026142	Bacteria	781
168	Ga0268266_10000973	3300028379	Bacteria	36388
169	Ga0268266_10002641	3300028379	Bacteria	18887
170	Ga0268266_10221670	3300028379	Bacteria	1739
171	Ga0268266_10724426	3300028379	Unclassified	959
172	Ga0268266_10991226	3300028379	Unclassified	813
173	Ga0265326_10041207	3300028558	Bacteria	1311
174	Ga0265319_1000030	3300028563	Bacteria	129742
175	Ga0265336_10008315	3300028666	Bacteria	3647
176	Ga0265338_10000156	3300028800	Bacteria	125065
177	Ga0265325_10212706	3300031241	Unclassified	887
178	Ga0265331_10195716	3300031250	Bacteria	911
179	Ga0373954_0198109	3300035118	Bacteria	987
180	Ga0373956_0350671	3300035119	Bacteria	704
181	Ga0373937_0482499	3300036401	Unclassified	1177
182	Ga0316582_0815702	3300036647	Bacteria	639
183	Ga0451791_1123960	3300041451	Bacteria	507
184	Ga0451804_0012943	3300041463	Unclassified	612
185	Ga0451807_0264330	3300041486	Bacteria	2611
186	Ga0451807_1086899	3300041486	Unclassified	800
187	Ga0451835_0937288	3300041492	Bacteria	904
188	Ga0451839_1112076	3300041496	Unclassified	546
189	Ga0451845_0446452	3300041501	Unclassified	881
190	Ga0451853_1819686	3300041512	Unclassified	2893
191	Ga0466965_0115628	3300044683	Bacteria	1382
192	Ga0466957_0074256	3300044842	Bacteria	2108
193	Ga0466960_0943817	3300044901	Unclassified	528
194	Ga0466967_0875796	3300045976	Unclassified	893
195	Ga0466967_1889452	3300045976	Unclassified	594
196	Ga0495592_0000752	3300046454	Bacteria	22576
197	Ga0495592_0336397	3300046454	Unclassified	972
198	Ga0495592_0569783	3300046454	Unclassified	694
199	Ga0495629_0029334	3300046459	Bacteria	3902
200	Ga0495629_0044723	3300046459	Unclassified	3107
201	Ga0495641_0038942	3300046461	Bacteria	2220
202	Ga0495641_0054108	3300046461	Bacteria	1824
203	Ga0495641_0495773	3300046461	Unclassified	557
204	Ga0495651_0113387	3300046462	Bacteria	2001
205	Ga0495653_0029557	3300046463	Bacteria	4373
206	Ga0495653_0275487	3300046463	Unclassified	1106
207	Ga0495653_0316683	3300046463	Bacteria	1012
208	Ga0495662_0000212	3300046476	Bacteria	24249
209	Ga0495662_0081700	3300046476	Unclassified	1572
210	Ga0495594_0000001	3300046499	Bacteria	293051
211	Ga0495608_0004956	3300046511	Bacteria	9532
212	Ga0495610_0166141	3300046512	Bacteria	929
213	Ga0495618_0000037	3300046514	Bacteria	99735
214	Ga0495618_0228897	3300046514	Unclassified	1171
215	Ga0495628_0002292	3300046516	Bacteria	17305
216	Ga0495628_0018585	3300046516	Bacteria	5755
217	Ga0495628_0114248	3300046516	Bacteria	2075
218	Ga0495628_0415720	3300046516	Bacteria	981
219	Ga0495628_1189680	3300046516	Unclassified	517
220	Ga0495630_0003679	3300046517	Bacteria	10686
221	Ga0495630_0599099	3300046517	Unclassified	845
222	Ga0495632_0051782	3300046519	Bacteria	2020
223	Ga0495652_0065935	3300046529	Bacteria	3041
224	Ga0495640_0013833	3300046533	Bacteria	6129
225	Ga0495586_0433411	3300046535	Bacteria	757
226	Ga0495587_0076592	3300046536	Bacteria	1942
227	Ga0495587_0086207	3300046536	Unclassified	1817
228	Ga0495587_0102932	3300046536	Bacteria	1644
229	Ga0495622_0000069	3300046557	Bacteria	89759
230	Ga0495634_0013095	3300046642	Bacteria	5996
231	Ga0495625_0135104	3300046660	Bacteria	1668
232	Ga0495635_0748709	3300046663	Bacteria	632
233	Ga0495588_0000175	3300046674	Bacteria	80911
234	Ga0495657_0006659	3300046675	Bacteria	9022
235	Ga0495599_0401853	3300046678	Bacteria	816
236	Ga0495599_0427392	3300046678	Bacteria	786
237	Ga0495623_0090269	3300046679	Bacteria	1882
238	Ga0495646_0257558	3300046680	Bacteria	933
239	Ga0495647_0000002	3300046681	Bacteria	174959
240	Ga0495658_0413541	3300046683	Unclassified	860
241	Ga0495613_0000190	3300046689	Bacteria	60696
242	Ga0495624_0000005	3300046690	Bacteria	158127
243	Ga0495624_0010629	3300046690	Bacteria	6339
244	Ga0495600_0002305	3300046809	Bacteria	10893
245	Ga0495600_0033104	3300046809	Bacteria	3355
246	Ga0495600_0033185	3300046809	Bacteria	3351
247	Ga0495581_0089243	3300047315	Bacteria	1788
248	Ga0495604_0209819	3300047317	Bacteria	1346
249	Ga0495604_0340290	3300047317	Unclassified	999
250	Ga0495672_0111712	3300047320	Unclassified	1465
251	Ga0495672_0473673	3300047320	Bacteria	561
252	Ga0495676_0029191	3300047321	Bacteria	4698
253	Ga0495676_0643395	3300047321	Bacteria	688
254	Ga0495680_0122828	3300047322	Unclassified	1915
255	Ga0495680_0275926	3300047322	Unclassified	1186
256	Ga0495680_0716444	3300047322	Unclassified	660
257	Ga0495675_0406047	3300047444	Unclassified	793
258	Ga0495675_0676202	3300047444	Bacteria	580
259	Ga0495684_1002735	3300047471	Unclassified	530
260	Ga0495684_1057421	3300047471	Unclassified	512
261	Ga0495686_0054554	3300047472	Bacteria	2502
262	Ga0495593_0125998	3300047673	Bacteria	1302
263	Ga0495593_0252145	3300047673	Bacteria	884
264	Ga0495602_0043909	3300048088	Bacteria	4058
265	Ga0495602_0097031	3300048088	Bacteria	2430
266	Ga0495602_0731760	3300048088	Unclassified	669
267	Ga0496100_0987994	3300048903	Bacteria	662
268	Ga0496100_1353873	3300048903	Unclassified	562
269	Ga0496102_0000021	3300048905	Bacteria	246920
270	Ga0496102_0002673	3300048905	Bacteria	15162
271	Ga0496102_0835932	3300048905	Archaea	843
272	Ga0496102_1975100	3300048905	Unclassified	500
273	Ga0496103_0000001	3300048906	Bacteria	643471
274	Ga0496103_0020009	3300048906	Bacteria	4019
275	Ga0496103_0646084	3300048906	Bacteria	672
276	Ga0496104_0000029	3300048907	Bacteria	202968
277	Ga0496104_0000214	3300048907	Bacteria	51141
278	Ga0496104_0034623	3300048907	Bacteria	4711
279	Ga0496104_1040822	3300048907	Bacteria	722
280	Ga0496105_0000002	3300048908	Bacteria	753215
281	Ga0496105_0000070	3300048908	Bacteria	80117
282	Ga0496105_1387509	3300048908	Unclassified	509
283	Ga0496106_0000307	3300048909	Bacteria	34433
284	Ga0496106_1193302	3300048909	Bacteria	594
285	Ga0496107_0102568	3300048910	Bacteria	2098
286	Ga0496107_0119013	3300048910	Bacteria	1945
287	Ga0496108_0000339	3300048911	Bacteria	39428
288	Ga0496109_0000391	3300048912	Bacteria	39830
289	Ga0496109_0001321	3300048912	Bacteria	20438
290	Ga0496109_0601104	3300048912	Bacteria	1036
291	Ga0496110_0000325	3300048913	Bacteria	31707
292	Ga0496111_0000171	3300048914	Bacteria	29367
293	Ga0496112_0002000	3300048915	Bacteria	16136
294	Ga0496113_0000002	3300048916	Bacteria	220193
295	Ga0496114_0000097	3300048917	Bacteria	63410
296	Ga0496114_0004701	3300048917	Bacteria	10621
297	Ga0496114_0448506	3300048917	Bacteria	1143
298	Ga0496115_0000151	3300048918	Bacteria	64493
299	Ga0496115_0911161	3300048918	Unclassified	677
300	Ga0496116_0000529	3300048919	Bacteria	51417
301	Ga0496117_0042384	3300048920	Bacteria	3322
302	Ga0496118_0004226	3300048921	Bacteria	17234
303	Ga0496118_0035771	3300048921	Bacteria	4026
304	Ga0496118_0394402	3300048921	Bacteria	721
305	Ga0496119_0004226	3300048922	Bacteria	14408
306	Ga0496119_0004642	3300048922	Bacteria	13555
307	Ga0496119_0030134	3300048922	Bacteria	3664
308	Ga0496119_0113040	3300048922	Bacteria	1504
309	Ga0496120_0007950	3300048923	Bacteria	7807
310	Ga0496121_0028233	3300048924	Bacteria	5228
311	Ga0496121_0083273	3300048924	Bacteria	2526
312	Ga0496121_0312135	3300048924	Bacteria	1062
313	Ga0496125_0040204	3300048928	Bacteria	4014
314	Ga0496125_0063542	3300048928	Bacteria	2943
315	Ga0496125_0307717	3300048928	Bacteria	967
316	Ga0496126_0497579	3300048929	Bacteria	975
317	Ga0496126_1027953	3300048929	Bacteria	617
318	Ga0496126_1279387	3300048929	Unclassified	535
319	Ga0501031_0008611	3300049568	Bacteria	6635
320	Ga0501032_0000843	3300049569	Bacteria	24899
321	Ga0501033_0001203	3300049570	Bacteria	23326
322	Ga0501034_0015370	3300049571	Bacteria	7866
323	Ga0501034_0377030	3300049571	Bacteria	1344
324	Ga0501036_0000711	3300049572	Bacteria	24631
325	Ga0501037_0000522	3300049573	Bacteria	30837
326	Ga0501038_0002510	3300049574	Bacteria	17093
327	Ga0501039_0003044	3300049575	Bacteria	12541
328	Ga0501040_0065852	3300049576	Bacteria	2496
329	Ga0501042_0016864	3300049578	Bacteria	5025
330	Ga0501043_0002028	3300049579	Bacteria	17289
331	Ga0501043_0391570	3300049579	Bacteria	1051
332	Ga0501043_1115565	3300049579	Unclassified	557
333	Ga0501046_0001261	3300049580	Bacteria	24516
334	Ga0501047_0001310	3300049581	Bacteria	24535
335	Ga0501047_0935740	3300049581	Bacteria	680
336	Ga0501047_1072469	3300049581	Unclassified	619
337	Ga0501047_1435951	3300049581	Unclassified	505
338	Ga0501048_0000689	3300049582	Bacteria	24553
339	Ga0501067_0117714	3300049583	Bacteria	1478
340	Ga0501068_0074801	3300049584	Bacteria	2071
341	Ga0501069_0591717	3300049585	Bacteria	665
342	Ga0501070_0000267	3300049586	Bacteria	49167
343	Ga0501070_0001982	3300049586	Bacteria	18007
344	Ga0501070_0076407	3300049586	Bacteria	2773
345	Ga0501070_0127456	3300049586	Bacteria	2103
346	Ga0501071_0048315	3300049587	Bacteria	3060
347	Ga0501072_0811007	3300049588	Unclassified	733
348	Ga0501072_0851289	3300049588	Bacteria	713
349	Ga0501073_0001506	3300049589	Bacteria	17232
350	Ga0501074_0003835	3300049590	Bacteria	10696
351	Ga0501074_0448179	3300049590	Unclassified	915
352	Ga0501074_1106000	3300049590	Unclassified	556
353	Ga0501075_0045791	3300049591	Bacteria	3284
354	Ga0501079_0053148	3300049741	Bacteria	3126
355	Ga0501080_0324813	3300049742	Bacteria	1392
356	Ga0501080_0701931	3300049742	Unclassified	892
357	Ga0501083_0007708	3300049744	Bacteria	7632
358	Ga0501083_0033628	3300049744	Bacteria	3509
359	Ga0501035_0001546	3300049822	Bacteria	23436
360	Ga0501044_0003136	3300049823	Bacteria	18695
361	Ga0501044_0793389	3300049823	Unclassified	827
362	Ga0501045_0232521	3300049824	Bacteria	1372
363	nmdc:mga03n38_368594_c1	3300050490	Archaea	785
364	nmdc:mga05p37_1976456_c1	3300050507	Unclassified	553
365	Ga0495601_0007898	3300053077	Bacteria	6267
366	Ga0495601_0063199	3300053077	Bacteria	2353
367	Ga0495655_0000013	3300053083	Bacteria	63264
368	Ga0495655_0001197	3300053083	Bacteria	4010
369	Ga0495595_0000579	3300053084	Bacteria	14007
370	Ga0495595_0101887	3300053084	Bacteria	1387
371	Ga0495619_0000069	3300053085	Bacteria	82755
372	Ga0495619_0000564	3300053085	Bacteria	24556
373	Ga0495619_0010064	3300053085	Bacteria	5953
374	Ga0495619_0030361	3300053085	Bacteria	3499
375	Ga0500566_0003812	3300053094	Bacteria	8988
376	Ga0500566_0223948	3300053094	Bacteria	933
377	Ga0500595_013400	3300053119	Bacteria	3142
378	Ga0500628_000045	3300053129	Bacteria	45042
379	Ga0501084_0065488	3300054114	Bacteria	3040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046512	Ga0495610_0166141	Ga0495610_0166141_448_639	52
2	3300005329	Ga0070683_100799278	Ga0070683_1007992782	53
3	3300005535	Ga0070684_100180405	Ga0070684_1001804053	53
4	3300025944	Ga0207661_10748389	Ga0207661_107483892	56
5	3300025913	Ga0207695_10378132	Ga0207695_103781323	57
6	3300005439	Ga0070711_100437839	Ga0070711_1004378392	58
7	3300006048	Ga0075363_100257916	Ga0075363_1002579162	58
8	3300006051	Ga0075364_10782044	Ga0075364_107820442	58
9	3300049586	Ga0501070_0127456	Ga0501070_0127456_1669_1845	58
10	3300049590	Ga0501074_1106000	Ga0501074_1106000_200_376	58
11	3300050490	nmdc:mga03n38_368594_c1	nmdc:mga03n38_368594_c1_407_583	58
12	3300005441	Ga0070700_100281446	Ga0070700_1002814461	59
13	3300026075	Ga0207708_10316049	Ga0207708_103160491	59
14	3300005439	Ga0070711_100002459	Ga0070711_1000024592	60
15	3300013104	Ga0157370_10003648	Ga0157370_1000364814	60
16	3300025916	Ga0207663_10000767	Ga0207663_100007673	60
17	3300044901	Ga0466960_0943817	Ga0466960_0943817_77_259	60
18	3300047471	Ga0495684_1002735	Ga0495684_1002735_115_297	60
19	3300048908	Ga0496105_1387509	Ga0496105_1387509_281_463	60
20	3300000546	LJNas_1007082	LJNas_10070822	61
21	3300001979	JGI24740J21852_10002623	JGI24740J21852_100026232	61
22	3300002239	JGI24034J26672_10000086	JGI24034J26672_100000867	61
23	3300002244	JGI24742J22300_10007450	JGI24742J22300_100074502	61
24	3300005295	Ga0065707_10568376	Ga0065707_105683762	61
25	3300005327	Ga0070658_10638150	Ga0070658_106381502	61
26	3300005335	Ga0070666_10048502	Ga0070666_100485022	61
27	3300005335	Ga0070666_10177286	Ga0070666_101772863	61
28	3300005336	Ga0070680_100304769	Ga0070680_1003047692	61
29	3300005337	Ga0070682_100000032	Ga0070682_100000032136	61
30	3300005338	Ga0068868_100000978	Ga0068868_1000009783	61
31	3300005341	Ga0070691_10000003	Ga0070691_1000000376	61
32	3300005344	Ga0070661_100000236	Ga0070661_1000002364	61
33	3300005344	Ga0070661_100697942	Ga0070661_1006979422	61
34	3300005347	Ga0070668_100757496	Ga0070668_1007574962	61
35	3300005366	Ga0070659_101262881	Ga0070659_1012628811	61
36	3300005367	Ga0070667_100019543	Ga0070667_1000195438	61
37	3300005367	Ga0070667_100301090	Ga0070667_1003010902	61
38	3300005435	Ga0070714_100141426	Ga0070714_1001414262	61
39	3300005435	Ga0070714_100349720	Ga0070714_1003497202	61
40	3300005455	Ga0070663_100001455	Ga0070663_1000014552	61
41	3300005455	Ga0070663_101215313	Ga0070663_1012153132	61
42	3300005456	Ga0070678_100113504	Ga0070678_1001135042	61
43	3300005456	Ga0070678_100673810	Ga0070678_1006738102	61
44	3300005456	Ga0070678_100884123	Ga0070678_1008841231	61
45	3300005466	Ga0070685_10145908	Ga0070685_101459082	61
46	3300005466	Ga0070685_11129742	Ga0070685_111297422	61
47	3300005530	Ga0070679_100000527	Ga0070679_1000005277	61
48	3300005535	Ga0070684_100144007	Ga0070684_1001440072	61
49	3300005535	Ga0070684_101277393	Ga0070684_1012773931	61
50	3300005535	Ga0070684_102301903	Ga0070684_1023019032	61
51	3300005544	Ga0070686_100462022	Ga0070686_1004620222	61
52	3300005545	Ga0070695_100127441	Ga0070695_1001274412	61
53	3300005548	Ga0070665_100002631	Ga0070665_1000026316	61
54	3300005548	Ga0070665_100214316	Ga0070665_1002143163	61
55	3300005548	Ga0070665_100422131	Ga0070665_1004221312	61
56	3300005548	Ga0070665_101068607	Ga0070665_1010686071	61
57	3300005548	Ga0070665_101576676	Ga0070665_1015766762	61
58	3300005549	Ga0070704_100339647	Ga0070704_1003396472	61
59	3300005563	Ga0068855_100583554	Ga0068855_1005835542	61
60	3300005563	Ga0068855_101776336	Ga0068855_1017763362	61
61	3300005564	Ga0070664_101032123	Ga0070664_1010321232	61
62	3300005577	Ga0068857_101091208	Ga0068857_1010912082	61
63	3300005578	Ga0068854_100000133	Ga0068854_1000001334	61
64	3300005614	Ga0068856_100632060	Ga0068856_1006320602	61
65	3300005615	Ga0070702_100023007	Ga0070702_1000230072	61
66	3300005616	Ga0068852_100725510	Ga0068852_1007255102	61
67	3300005617	Ga0068859_100764402	Ga0068859_1007644022	61
68	3300005718	Ga0068866_10026919	Ga0068866_100269192	61
69	3300005834	Ga0068851_10000247	Ga0068851_1000024713	61
70	3300005840	Ga0068870_11210945	Ga0068870_112109452	61
71	3300005841	Ga0068863_100000110	Ga0068863_10000011050	61
72	3300005841	Ga0068863_100012362	Ga0068863_1000123625	61
73	3300005841	Ga0068863_100018968	Ga0068863_1000189688	61
74	3300005842	Ga0068858_100505445	Ga0068858_1005054452	61
75	3300005937	Ga0081455_10063268	Ga0081455_100632682	61
76	3300005937	Ga0081455_10691362	Ga0081455_106913622	61
77	3300006163	Ga0070715_10016760	Ga0070715_100167604	61
78	3300006852	Ga0075433_10004466	Ga0075433_100044664	61
79	3300006931	Ga0097620_100764269	Ga0097620_1007642692	61
80	3300009093	Ga0105240_10363786	Ga0105240_103637862	61
81	3300009093	Ga0105240_11248332	Ga0105240_112483322	61
82	3300009098	Ga0105245_10003467	Ga0105245_100034679	61
83	3300009101	Ga0105247_10000064	Ga0105247_1000006493	61
84	3300009101	Ga0105247_10248293	Ga0105247_102482932	61
85	3300009101	Ga0105247_10352259	Ga0105247_103522592	61
86	3300009147	Ga0114129_11852371	Ga0114129_118523712	61
87	3300009174	Ga0105241_10330924	Ga0105241_103309242	61
88	3300009174	Ga0105241_11422553	Ga0105241_114225532	61
89	3300009176	Ga0105242_10000123	Ga0105242_1000012338	61
90	3300009176	Ga0105242_10000589	Ga0105242_1000058916	61
91	3300009176	Ga0105242_11044905	Ga0105242_110449052	61
92	3300009177	Ga0105248_10304496	Ga0105248_103044961	61
93	3300009177	Ga0105248_11179549	Ga0105248_111795492	61
94	3300009545	Ga0105237_10313935	Ga0105237_103139352	61
95	3300009551	Ga0105238_10058293	Ga0105238_100582933	61
96	3300009553	Ga0105249_10293973	Ga0105249_102939732	61
97	3300010375	Ga0105239_10060890	Ga0105239_100608902	61
98	3300010375	Ga0105239_10929053	Ga0105239_109290532	61
99	3300013296	Ga0157374_10002241	Ga0157374_1000224112	61
100	3300013296	Ga0157374_10041123	Ga0157374_100411234	61
101	3300013296	Ga0157374_11235930	Ga0157374_112359301	61
102	3300013306	Ga0163162_10119144	Ga0163162_101191442	61
103	3300013307	Ga0157372_10000809	Ga0157372_1000080940	61
104	3300013308	Ga0157375_10000126	Ga0157375_1000012639	61
105	3300013308	Ga0157375_10093081	Ga0157375_100930813	61
106	3300013308	Ga0157375_10427037	Ga0157375_104270372	61
107	3300013308	Ga0157375_13032656	Ga0157375_130326562	61
108	3300014325	Ga0163163_10304838	Ga0163163_103048382	61
109	3300014325	Ga0163163_11073051	Ga0163163_110730512	61
110	3300014325	Ga0163163_12378225	Ga0163163_123782251	61
111	3300014325	Ga0163163_12931804	Ga0163163_129318041	61
112	3300014326	Ga0157380_10079655	Ga0157380_100796554	61
113	3300014745	Ga0157377_11753899	Ga0157377_117538991	61
114	3300014968	Ga0157379_10154872	Ga0157379_101548723	61
115	3300014968	Ga0157379_10186020	Ga0157379_101860202	61
116	3300014968	Ga0157379_11527924	Ga0157379_115279242	61
117	3300014968	Ga0157379_11761467	Ga0157379_117614672	61
118	3300014969	Ga0157376_10739481	Ga0157376_107394811	61
119	3300017792	Ga0163161_10000013	Ga0163161_10000013138	61
120	3300017792	Ga0163161_10320251	Ga0163161_103202512	61
121	3300020069	Ga0197907_10969773	Ga0197907_109697731	61
122	3300020070	Ga0206356_10517561	Ga0206356_105175612	61
123	3300020077	Ga0206351_10315475	Ga0206351_103154751	61
124	3300020078	Ga0206352_10925360	Ga0206352_109253602	61
125	3300020080	Ga0206350_11335362	Ga0206350_113353622	61
126	3300020080	Ga0206350_11567552	Ga0206350_115675522	61
127	3300020081	Ga0206354_10274994	Ga0206354_102749942	61
128	3300020610	Ga0154015_1094621	Ga0154015_10946212	61
129	3300022467	Ga0224712_10125227	Ga0224712_101252271	61
130	3300025321	Ga0207656_10002300	Ga0207656_100023004	61
131	3300025900	Ga0207710_10000165	Ga0207710_1000016579	61
132	3300025900	Ga0207710_10046349	Ga0207710_100463492	61
133	3300025900	Ga0207710_10128391	Ga0207710_101283912	61
134	3300025903	Ga0207680_10023163	Ga0207680_100231633	61
135	3300025903	Ga0207680_10103719	Ga0207680_101037192	61
136	3300025903	Ga0207680_10280830	Ga0207680_102808302	61
137	3300025905	Ga0207685_10030940	Ga0207685_100309402	61
138	3300025908	Ga0207643_10405537	Ga0207643_104055371	61
139	3300025909	Ga0207705_11127868	Ga0207705_111278682	61
140	3300025911	Ga0207654_10491552	Ga0207654_104915522	61
141	3300025912	Ga0207707_10267104	Ga0207707_102671042	61
142	3300025913	Ga0207695_10568144	Ga0207695_105681442	61
143	3300025914	Ga0207671_10092850	Ga0207671_100928502	61
144	3300025917	Ga0207660_10271501	Ga0207660_102715012	61
145	3300025920	Ga0207649_10000166	Ga0207649_1000016626	61
146	3300025921	Ga0207652_10000437	Ga0207652_1000043740	61
147	3300025924	Ga0207694_10124879	Ga0207694_101248793	61
148	3300025927	Ga0207687_10187896	Ga0207687_101878962	61
149	3300025929	Ga0207664_10219603	Ga0207664_102196033	61
150	3300025934	Ga0207686_10000066	Ga0207686_1000006668	61
151	3300025934	Ga0207686_10000967	Ga0207686_1000096711	61
152	3300025938	Ga0207704_10138369	Ga0207704_101383692	61
153	3300025944	Ga0207661_10013529	Ga0207661_100135298	61
154	3300025949	Ga0207667_11550357	Ga0207667_115503572	61
155	3300025961	Ga0207712_10474897	Ga0207712_104748971	61
156	3300025972	Ga0207668_10608692	Ga0207668_106086922	61
157	3300025981	Ga0207640_10000147	Ga0207640_100001474	61
158	3300025986	Ga0207658_10141837	Ga0207658_101418373	61
159	3300025986	Ga0207658_10251695	Ga0207658_102516952	61
160	3300026023	Ga0207677_10005583	Ga0207677_100055833	61
161	3300026035	Ga0207703_10000122	Ga0207703_1000012263	61
162	3300026035	Ga0207703_10649398	Ga0207703_106493982	61
163	3300026067	Ga0207678_10003762	Ga0207678_1000376213	61
164	3300026067	Ga0207678_10376604	Ga0207678_103766042	61
165	3300026078	Ga0207702_10495230	Ga0207702_104952302	61
166	3300026078	Ga0207702_10937704	Ga0207702_109377042	61
167	3300026088	Ga0207641_10000065	Ga0207641_10000065120	61
168	3300026088	Ga0207641_10008293	Ga0207641_100082934	61
169	3300026088	Ga0207641_10013865	Ga0207641_100138651	61
170	3300026095	Ga0207676_10000025	Ga0207676_1000002572	61
171	3300026118	Ga0207675_102724976	Ga0207675_1027249761	61
172	3300026121	Ga0207683_10069565	Ga0207683_100695652	61
173	3300026142	Ga0207698_10197572	Ga0207698_101975722	61
174	3300026142	Ga0207698_11176069	Ga0207698_111760692	61
175	3300028379	Ga0268266_10000973	Ga0268266_1000097339	61
176	3300028379	Ga0268266_10002641	Ga0268266_1000264116	61
177	3300028379	Ga0268266_10221670	Ga0268266_102216702	61
178	3300028379	Ga0268266_10724426	Ga0268266_107244262	61
179	3300028379	Ga0268266_10991226	Ga0268266_109912262	61
180	3300028558	Ga0265326_10041207	Ga0265326_100412072	61
181	3300028563	Ga0265319_1000030	Ga0265319_100003080	61
182	3300028666	Ga0265336_10008315	Ga0265336_100083152	61
183	3300028800	Ga0265338_10000156	Ga0265338_1000015679	61
184	3300031241	Ga0265325_10212706	Ga0265325_102127062	61
185	3300031250	Ga0265331_10195716	Ga0265331_101957162	61
186	3300035118	Ga0373954_0198109	Ga0373954_0198109_435_626	61
187	3300035119	Ga0373956_0350671	Ga0373956_0350671_495_686	61
188	3300036401	Ga0373937_0482499	Ga0373937_0482499_297_488	61
189	3300036647	Ga0316582_0815702	Ga0316582_0815702_112_303	61
190	3300041451	Ga0451791_1123960	Ga0451791_1123960_103_288	61
191	3300041463	Ga0451804_0012943	Ga0451804_0012943_83_268	61
192	3300041486	Ga0451807_0264330	Ga0451807_0264330_1119_1310	61
193	3300041486	Ga0451807_1086899	Ga0451807_1086899_602_787	61
194	3300041492	Ga0451835_0937288	Ga0451835_0937288_221_406	61
195	3300041496	Ga0451839_1112076	Ga0451839_1112076_213_398	61
196	3300041501	Ga0451845_0446452	Ga0451845_0446452_33_224	61
197	3300041512	Ga0451853_1819686	Ga0451853_1819686_1825_2016	61
198	3300044683	Ga0466965_0115628	Ga0466965_0115628_328_522	61
199	3300044842	Ga0466957_0074256	Ga0466957_0074256_929_1120	61
200	3300045976	Ga0466967_0875796	Ga0466967_0875796_579_773	61
201	3300045976	Ga0466967_1889452	Ga0466967_1889452_160_354	61
202	3300046454	Ga0495592_0000752	Ga0495592_0000752_4925_5110	61
203	3300046454	Ga0495592_0336397	Ga0495592_0336397_538_729	61
204	3300046454	Ga0495592_0569783	Ga0495592_0569783_153_338	61
205	3300046459	Ga0495629_0029334	Ga0495629_0029334_3334_3519	61
206	3300046459	Ga0495629_0044723	Ga0495629_0044723_2174_2359	61
207	3300046461	Ga0495641_0038942	Ga0495641_0038942_611_796	61
208	3300046461	Ga0495641_0054108	Ga0495641_0054108_1322_1513	61
209	3300046461	Ga0495641_0495773	Ga0495641_0495773_20_205	61
210	3300046462	Ga0495651_0113387	Ga0495651_0113387_1522_1716	61
211	3300046463	Ga0495653_0029557	Ga0495653_0029557_3067_3261	61
212	3300046463	Ga0495653_0275487	Ga0495653_0275487_650_835	61
213	3300046463	Ga0495653_0316683	Ga0495653_0316683_796_981	61
214	3300046476	Ga0495662_0000212	Ga0495662_0000212_16988_17173	61
215	3300046476	Ga0495662_0081700	Ga0495662_0081700_1339_1524	61
216	3300046499	Ga0495594_0000001	Ga0495594_0000001_55471_55662	61
217	3300046511	Ga0495608_0004956	Ga0495608_0004956_4727_4912	61
218	3300046514	Ga0495618_0000037	Ga0495618_0000037_55485_55670	61
219	3300046514	Ga0495618_0228897	Ga0495618_0228897_495_686	61
220	3300046516	Ga0495628_0002292	Ga0495628_0002292_11684_11875	61
221	3300046516	Ga0495628_0018585	Ga0495628_0018585_4038_4223	61
222	3300046516	Ga0495628_0114248	Ga0495628_0114248_1435_1626	61
223	3300046516	Ga0495628_0415720	Ga0495628_0415720_90_275	61
224	3300046516	Ga0495628_1189680	Ga0495628_1189680_292_483	61
225	3300046517	Ga0495630_0003679	Ga0495630_0003679_4145_4330	61
226	3300046517	Ga0495630_0599099	Ga0495630_0599099_432_617	61
227	3300046519	Ga0495632_0051782	Ga0495632_0051782_476_673	61
228	3300046529	Ga0495652_0065935	Ga0495652_0065935_1529_1723	61
229	3300046533	Ga0495640_0013833	Ga0495640_0013833_2381_2566	61
230	3300046535	Ga0495586_0433411	Ga0495586_0433411_349_534	61
231	3300046536	Ga0495587_0076592	Ga0495587_0076592_1317_1502	61
232	3300046536	Ga0495587_0086207	Ga0495587_0086207_497_682	61
233	3300046536	Ga0495587_0102932	Ga0495587_0102932_1204_1389	61
234	3300046557	Ga0495622_0000069	Ga0495622_0000069_60002_60193	61
235	3300046642	Ga0495634_0013095	Ga0495634_0013095_819_1004	61
236	3300046660	Ga0495625_0135104	Ga0495625_0135104_779_976	61
237	3300046663	Ga0495635_0748709	Ga0495635_0748709_121_312	61
238	3300046674	Ga0495588_0000175	Ga0495588_0000175_62983_63174	61
239	3300046675	Ga0495657_0006659	Ga0495657_0006659_184_369	61
240	3300046678	Ga0495599_0401853	Ga0495599_0401853_206_391	61
241	3300046678	Ga0495599_0427392	Ga0495599_0427392_541_744	61
242	3300046679	Ga0495623_0090269	Ga0495623_0090269_1232_1417	61
243	3300046680	Ga0495646_0257558	Ga0495646_0257558_634_825	61
244	3300046681	Ga0495647_0000002	Ga0495647_0000002_11422_11607	61
245	3300046683	Ga0495658_0413541	Ga0495658_0413541_294_479	61
246	3300046689	Ga0495613_0000190	Ga0495613_0000190_48328_48513	61
247	3300046690	Ga0495624_0000005	Ga0495624_0000005_12029_12214	61
248	3300046690	Ga0495624_0010629	Ga0495624_0010629_2688_2873	61
249	3300046809	Ga0495600_0002305	Ga0495600_0002305_4804_4989	61
250	3300046809	Ga0495600_0033104	Ga0495600_0033104_1020_1211	61
251	3300046809	Ga0495600_0033185	Ga0495600_0033185_1321_1512	61
252	3300047315	Ga0495581_0089243	Ga0495581_0089243_1055_1240	61
253	3300047317	Ga0495604_0209819	Ga0495604_0209819_734_925	61
254	3300047317	Ga0495604_0340290	Ga0495604_0340290_475_660	61
255	3300047320	Ga0495672_0111712	Ga0495672_0111712_866_1057	61
256	3300047320	Ga0495672_0473673	Ga0495672_0473673_340_531	61
257	3300047321	Ga0495676_0029191	Ga0495676_0029191_1731_1916	61
258	3300047321	Ga0495676_0643395	Ga0495676_0643395_68_253	61
259	3300047322	Ga0495680_0122828	Ga0495680_0122828_1239_1424	61
260	3300047322	Ga0495680_0275926	Ga0495680_0275926_701_892	61
261	3300047322	Ga0495680_0716444	Ga0495680_0716444_222_413	61
262	3300047444	Ga0495675_0406047	Ga0495675_0406047_160_351	61
263	3300047444	Ga0495675_0676202	Ga0495675_0676202_265_450	61
264	3300047471	Ga0495684_1057421	Ga0495684_1057421_104_289	61
265	3300047472	Ga0495686_0054554	Ga0495686_0054554_1955_2146	61
266	3300047673	Ga0495593_0125998	Ga0495593_0125998_288_479	61
267	3300047673	Ga0495593_0252145	Ga0495593_0252145_611_796	61
268	3300048088	Ga0495602_0043909	Ga0495602_0043909_3076_3261	61
269	3300048088	Ga0495602_0097031	Ga0495602_0097031_2084_2275	61
270	3300048088	Ga0495602_0731760	Ga0495602_0731760_135_326	61
271	3300048903	Ga0496100_0987994	Ga0496100_0987994_307_492	61
272	3300048903	Ga0496100_1353873	Ga0496100_1353873_12_203	61
273	3300048905	Ga0496102_0000021	Ga0496102_0000021_157139_157324	61
274	3300048905	Ga0496102_0002673	Ga0496102_0002673_2263_2454	61
275	3300048905	Ga0496102_0835932	Ga0496102_0835932_78_269	61
276	3300048905	Ga0496102_1975100	Ga0496102_1975100_11_202	61
277	3300048906	Ga0496103_0000001	Ga0496103_0000001_438583_438768	61
278	3300048906	Ga0496103_0020009	Ga0496103_0020009_1314_1505	61
279	3300048906	Ga0496103_0646084	Ga0496103_0646084_273_464	61
280	3300048907	Ga0496104_0000029	Ga0496104_0000029_169017_169202	61
281	3300048907	Ga0496104_0000214	Ga0496104_0000214_46508_46702	61
282	3300048907	Ga0496104_0034623	Ga0496104_0034623_4486_4680	61
283	3300048907	Ga0496104_1040822	Ga0496104_1040822_236_427	61
284	3300048908	Ga0496105_0000002	Ga0496105_0000002_169017_169202	61
285	3300048908	Ga0496105_0000070	Ga0496105_0000070_78914_79108	61
286	3300048909	Ga0496106_0000307	Ga0496106_0000307_11364_11549	61
287	3300048909	Ga0496106_1193302	Ga0496106_1193302_344_538	61
288	3300048910	Ga0496107_0102568	Ga0496107_0102568_462_647	61
289	3300048910	Ga0496107_0119013	Ga0496107_0119013_1707_1901	61
290	3300048911	Ga0496108_0000339	Ga0496108_0000339_25308_25493	61
291	3300048912	Ga0496109_0000391	Ga0496109_0000391_31605_31796	61
292	3300048912	Ga0496109_0001321	Ga0496109_0001321_3139_3324	61
293	3300048912	Ga0496109_0601104	Ga0496109_0601104_243_437	61
294	3300048913	Ga0496110_0000325	Ga0496110_0000325_814_1005	61
295	3300048914	Ga0496111_0000171	Ga0496111_0000171_28602_28793	61
296	3300048915	Ga0496112_0002000	Ga0496112_0002000_14128_14319	61
297	3300048916	Ga0496113_0000002	Ga0496113_0000002_60927_61118	61
298	3300048917	Ga0496114_0000097	Ga0496114_0000097_48058_48243	61
299	3300048917	Ga0496114_0004701	Ga0496114_0004701_2239_2424	61
300	3300048917	Ga0496114_0448506	Ga0496114_0448506_850_1044	61
301	3300048918	Ga0496115_0000151	Ga0496115_0000151_49160_49345	61
302	3300048918	Ga0496115_0911161	Ga0496115_0911161_291_476	61
303	3300048919	Ga0496116_0000529	Ga0496116_0000529_13049_13240	61
304	3300048920	Ga0496117_0042384	Ga0496117_0042384_2253_2444	61
305	3300048921	Ga0496118_0004226	Ga0496118_0004226_2110_2301	61
306	3300048921	Ga0496118_0035771	Ga0496118_0035771_937_1128	61
307	3300048921	Ga0496118_0394402	Ga0496118_0394402_453_644	61
308	3300048922	Ga0496119_0004226	Ga0496119_0004226_7636_7827	61
309	3300048922	Ga0496119_0004642	Ga0496119_0004642_9551_9745	61
310	3300048922	Ga0496119_0030134	Ga0496119_0030134_2113_2298	61
311	3300048922	Ga0496119_0113040	Ga0496119_0113040_617_808	61
312	3300048923	Ga0496120_0007950	Ga0496120_0007950_1902_2093	61
313	3300048924	Ga0496121_0028233	Ga0496121_0028233_3939_4133	61
314	3300048924	Ga0496121_0083273	Ga0496121_0083273_1911_2105	61
315	3300048924	Ga0496121_0312135	Ga0496121_0312135_360_551	61
316	3300048928	Ga0496125_0040204	Ga0496125_0040204_1293_1484	61
317	3300048928	Ga0496125_0063542	Ga0496125_0063542_766_960	61
318	3300048928	Ga0496125_0307717	Ga0496125_0307717_90_284	61
319	3300048929	Ga0496126_0497579	Ga0496126_0497579_586_780	61
320	3300048929	Ga0496126_1027953	Ga0496126_1027953_382_576	61
321	3300048929	Ga0496126_1279387	Ga0496126_1279387_171_368	61
322	3300049568	Ga0501031_0008611	Ga0501031_0008611_409_603	61
323	3300049569	Ga0501032_0000843	Ga0501032_0000843_6322_6516	61
324	3300049570	Ga0501033_0001203	Ga0501033_0001203_4721_4915	61
325	3300049571	Ga0501034_0015370	Ga0501034_0015370_6229_6423	61
326	3300049571	Ga0501034_0377030	Ga0501034_0377030_822_1016	61
327	3300049572	Ga0501036_0000711	Ga0501036_0000711_6026_6220	61
328	3300049573	Ga0501037_0000522	Ga0501037_0000522_12260_12454	61
329	3300049574	Ga0501038_0002510	Ga0501038_0002510_5896_6090	61
330	3300049575	Ga0501039_0003044	Ga0501039_0003044_10976_11170	61
331	3300049576	Ga0501040_0065852	Ga0501040_0065852_640_834	61
332	3300049578	Ga0501042_0016864	Ga0501042_0016864_4661_4855	61
333	3300049579	Ga0501043_0002028	Ga0501043_0002028_6066_6260	61
334	3300049579	Ga0501043_0391570	Ga0501043_0391570_68_262	61
335	3300049579	Ga0501043_1115565	Ga0501043_1115565_339_530	61
336	3300049580	Ga0501046_0001261	Ga0501046_0001261_18281_18475	61
337	3300049581	Ga0501047_0001310	Ga0501047_0001310_6001_6195	61
338	3300049581	Ga0501047_0935740	Ga0501047_0935740_32_229	61
339	3300049581	Ga0501047_1072469	Ga0501047_1072469_243_434	61
340	3300049581	Ga0501047_1435951	Ga0501047_1435951_162_356	61
341	3300049582	Ga0501048_0000689	Ga0501048_0000689_18412_18606	61
342	3300049583	Ga0501067_0117714	Ga0501067_0117714_532_726	61
343	3300049584	Ga0501068_0074801	Ga0501068_0074801_1596_1787	61
344	3300049585	Ga0501069_0591717	Ga0501069_0591717_434_628	61
345	3300049586	Ga0501070_0000267	Ga0501070_0000267_30562_30756	61
346	3300049586	Ga0501070_0001982	Ga0501070_0001982_9610_9801	61
347	3300049586	Ga0501070_0076407	Ga0501070_0076407_342_533	61
348	3300049587	Ga0501071_0048315	Ga0501071_0048315_1625_1819	61
349	3300049588	Ga0501072_0811007	Ga0501072_0811007_148_336	61
350	3300049588	Ga0501072_0851289	Ga0501072_0851289_97_291	61
351	3300049589	Ga0501073_0001506	Ga0501073_0001506_11030_11224	61
352	3300049590	Ga0501074_0003835	Ga0501074_0003835_2372_2566	61
353	3300049590	Ga0501074_0448179	Ga0501074_0448179_448_642	61
354	3300049591	Ga0501075_0045791	Ga0501075_0045791_1168_1356	61
355	3300049741	Ga0501079_0053148	Ga0501079_0053148_2372_2566	61
356	3300049742	Ga0501080_0324813	Ga0501080_0324813_728_922	61
357	3300049742	Ga0501080_0701931	Ga0501080_0701931_278_472	61
358	3300049744	Ga0501083_0007708	Ga0501083_0007708_4434_4628	61
359	3300049744	Ga0501083_0033628	Ga0501083_0033628_1372_1563	61
360	3300049822	Ga0501035_0001546	Ga0501035_0001546_18394_18588	61
361	3300049823	Ga0501044_0003136	Ga0501044_0003136_161_355	61
362	3300049823	Ga0501044_0793389	Ga0501044_0793389_98_292	61
363	3300049824	Ga0501045_0232521	Ga0501045_0232521_516_710	61
364	3300050507	nmdc:mga05p37_1976456_c1	nmdc:mga05p37_1976456_c1_321_506	61
365	3300053077	Ga0495601_0007898	Ga0495601_0007898_2135_2329	61
366	3300053077	Ga0495601_0063199	Ga0495601_0063199_433_624	61
367	3300053083	Ga0495655_0000013	Ga0495655_0000013_13716_13901	61
368	3300053083	Ga0495655_0001197	Ga0495655_0001197_2022_2213	61
369	3300053084	Ga0495595_0000579	Ga0495595_0000579_5788_5973	61
370	3300053084	Ga0495595_0101887	Ga0495595_0101887_1103_1294	61
371	3300053085	Ga0495619_0000069	Ga0495619_0000069_47437_47628	61
372	3300053085	Ga0495619_0000564	Ga0495619_0000564_21733_21918	61
373	3300053085	Ga0495619_0010064	Ga0495619_0010064_4866_5057	61
374	3300053085	Ga0495619_0030361	Ga0495619_0030361_905_1096	61
375	3300053094	Ga0500566_0003812	Ga0500566_0003812_2122_2307	61
376	3300053094	Ga0500566_0223948	Ga0500566_0223948_147_338	61
377	3300053119	Ga0500595_013400	Ga0500595_013400_1800_1991	61
378	3300053129	Ga0500628_000045	Ga0500628_000045_28580_28765	61
379	3300054114	Ga0501084_0065488	Ga0501084_0065488_1529_1723	61

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4j2n-assembly1.cif.gz_A	crystal structure of mycobacteriophage pukovnik xis	0.7913	1	45
7lwr-assembly1.cif.gz_H-2	error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer'))	0.7848	4	49
7lwr-assembly2.cif.gz_B	error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer'))	0.7842	4	49
7lwr-assembly3.cif.gz_E	error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer'))	0.7775	4	48
6hlk-assembly1.cif.gz_A-2	hijacking the hijackers: escherichia coli pathogenicity islands redirect helper phage packaging for their own benefit.	0.7735	5	59

ID	Description	Score	Start	End	Superfamily
af_P15082_1_58_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.813	3	38	1.10.10.10
af_I6YE30_32_77_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.7995	5	43	1.10.10.10
af_P31062_1_68_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.7992	4	52	1.10.10.10
3irqD00	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.7979	4	29	1.10.10.10
af_P0ACK5_8_61_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.7776	2	37	1.10.10.10

ID	Description	Score	Start	End
AF-A0A7V9K5C0-F1-model_v4	DNA-binding protein	1.003	4	52
AF-A0A7W0JZV4-F1-model_v4	DNA-binding protein	0.9968	4	52
AF-A0A1H6FQD3-F1-model_v4	DNA binding domain-containing protein, excisionase family	0.9952	4	52
AF-A0A7V9EZE6-F1-model_v4	DNA-binding protein	0.9949	4	52
AF-A0A1M3BGI0-F1-model_v4	DNA-binding protein	0.9854	1	52

Feature Viewer

pLDDT	pTM	Quality
82.61	0.65	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F428457

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map