metagRoot

F428415

General Info

Members	Datasets	Scaffolds	Average Seq Length
379	245	371	97

Family's Representative Sequence

Representative Sequence	3300037068\|Ga0373925_0290928\|Ga0373925_0290928_432_794
Length	120
Sequence	VAVSELTLRFGVVGTTMDGMAELLTDDQVTAALGRLAQWRQDGDAIVRVVELASFPVAIQAVARIGEIAENDNHHPDIDIRWRTLTFRCRTHSAGGVTSLDVTLAGEIDGVLELLGQPRE

Samples

	Sample ID	Description	Type	Environment
1	2558860112	Pseudonocardia acaciae DSM 45401	Isolate	Unclassified
2	2558860280	Kutzneria sp. 744	Isolate	Unclassified
3	2738541264	Mycobacterium sp. OK889	Isolate	Unclassified
4	2738541356	Mycobacterium sp. OK887	Isolate	Unclassified
5	2738543011	Rhodococcus sp. OK611	Isolate	Unclassified
6	2791354901	Actinophytocola xanthii 11-183	Isolate	Rhizosphere
7	2861520306	Phytomonospora endophytica DSM 45386	Isolate	Unclassified
8	2939743619	Rhodococcus sp. PvR044	Isolate	Rhizosphere
9	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
10	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
11	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
12	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
13	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
14	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
15	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
16	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
17	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
18	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
19	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
20	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
21	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
22	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
23	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
24	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
25	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
26	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
27	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
28	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
29	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
30	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
31	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
32	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
33	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
34	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
35	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
36	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
37	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
38	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
39	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
40	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
41	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
42	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
43	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
44	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
45	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
46	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
47	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
48	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
49	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
50	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
51	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
52	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
53	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
54	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
55	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
56	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
57	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
58	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
59	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
60	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
61	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
62	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
63	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
64	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
65	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
66	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
67	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
69	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
70	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
71	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
73	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
74	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
76	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
77	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
78	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
79	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
80	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
81	3300009984	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG	Metagenome	Rhizosphere
82	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
83	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
84	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
85	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
86	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
87	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
88	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
89	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
90	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
91	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
92	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
93	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
94	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
95	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
96	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
97	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
98	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
99	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
100	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
144	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
145	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
146	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
147	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
148	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
149	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
150	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
151	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
152	3300031889	Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO	Metagenome	Rhizosphere
153	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
154	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
155	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
156	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
157	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
158	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
159	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
160	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
161	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
162	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
163	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
164	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
165	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
166	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
167	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
168	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
169	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
170	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
171	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
172	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
173	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
174	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
175	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
176	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
177	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
178	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
179	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
180	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
181	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
182	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
183	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
184	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
185	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
186	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
187	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
188	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
189	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
190	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
191	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
192	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
193	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
194	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
195	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
196	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
197	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
198	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
199	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
200	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
201	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
202	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
203	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
204	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
205	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
206	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
207	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
208	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
209	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
210	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
211	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
212	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
213	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
214	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
215	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
216	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
217	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
218	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
219	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
220	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
221	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
222	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
223	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
224	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
225	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
226	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
227	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
228	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
229	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
230	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
231	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
232	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
233	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
234	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
235	3300053099	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere	Metagenome	Endosphere
236	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
237	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
238	3300053143	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere	Metagenome	Endosphere
239	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
240	3300053149	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere	Metagenome	Endosphere
241	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
242	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
243	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
244	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
245	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	97.36
Metatranscriptomes	0.53
Isolates	2.11

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.49
Nodule	0
Rhizoplane	10.82
Rhizosphere	72.56
Stem	0
Stem Tuber	0
Unclassified	12.14

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24739J22299_10091102	3300001989	Bacteria	928
2	JGI25406J46586_10003918	3300003203	Bacteria	6955
3	Ga0055540_1000068	3300003792	Bacteria	120413
4	Ga0070658_10431319	3300005327	Bacteria	1134
5	Ga0070670_101288142	3300005331	Bacteria	669
6	Ga0068869_100020859	3300005334	Bacteria	4500
7	Ga0070666_10008072	3300005335	Bacteria	6518
8	Ga0070666_11081972	3300005335	Bacteria	596
9	Ga0070680_100080680	3300005336	Bacteria	2683
10	Ga0070660_100532102	3300005339	Bacteria	979
11	Ga0070689_100616652	3300005340	Bacteria	941
12	Ga0070661_100423609	3300005344	Bacteria	1055
13	Ga0070668_100371923	3300005347	Bacteria	1214
14	Ga0070671_100014570	3300005355	Bacteria	6358
15	Ga0070688_100019302	3300005365	Bacteria	3947
16	Ga0070659_100071406	3300005366	Bacteria	2760
17	Ga0070667_100000525	3300005367	Bacteria	38503
18	Ga0070667_101412855	3300005367	Bacteria	653
19	Ga0070713_100060933	3300005436	Bacteria	3156
20	Ga0070713_101665988	3300005436	Bacteria	619
21	Ga0070710_10952519	3300005437	Bacteria	623
22	Ga0070701_10103885	3300005438	Bacteria	1578
23	Ga0070711_100066217	3300005439	Bacteria	2530
24	Ga0070700_100023986	3300005441	Bacteria	3575
25	Ga0070663_100672196	3300005455	Bacteria	878
26	Ga0070678_100048083	3300005456	Bacteria	3069
27	Ga0070685_10523290	3300005466	Bacteria	842
28	Ga0070679_100802478	3300005530	Bacteria	884
29	Ga0070679_100866197	3300005530	Bacteria	847
30	Ga0068853_100204077	3300005539	Bacteria	1799
31	Ga0070672_101536228	3300005543	Bacteria	597
32	Ga0070696_100584031	3300005546	Bacteria	899
33	Ga0070693_100016903	3300005547	Bacteria	3783
34	Ga0070665_100058377	3300005548	Bacteria	3868
35	Ga0070704_101385316	3300005549	Bacteria	645
36	Ga0068855_100088744	3300005563	Bacteria	3571
37	Ga0070664_101016181	3300005564	Bacteria	779
38	Ga0068857_100538943	3300005577	Bacteria	1098
39	Ga0068854_100093567	3300005578	Bacteria	2240
40	Ga0068856_100068212	3300005614	Bacteria	3515
41	Ga0070702_100027826	3300005615	Bacteria	3055
42	Ga0068852_100276531	3300005616	Bacteria	1617
43	Ga0068859_100438929	3300005617	Bacteria	1402
44	Ga0068859_100738374	3300005617	Bacteria	1074
45	Ga0068864_100149648	3300005618	Bacteria	2113
46	Ga0068864_100459265	3300005618	Bacteria	1219
47	Ga0068861_100354133	3300005719	Bacteria	1289
48	Ga0068851_10006918	3300005834	Bacteria	5199
49	Ga0068870_10006076	3300005840	Bacteria	5304
50	Ga0068870_10171375	3300005840	Bacteria	1295
51	Ga0068863_100001064	3300005841	Bacteria	27416
52	Ga0068863_100017082	3300005841	Bacteria	6959
53	Ga0068863_100069771	3300005841	Bacteria	3323
54	Ga0068863_100716946	3300005841	Bacteria	995
55	Ga0068863_102220571	3300005841	Bacteria	559
56	Ga0068860_100358274	3300005843	Bacteria	1437
57	Ga0068860_100981193	3300005843	Bacteria	862
58	Ga0081455_10021418	3300005937	Bacteria	6064
59	Ga0081539_10000264	3300005985	Bacteria	120533
60	Ga0070717_11563264	3300006028	Bacteria	598
61	Ga0075364_10421433	3300006051	Bacteria	911
62	Ga0097621_101146579	3300006237	Bacteria	731
63	Ga0068871_100345631	3300006358	Bacteria	1315
64	Ga0075428_100030559	3300006844	Bacteria	5957
65	Ga0075428_100191523	3300006844	Bacteria	2212
66	Ga0075428_100322625	3300006844	Bacteria	1659
67	Ga0075428_100392249	3300006844	Bacteria	1488
68	Ga0075428_100673632	3300006844	Bacteria	1103
69	Ga0075430_100001544	3300006846	Bacteria	18810
70	Ga0075430_100002213	3300006846	Bacteria	16120
71	Ga0075430_100423994	3300006846	Bacteria	1098
72	Ga0075431_100011435	3300006847	Bacteria	8944
73	Ga0075431_100063828	3300006847	Bacteria	3801
74	Ga0075431_100831862	3300006847	Bacteria	895
75	Ga0075433_10028279	3300006852	Bacteria	4765
76	Ga0075434_100585007	3300006871	Bacteria	1135
77	Ga0075429_100002594	3300006880	Bacteria	15233
78	Ga0075429_100025234	3300006880	Bacteria	5159
79	Ga0075429_100621432	3300006880	Bacteria	947
80	Ga0075429_100668331	3300006880	Bacteria	910
81	Ga0075429_101978381	3300006880	Bacteria	505
82	Ga0075436_100005637	3300006914	Bacteria	8593
83	Ga0097620_100438891	3300006931	Bacteria	1402
84	Ga0097620_100738275	3300006931	Bacteria	1074
85	Ga0075435_100066968	3300007076	Bacteria	2923
86	Ga0105251_10113247	3300009011	Bacteria	1235
87	Ga0105251_10337589	3300009011	Bacteria	686
88	Ga0105240_10393126	3300009093	Bacteria	1563
89	Ga0111539_10233537	3300009094	Bacteria	2141
90	Ga0111539_10740276	3300009094	Bacteria	1144
91	Ga0111539_10996275	3300009094	Bacteria	974
92	Ga0111539_11380290	3300009094	Bacteria	817
93	Ga0111539_11663845	3300009094	Bacteria	740
94	Ga0111539_12907642	3300009094	Bacteria	554
95	Ga0105245_13194463	3300009098	Bacteria	508
96	Ga0105247_10047971	3300009101	Bacteria	2624
97	Ga0105247_10167846	3300009101	Bacteria	1457
98	Ga0114129_10010110	3300009147	Bacteria	13450
99	Ga0114129_10014058	3300009147	Bacteria	11403
100	Ga0114129_10076083	3300009147	Bacteria	4673
101	Ga0114129_11114259	3300009147	Bacteria	987
102	Ga0105243_10537944	3300009148	Bacteria	1114
103	Ga0105241_10005987	3300009174	Bacteria	8974
104	Ga0105248_10581466	3300009177	Bacteria	1264
105	Ga0105237_10138524	3300009545	Bacteria	2428
106	Ga0105238_10038837	3300009551	Bacteria	4834
107	Ga0105249_11333165	3300009553	Bacteria	789
108	Ga0105029_102423	3300009984	Bacteria	1212
109	Ga0105239_10046143	3300010375	Bacteria	4774
110	Ga0105239_10426540	3300010375	Bacteria	1503
111	Ga0105239_10584907	3300010375	Bacteria	1273
112	Ga0105239_11290866	3300010375	Bacteria	842
113	Ga0105246_10013859	3300011119	Bacteria	5060
114	Ga0105246_10942223	3300011119	Bacteria	777
115	Ga0157347_1035988	3300012502	Bacteria	638
116	Ga0157373_10119446	3300013100	Bacteria	1852
117	Ga0157370_10086779	3300013104	Bacteria	2939
118	Ga0157374_10046125	3300013296	Bacteria	4035
119	Ga0163162_12269316	3300013306	Bacteria	623
120	Ga0157375_10088565	3300013308	Bacteria	3150
121	Ga0157375_10416561	3300013308	Bacteria	1509
122	Ga0163163_10226062	3300014325	Bacteria	1920
123	Ga0163163_10392096	3300014325	Bacteria	1447
124	Ga0163163_11976024	3300014325	Bacteria	643
125	Ga0157380_11339184	3300014326	Bacteria	764
126	Ga0157380_11342086	3300014326	Bacteria	764
127	Ga0182008_10080310	3300014497	Bacteria	1605
128	Ga0157377_10016439	3300014745	Bacteria	3806
129	Ga0157377_10338311	3300014745	Bacteria	1006
130	Ga0157379_10001672	3300014968	Bacteria	18340
131	Ga0157379_10024466	3300014968	Bacteria	5360
132	Ga0157376_10372139	3300014969	Bacteria	1374
133	Ga0163161_11440026	3300017792	Bacteria	603
134	Ga0206356_10539135	3300020070	Bacteria	879
135	Ga0224712_10117835	3300022467	Bacteria	1146
136	Ga0209051_1000057	3300025303	Bacteria	263902
137	Ga0209051_1000582	3300025303	Bacteria	43455
138	Ga0207656_10397829	3300025321	Bacteria	692
139	Ga0207713_1174969	3300025735	Bacteria	674
140	Ga0207710_10064908	3300025900	Bacteria	1663
141	Ga0207680_10072505	3300025903	Bacteria	2138
142	Ga0207680_10915899	3300025903	Bacteria	628
143	Ga0207643_10000252	3300025908	Bacteria	37454
144	Ga0207705_10204260	3300025909	Bacteria	1497
145	Ga0207654_10010575	3300025911	Bacteria	4698
146	Ga0207707_10055120	3300025912	Bacteria	3459
147	Ga0207695_11197694	3300025913	Bacteria	640
148	Ga0207671_10400793	3300025914	Bacteria	1091
149	Ga0207693_11424690	3300025915	Bacteria	514
150	Ga0207663_10403812	3300025916	Bacteria	1045
151	Ga0207662_10430361	3300025918	Bacteria	899
152	Ga0207657_10020434	3300025919	Bacteria	6257
153	Ga0207649_11127599	3300025920	Bacteria	619
154	Ga0207652_10855516	3300025921	Bacteria	805
155	Ga0207650_10056265	3300025925	Bacteria	2922
156	Ga0207659_10012252	3300025926	Bacteria	5446
157	Ga0207700_10021810	3300025928	Bacteria	4381
158	Ga0207700_11107317	3300025928	Bacteria	708
159	Ga0207664_10028491	3300025929	Bacteria	4245
160	Ga0207664_10336141	3300025929	Bacteria	1335
161	Ga0207644_10277257	3300025931	Bacteria	1345
162	Ga0207706_10061146	3300025933	Bacteria	3317
163	Ga0207670_10212456	3300025936	Bacteria	1476
164	Ga0207704_11471816	3300025938	Bacteria	584
165	Ga0207704_11974990	3300025938	Bacteria	502
166	Ga0207691_10444628	3300025940	Bacteria	1103
167	Ga0207711_10411755	3300025941	Bacteria	1257
168	Ga0207689_10001903	3300025942	Bacteria	19727
169	Ga0207661_10057197	3300025944	Bacteria	3134
170	Ga0207667_10184306	3300025949	Bacteria	2143
171	Ga0207712_11626692	3300025961	Bacteria	579
172	Ga0207668_10029698	3300025972	Bacteria	3585
173	Ga0207668_10141528	3300025972	Bacteria	1851
174	Ga0207668_11334725	3300025972	Bacteria	646
175	Ga0207658_10000837	3300025986	Bacteria	25676
176	Ga0207677_11604793	3300026023	Bacteria	602
177	Ga0207678_10002235	3300026067	Bacteria	17500
178	Ga0207678_10358738	3300026067	Bacteria	1258
179	Ga0207708_10524495	3300026075	Bacteria	996
180	Ga0207702_10034189	3300026078	Bacteria	4249
181	Ga0207702_10070741	3300026078	Bacteria	3002
182	Ga0207641_10001569	3300026088	Bacteria	22316
183	Ga0207641_10108707	3300026088	Bacteria	2455
184	Ga0207641_12135867	3300026088	Bacteria	561
185	Ga0207648_10490604	3300026089	Bacteria	1123
186	Ga0207676_10339672	3300026095	Bacteria	1385
187	Ga0207676_10781074	3300026095	Bacteria	930
188	Ga0207676_11357174	3300026095	Bacteria	706
189	Ga0207674_10050897	3300026116	Bacteria	4229
190	Ga0207674_10313765	3300026116	Bacteria	1517
191	Ga0207675_100028681	3300026118	Bacteria	5185
192	Ga0207683_10063107	3300026121	Bacteria	3264
193	Ga0268264_10492126	3300028381	Bacteria	1195
194	Ga0268264_10895597	3300028381	Bacteria	890
195	Ga0307517_10245211	3300028786	Bacteria	1058
196	Ga0307517_10495173	3300028786	Bacteria	623
197	Ga0307515_10000065	3300028794	Bacteria	244497
198	Ga0307515_10012622	3300028794	Bacteria	15875
199	Ga0307515_10036058	3300028794	Bacteria	8018
200	Ga0307515_10122857	3300028794	Bacteria	2925
201	Ga0307512_10005567	3300030522	Bacteria	13089
202	Ga0307512_10010384	3300030522	Bacteria	8886
203	Ga0265327_10000336	3300031251	Bacteria	89407
204	Ga0307513_10050992	3300031456	Bacteria	4468
205	Ga0307513_10266728	3300031456	Bacteria	1498
206	Ga0307516_10004210	3300031730	Bacteria	17917
207	Ga0307516_10035054	3300031730	Bacteria	5038
208	Ga0307405_10024315	3300031731	Bacteria	3458
209	Ga0307405_10427494	3300031731	Bacteria	1044
210	Ga0307413_10171371	3300031824	Bacteria	1537
211	Ga0307413_10514630	3300031824	Bacteria	964
212	Ga0307410_10103577	3300031852	Bacteria	2044
213	Ga0326468_10005181	3300031889	Bacteria	1164
214	Ga0326468_10028981	3300031889	Bacteria	720
215	Ga0307406_10701879	3300031901	Bacteria	845
216	Ga0307406_10798445	3300031901	Bacteria	796
217	Ga0307407_10245433	3300031903	Bacteria	1224
218	Ga0307407_10899601	3300031903	Bacteria	679
219	Ga0307409_100001392	3300031995	Bacteria	11817
220	Ga0307409_100150636	3300031995	Bacteria	2019
221	Ga0307409_100170573	3300031995	Bacteria	1915
222	Ga0307409_100566802	3300031995	Bacteria	1117
223	Ga0307416_100004087	3300032002	Bacteria	8725
224	Ga0307416_100360533	3300032002	Bacteria	1476
225	Ga0307416_101050058	3300032002	Bacteria	919
226	Ga0307411_10804453	3300032005	Bacteria	828
227	Ga0307415_100000010	3300032126	Bacteria	88681
228	Ga0307415_100001227	3300032126	Bacteria	12002
229	Ga0307415_100097965	3300032126	Bacteria	2142
230	Ga0307415_100183445	3300032126	Bacteria	1644
231	Ga0307415_100933943	3300032126	Bacteria	802
232	Ga0307507_10267158	3300033179	Bacteria	1085
233	Ga0307507_10317601	3300033179	Bacteria	940
234	Ga0307510_10423069	3300033180	Bacteria	774
235	Ga0373951_0000316	3300035091	Bacteria	15083
236	Ga0373941_0218391	3300035115	Bacteria	732
237	Ga0373960_0194832	3300035121	Bacteria	714
238	Ga0373931_0147178	3300035691	Bacteria	1370
239	Ga0373935_1147510	3300035692	Bacteria	579
240	Ga0373925_0290928	3300037068	Bacteria	1317
241	Ga0395900_0027730	3300037418	Bacteria	5802
242	Ga0395900_1856614	3300037418	Bacteria	513
243	Ga0395898_0004207	3300037466	Bacteria	15775
244	Ga0395905_0003823	3300037471	Bacteria	15908
245	Ga0436364_0772176	3300037853	Bacteria	15181
246	Ga0395901_1357893	3300038443	Bacteria	670
247	Ga0436365_1236773	3300039437	Bacteria	3873
248	Ga0451789_0347640	3300041443	Bacteria	625
249	Ga0451791_1739790	3300041451	Bacteria	514
250	Ga0451797_0998689	3300041453	Bacteria	921
251	Ga0451807_1174770	3300041486	Bacteria	558
252	Ga0451843_1771699	3300041509	Bacteria	932
253	Ga0451853_0273355	3300041512	Bacteria	569
254	Ga0439448_0004556	3300042005	Bacteria	3914
255	Ga0439448_0100783	3300042005	Bacteria	981
256	Ga0439448_0112349	3300042005	Bacteria	931
257	Ga0439455_0091296	3300042012	Bacteria	835
258	Ga0439463_048309	3300042016	Bacteria	1084
259	Ga0466969_0004625	3300044656	Bacteria	7330
260	Ga0466969_0018478	3300044656	Bacteria	3630
261	Ga0466965_0058877	3300044683	Bacteria	1916
262	Ga0466965_0939060	3300044683	Bacteria	506
263	Ga0466966_0071914	3300044684	Bacteria	2166
264	Ga0466961_0001930	3300044693	Bacteria	12918
265	Ga0466970_0004813	3300044765	Bacteria	6668
266	Ga0466960_0020338	3300044901	Bacteria	2939
267	Ga0466959_0006031	3300045049	Bacteria	8365
268	Ga0466967_0256173	3300045976	Bacteria	1673
269	Ga0466967_0429318	3300045976	Bacteria	1289
270	Ga0466967_2438547	3300045976	Bacteria	518
271	Ga0495638_0307026	3300046460	Bacteria	853
272	Ga0495650_0022693	3300046471	Bacteria	3006
273	Ga0495676_0798524	3300047321	Bacteria	608
274	Ga0496100_0000073	3300048903	Bacteria	55397
275	Ga0496100_0002383	3300048903	Bacteria	9514
276	Ga0496100_0094636	3300048903	Bacteria	2046
277	Ga0496101_0000427	3300048904	Bacteria	26970
278	Ga0496101_0122706	3300048904	Bacteria	1965
279	Ga0496101_0182398	3300048904	Bacteria	1617
280	Ga0496102_0000015	3300048905	Bacteria	304524
281	Ga0496102_0001492	3300048905	Bacteria	20667
282	Ga0496102_0084668	3300048905	Bacteria	2927
283	Ga0496103_0000160	3300048906	Bacteria	71063
284	Ga0496103_0001217	3300048906	Bacteria	17651
285	Ga0496103_0133007	3300048906	Bacteria	1589
286	Ga0496104_0024928	3300048907	Bacteria	5509
287	Ga0496104_0091984	3300048907	Bacteria	2900
288	Ga0496105_0136211	3300048908	Bacteria	2023
289	Ga0496106_0000180	3300048909	Bacteria	45250
290	Ga0496106_0002835	3300048909	Bacteria	12861
291	Ga0496106_0080735	3300048909	Bacteria	2498
292	Ga0496107_0003206	3300048910	Bacteria	10883
293	Ga0496107_0250991	3300048910	Bacteria	1316
294	Ga0496107_0418868	3300048910	Bacteria	996
295	Ga0496108_0002801	3300048911	Bacteria	13978
296	Ga0496108_0227148	3300048911	Bacteria	1622
297	Ga0496108_1242647	3300048911	Bacteria	628
298	Ga0496109_0010645	3300048912	Bacteria	7865
299	Ga0496109_0221441	3300048912	Bacteria	1779
300	Ga0496110_0030743	3300048913	Bacteria	4630
301	Ga0496110_0101566	3300048913	Bacteria	2578
302	Ga0496110_0492479	3300048913	Bacteria	1116
303	Ga0496111_0026068	3300048914	Bacteria	4126
304	Ga0496111_0043048	3300048914	Bacteria	3244
305	Ga0496112_0525121	3300048915	Bacteria	1118
306	Ga0496113_0833444	3300048916	Bacteria	732
307	Ga0496114_0000666	3300048917	Bacteria	25494
308	Ga0496114_1529817	3300048917	Bacteria	555
309	Ga0496115_0060975	3300048918	Bacteria	3040
310	Ga0496115_0598270	3300048918	Bacteria	877
311	Ga0496116_0000178	3300048919	Bacteria	128023
312	Ga0496116_0112205	3300048919	Bacteria	1598
313	Ga0496117_0000047	3300048920	Bacteria	299632
314	Ga0496117_0272627	3300048920	Bacteria	910
315	Ga0496117_0272641	3300048920	Bacteria	910
316	Ga0496118_0000050	3300048921	Bacteria	244124
317	Ga0496118_0100828	3300048921	Bacteria	1951
318	Ga0496119_0001154	3300048922	Bacteria	33132
319	Ga0496119_0026687	3300048922	Bacteria	3995
320	Ga0496120_0002668	3300048923	Bacteria	17576
321	Ga0496120_0052270	3300048923	Bacteria	2328
322	Ga0496121_0000004	3300048924	Bacteria	1139011
323	Ga0496121_0018458	3300048924	Bacteria	7031
324	Ga0496122_0002713	3300048925	Bacteria	24596
325	Ga0496123_0015831	3300048926	Bacteria	6159
326	Ga0496124_0000117	3300048927	Bacteria	164439
327	Ga0496124_0047065	3300048927	Bacteria	3691
328	Ga0496125_0000003	3300048928	Bacteria	1189767
329	Ga0496125_0055770	3300048928	Bacteria	3215
330	Ga0496126_0000001	3300048929	Bacteria	1139011
331	Ga0496126_0000049	3300048929	Bacteria	317568
332	Ga0501040_0274458	3300049576	Bacteria	1204
333	Ga0501046_1215000	3300049580	Bacteria	517
334	nmdc:mga03683_556849_c1	3300050489	Bacteria	558
335	nmdc:mga05p37_1202953_c1	3300050507	Bacteria	783
336	nmdc:mga05p37_32353_c1	3300050507	Bacteria	6396
337	nmdc:mga05p37_45682_c1	3300050507	Bacteria	5386
338	nmdc:mga09592_107247_c1	3300050508	Bacteria	2396
339	nmdc:mga09592_1491889_c1	3300050508	Bacteria	550
340	nmdc:mga09592_4891_c1	3300050508	Bacteria	10852
341	nmdc:mga09592_801128_c1	3300050508	Bacteria	797
342	nmdc:mga0qj67_10942_c1	3300050509	Bacteria	6790
343	nmdc:mga0qj67_1578241_c1	3300050509	Bacteria	504
344	nmdc:mga0qj67_759_c1	3300050509	Bacteria	21967
345	nmdc:mga0qj67_954336_c1	3300050509	Bacteria	674
346	nmdc:mga06r32_1729157_c1	3300050510	Bacteria	562
347	nmdc:mga06r32_440873_c1	3300050510	Bacteria	1282
348	nmdc:mga06r32_475096_c1	3300050510	Bacteria	1228
349	nmdc:mga06r32_59571_c1	3300050510	Bacteria	3673
350	nmdc:mga06r32_9512_c1	3300050510	Bacteria	8776
351	nmdc:mga06r32_983506_c1	3300050510	Bacteria	797
352	nmdc:mga08y16_1982129_c1	3300050511	Bacteria	532
353	nmdc:mga08y16_225402_c1	3300050511	Bacteria	1940
354	nmdc:mga0n895_18586_c1	3300050512	Bacteria	6436
355	nmdc:mga08x19_4076_c1	3300050514	Bacteria	8671
356	nmdc:mga0a205_119809_c1	3300050515	Bacteria	2531
357	Ga0500644_0337445	3300053088	Bacteria	650
358	Ga0500646_0000139	3300053090	Bacteria	21207
359	Ga0500583_0016518	3300053092	Bacteria	2948
360	Ga0500641_0045072	3300053096	Bacteria	1795
361	Ga0500654_068853	3300053099	Bacteria	1742
362	Ga0500594_0006901	3300053118	Bacteria	2560
363	Ga0500577_0037056	3300053142	Bacteria	1750
364	Ga0500579_152214	3300053143	Bacteria	1004
365	Ga0500588_0010591	3300053146	Bacteria	2232
366	Ga0500600_0049664	3300053149	Bacteria	2383
367	Ga0500624_144421	3300053157	Bacteria	509
368	Ga0500630_215147	3300053159	Bacteria	728
369	Ga0501084_0248007	3300054114	Bacteria	1503
370	Ga0466962_0081648	3300061719	Bacteria	1546
371	Ga0530510_0029651	3300061734	Bacteria	3928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	iso_pu_bacteria	2738541264	2738669106	87
2	iso_pu_bacteria	2738541356	2739147643	87
3	3300003792	Ga0055540_1000068	Ga0055540_100006857	90
4	3300025303	Ga0209051_1000057	Ga0209051_100005757	90
5	3300042005	Ga0439448_0004556	Ga0439448_0004556_2542_2814	90
6	3300005335	Ga0070666_10008072	Ga0070666_100080723	91
7	3300005367	Ga0070667_100000525	Ga0070667_10000052513	91
8	3300009545	Ga0105237_10138524	Ga0105237_101385242	91
9	3300010375	Ga0105239_10046143	Ga0105239_100461433	91
10	3300010375	Ga0105239_10426540	Ga0105239_104265402	91
11	3300012502	Ga0157347_1035988	Ga0157347_10359881	91
12	3300025903	Ga0207680_10072505	Ga0207680_100725053	91
13	3300025914	Ga0207671_10400793	Ga0207671_104007932	91
14	3300025986	Ga0207658_10000837	Ga0207658_100008378	91
15	3300031251	Ga0265327_10000336	Ga0265327_1000033641	91
16	3300044683	Ga0466965_0058877	Ga0466965_0058877_746_1021	91
17	3300045976	Ga0466967_0429318	Ga0466967_0429318_828_1103	91
18	3300048903	Ga0496100_0000073	Ga0496100_0000073_12417_12701	91
19	3300048904	Ga0496101_0000427	Ga0496101_0000427_13662_13946	91
20	3300048905	Ga0496102_0001492	Ga0496102_0001492_12995_13279	91
21	3300048906	Ga0496103_0001217	Ga0496103_0001217_5618_5902	91
22	3300048909	Ga0496106_0000180	Ga0496106_0000180_31969_32253	91
23	3300048910	Ga0496107_0003206	Ga0496107_0003206_7488_7772	91
24	3300048911	Ga0496108_0002801	Ga0496108_0002801_7870_8154	91
25	3300048912	Ga0496109_0010645	Ga0496109_0010645_342_626	91
26	3300048913	Ga0496110_0030743	Ga0496110_0030743_699_983	91
27	3300048914	Ga0496111_0026068	Ga0496111_0026068_2923_3207	91
28	3300048915	Ga0496112_0525121	Ga0496112_0525121_364_648	91
29	3300048917	Ga0496114_0000666	Ga0496114_0000666_12794_13078	91
30	3300048918	Ga0496115_0060975	Ga0496115_0060975_1259_1543	91
31	3300048919	Ga0496116_0112205	Ga0496116_0112205_56_340	91
32	3300048920	Ga0496117_0272627	Ga0496117_0272627_56_340	91
33	3300048920	Ga0496117_0272641	Ga0496117_0272641_56_340	91
34	3300048921	Ga0496118_0100828	Ga0496118_0100828_737_1021	91
35	3300048922	Ga0496119_0026687	Ga0496119_0026687_2858_3142	91
36	3300048923	Ga0496120_0052270	Ga0496120_0052270_697_981	91
37	3300048924	Ga0496121_0000004	Ga0496121_0000004_12417_12701	91
38	3300048925	Ga0496122_0002713	Ga0496122_0002713_11896_12180	91
39	3300048926	Ga0496123_0015831	Ga0496123_0015831_4373_4657	91
40	3300048927	Ga0496124_0000117	Ga0496124_0000117_12417_12701	91
41	3300048928	Ga0496125_0000003	Ga0496125_0000003_1177067_1177351	91
42	3300048929	Ga0496126_0000001	Ga0496126_0000001_12417_12701	91
43	3300025921	Ga0207652_10855516	Ga0207652_108555162	92
44	3300025303	Ga0209051_1000582	Ga0209051_100058216	93
45	3300050489	nmdc:mga03683_556849_c1	nmdc:mga03683_556849_c1_130_411	93
46	iso_pu_bacteria	2861520306	2861526691	93
47	3300005437	Ga0070710_10952519	Ga0070710_109525191	94
48	3300005841	Ga0068863_100716946	Ga0068863_1007169462	94
49	3300025929	Ga0207664_10336141	Ga0207664_103361414	94
50	3300028794	Ga0307515_10012622	Ga0307515_100126222	94
51	3300044683	Ga0466965_0939060	Ga0466965_0939060_156_440	94
52	3300048916	Ga0496113_0833444	Ga0496113_0833444_239_532	94
53	iso_pu_bacteria	2791354901	2791913994	94
54	3300006844	Ga0075428_100030559	Ga0075428_1000305599	95
55	3300041486	Ga0451807_1174770	Ga0451807_1174770_236_523	95
56	3300050510	nmdc:mga06r32_440873_c1	nmdc:mga06r32_440873_c1_468_755	95
57	3300005327	Ga0070658_10431319	Ga0070658_104313192	96
58	3300005334	Ga0068869_100020859	Ga0068869_1000208593	96
59	3300005335	Ga0070666_11081972	Ga0070666_110819721	96
60	3300005336	Ga0070680_100080680	Ga0070680_1000806802	96
61	3300005339	Ga0070660_100532102	Ga0070660_1005321022	96
62	3300005340	Ga0070689_100616652	Ga0070689_1006166522	96
63	3300005344	Ga0070661_100423609	Ga0070661_1004236092	96
64	3300005355	Ga0070671_100014570	Ga0070671_1000145703	96
65	3300005365	Ga0070688_100019302	Ga0070688_1000193024	96
66	3300005366	Ga0070659_100071406	Ga0070659_1000714063	96
67	3300005367	Ga0070667_101412855	Ga0070667_1014128552	96
68	3300005436	Ga0070713_100060933	Ga0070713_1000609333	96
69	3300005438	Ga0070701_10103885	Ga0070701_101038851	96
70	3300005439	Ga0070711_100066217	Ga0070711_1000662171	96
71	3300005441	Ga0070700_100023986	Ga0070700_1000239862	96
72	3300005456	Ga0070678_100048083	Ga0070678_1000480832	96
73	3300005466	Ga0070685_10523290	Ga0070685_105232902	96
74	3300005530	Ga0070679_100802478	Ga0070679_1008024782	96
75	3300005539	Ga0068853_100204077	Ga0068853_1002040772	96
76	3300005546	Ga0070696_100584031	Ga0070696_1005840311	96
77	3300005547	Ga0070693_100016903	Ga0070693_1000169033	96
78	3300005548	Ga0070665_100058377	Ga0070665_1000583773	96
79	3300005549	Ga0070704_101385316	Ga0070704_1013853162	96
80	3300005563	Ga0068855_100088744	Ga0068855_1000887443	96
81	3300005577	Ga0068857_100538943	Ga0068857_1005389432	96
82	3300005578	Ga0068854_100093567	Ga0068854_1000935673	96
83	3300005614	Ga0068856_100068212	Ga0068856_1000682122	96
84	3300005615	Ga0070702_100027826	Ga0070702_1000278263	96
85	3300005616	Ga0068852_100276531	Ga0068852_1002765312	96
86	3300005617	Ga0068859_100438929	Ga0068859_1004389292	96
87	3300005618	Ga0068864_100149648	Ga0068864_1001496482	96
88	3300005719	Ga0068861_100354133	Ga0068861_1003541333	96
89	3300005834	Ga0068851_10006918	Ga0068851_100069184	96
90	3300005840	Ga0068870_10006076	Ga0068870_100060763	96
91	3300005841	Ga0068863_100017082	Ga0068863_1000170827	96
92	3300005841	Ga0068863_100069771	Ga0068863_1000697713	96
93	3300005843	Ga0068860_100358274	Ga0068860_1003582742	96
94	3300006358	Ga0068871_100345631	Ga0068871_1003456312	96
95	3300006844	Ga0075428_100322625	Ga0075428_1003226252	96
96	3300006844	Ga0075428_100673632	Ga0075428_1006736322	96
97	3300006847	Ga0075431_100063828	Ga0075431_1000638283	96
98	3300006852	Ga0075433_10028279	Ga0075433_100282793	96
99	3300006871	Ga0075434_100585007	Ga0075434_1005850072	96
100	3300006880	Ga0075429_100621432	Ga0075429_1006214322	96
101	3300006880	Ga0075429_101978381	Ga0075429_1019783811	96
102	3300006914	Ga0075436_100005637	Ga0075436_1000056373	96
103	3300006931	Ga0097620_100438891	Ga0097620_1004388912	96
104	3300007076	Ga0075435_100066968	Ga0075435_1000669682	96
105	3300009011	Ga0105251_10113247	Ga0105251_101132472	96
106	3300009093	Ga0105240_10393126	Ga0105240_103931262	96
107	3300009094	Ga0111539_10233537	Ga0111539_102335373	96
108	3300009094	Ga0111539_10996275	Ga0111539_109962752	96
109	3300009101	Ga0105247_10167846	Ga0105247_101678462	96
110	3300009147	Ga0114129_10076083	Ga0114129_100760834	96
111	3300009148	Ga0105243_10537944	Ga0105243_105379441	96
112	3300009174	Ga0105241_10005987	Ga0105241_100059873	96
113	3300009177	Ga0105248_10581466	Ga0105248_105814663	96
114	3300009551	Ga0105238_10038837	Ga0105238_100388373	96
115	3300010375	Ga0105239_10584907	Ga0105239_105849072	96
116	3300011119	Ga0105246_10013859	Ga0105246_100138594	96
117	3300013100	Ga0157373_10119446	Ga0157373_101194461	96
118	3300013104	Ga0157370_10086779	Ga0157370_100867793	96
119	3300013296	Ga0157374_10046125	Ga0157374_100461254	96
120	3300013306	Ga0163162_12269316	Ga0163162_122693162	96
121	3300013308	Ga0157375_10088565	Ga0157375_100885653	96
122	3300014325	Ga0163163_10226062	Ga0163163_102260622	96
123	3300014497	Ga0182008_10080310	Ga0182008_100803101	96
124	3300014745	Ga0157377_10016439	Ga0157377_100164393	96
125	3300014968	Ga0157379_10024466	Ga0157379_100244662	96
126	3300014969	Ga0157376_10372139	Ga0157376_103721392	96
127	3300020070	Ga0206356_10539135	Ga0206356_105391352	96
128	3300022467	Ga0224712_10117835	Ga0224712_101178351	96
129	3300025321	Ga0207656_10397829	Ga0207656_103978291	96
130	3300025903	Ga0207680_10915899	Ga0207680_109158991	96
131	3300025908	Ga0207643_10000252	Ga0207643_1000025235	96
132	3300025909	Ga0207705_10204260	Ga0207705_102042602	96
133	3300025911	Ga0207654_10010575	Ga0207654_100105753	96
134	3300025912	Ga0207707_10055120	Ga0207707_100551204	96
135	3300025913	Ga0207695_11197694	Ga0207695_111976942	96
136	3300025916	Ga0207663_10403812	Ga0207663_104038121	96
137	3300025918	Ga0207662_10430361	Ga0207662_104303612	96
138	3300025919	Ga0207657_10020434	Ga0207657_100204344	96
139	3300025925	Ga0207650_10056265	Ga0207650_100562653	96
140	3300025926	Ga0207659_10012252	Ga0207659_100122523	96
141	3300025928	Ga0207700_10021810	Ga0207700_100218103	96
142	3300025929	Ga0207664_10028491	Ga0207664_100284914	96
143	3300025931	Ga0207644_10277257	Ga0207644_102772573	96
144	3300025933	Ga0207706_10061146	Ga0207706_100611463	96
145	3300025936	Ga0207670_10212456	Ga0207670_102124563	96
146	3300025938	Ga0207704_11974990	Ga0207704_119749902	96
147	3300025941	Ga0207711_10411755	Ga0207711_104117552	96
148	3300025942	Ga0207689_10001903	Ga0207689_1000190314	96
149	3300025944	Ga0207661_10057197	Ga0207661_100571973	96
150	3300025949	Ga0207667_10184306	Ga0207667_101843063	96
151	3300025972	Ga0207668_10029698	Ga0207668_100296985	96
152	3300025972	Ga0207668_10141528	Ga0207668_101415282	96
153	3300026023	Ga0207677_11604793	Ga0207677_116047931	96
154	3300026067	Ga0207678_10002235	Ga0207678_100022353	96
155	3300026075	Ga0207708_10524495	Ga0207708_105244952	96
156	3300026078	Ga0207702_10034189	Ga0207702_100341892	96
157	3300026078	Ga0207702_10070741	Ga0207702_100707414	96
158	3300026088	Ga0207641_10108707	Ga0207641_101087071	96
159	3300026089	Ga0207648_10490604	Ga0207648_104906041	96
160	3300026095	Ga0207676_10781074	Ga0207676_107810742	96
161	3300026116	Ga0207674_10050897	Ga0207674_100508974	96
162	3300026118	Ga0207675_100028681	Ga0207675_1000286814	96
163	3300026121	Ga0207683_10063107	Ga0207683_100631073	96
164	3300028381	Ga0268264_10492126	Ga0268264_104921262	96
165	3300033179	Ga0307507_10267158	Ga0307507_102671582	96
166	3300035692	Ga0373935_1147510	Ga0373935_1147510_78_377	96
167	3300042005	Ga0439448_0100783	Ga0439448_0100783_160_450	96
168	3300042005	Ga0439448_0112349	Ga0439448_0112349_119_409	96
169	3300042012	Ga0439455_0091296	Ga0439455_0091296_378_668	96
170	3300042016	Ga0439463_048309	Ga0439463_048309_485_775	96
171	3300047321	Ga0495676_0798524	Ga0495676_0798524_46_345	96
172	3300048903	Ga0496100_0094636	Ga0496100_0094636_400_690	96
173	3300048904	Ga0496101_0182398	Ga0496101_0182398_300_590	96
174	3300048905	Ga0496102_0084668	Ga0496102_0084668_515_805	96
175	3300048906	Ga0496103_0133007	Ga0496103_0133007_835_1125	96
176	3300048907	Ga0496104_0024928	Ga0496104_0024928_518_808	96
177	3300048909	Ga0496106_0002835	Ga0496106_0002835_345_635	96
178	3300048910	Ga0496107_0418868	Ga0496107_0418868_187_477	96
179	3300048911	Ga0496108_0227148	Ga0496108_0227148_882_1172	96
180	3300048912	Ga0496109_0221441	Ga0496109_0221441_451_741	96
181	3300048913	Ga0496110_0101566	Ga0496110_0101566_155_445	96
182	3300048914	Ga0496111_0043048	Ga0496111_0043048_2381_2671	96
183	3300048917	Ga0496114_1529817	Ga0496114_1529817_217_507	96
184	3300048918	Ga0496115_0598270	Ga0496115_0598270_214_504	96
185	3300050507	nmdc:mga05p37_1202953_c1	nmdc:mga05p37_1202953_c1_472_762	96
186	3300050508	nmdc:mga09592_1491889_c1	nmdc:mga09592_1491889_c1_239_529	96
187	3300050508	nmdc:mga09592_801128_c1	nmdc:mga09592_801128_c1_129_419	96
188	3300050509	nmdc:mga0qj67_954336_c1	nmdc:mga0qj67_954336_c1_329_619	96
189	3300050510	nmdc:mga06r32_9512_c1	nmdc:mga06r32_9512_c1_2220_2570	96
190	3300050510	nmdc:mga06r32_983506_c1	nmdc:mga06r32_983506_c1_188_478	96
191	3300050511	nmdc:mga08y16_1982129_c1	nmdc:mga08y16_1982129_c1_124_414	96
192	3300050511	nmdc:mga08y16_225402_c1	nmdc:mga08y16_225402_c1_1201_1491	96
193	3300050512	nmdc:mga0n895_18586_c1	nmdc:mga0n895_18586_c1_2314_2604	96
194	3300050514	nmdc:mga08x19_4076_c1	nmdc:mga08x19_4076_c1_7458_7748	96
195	3300050515	nmdc:mga0a205_119809_c1	nmdc:mga0a205_119809_c1_496_786	96
196	3300053090	Ga0500646_0000139	Ga0500646_0000139_7283_7573	96
197	3300053092	Ga0500583_0016518	Ga0500583_0016518_2191_2481	96
198	3300053096	Ga0500641_0045072	Ga0500641_0045072_1389_1679	96
199	3300053099	Ga0500654_068853	Ga0500654_068853_13_303	96
200	3300053118	Ga0500594_0006901	Ga0500594_0006901_1511_1801	96
201	3300053146	Ga0500588_0010591	Ga0500588_0010591_296_586	96
202	iso_pu_bacteria	2738543011	2739238616	96
203	iso_pu_bacteria	2939743619	2939746072	96
204	3300003203	JGI25406J46586_10003918	JGI25406J46586_100039185	97
205	3300005455	Ga0070663_100672196	Ga0070663_1006721961	97
206	3300005530	Ga0070679_100866197	Ga0070679_1008661972	97
207	3300005543	Ga0070672_101536228	Ga0070672_1015362281	97
208	3300005564	Ga0070664_101016181	Ga0070664_1010161811	97
209	3300005617	Ga0068859_100738374	Ga0068859_1007383742	97
210	3300005618	Ga0068864_100459265	Ga0068864_1004592652	97
211	3300005840	Ga0068870_10171375	Ga0068870_101713752	97
212	3300005841	Ga0068863_100001064	Ga0068863_10000106422	97
213	3300005841	Ga0068863_102220571	Ga0068863_1022205712	97
214	3300005985	Ga0081539_10000264	Ga0081539_1000026416	97
215	3300006051	Ga0075364_10421433	Ga0075364_104214332	97
216	3300006237	Ga0097621_101146579	Ga0097621_1011465792	97
217	3300006844	Ga0075428_100191523	Ga0075428_1001915234	97
218	3300006846	Ga0075430_100423994	Ga0075430_1004239941	97
219	3300006847	Ga0075431_100831862	Ga0075431_1008318622	97
220	3300006880	Ga0075429_100668331	Ga0075429_1006683312	97
221	3300006931	Ga0097620_100738275	Ga0097620_1007382752	97
222	3300009011	Ga0105251_10337589	Ga0105251_103375892	97
223	3300009094	Ga0111539_10740276	Ga0111539_107402762	97
224	3300009094	Ga0111539_12907642	Ga0111539_129076421	97
225	3300009098	Ga0105245_13194463	Ga0105245_131944631	97
226	3300009101	Ga0105247_10047971	Ga0105247_100479712	97
227	3300009147	Ga0114129_11114259	Ga0114129_111142592	97
228	3300009553	Ga0105249_11333165	Ga0105249_113331651	97
229	3300010375	Ga0105239_11290866	Ga0105239_112908662	97
230	3300011119	Ga0105246_10942223	Ga0105246_109422232	97
231	3300013308	Ga0157375_10416561	Ga0157375_104165612	97
232	3300014325	Ga0163163_10392096	Ga0163163_103920962	97
233	3300014325	Ga0163163_11976024	Ga0163163_119760242	97
234	3300014326	Ga0157380_11339184	Ga0157380_113391842	97
235	3300014326	Ga0157380_11342086	Ga0157380_113420861	97
236	3300014745	Ga0157377_10338311	Ga0157377_103383111	97
237	3300014968	Ga0157379_10001672	Ga0157379_100016726	97
238	3300025735	Ga0207713_1174969	Ga0207713_11749692	97
239	3300025900	Ga0207710_10064908	Ga0207710_100649083	97
240	3300025915	Ga0207693_11424690	Ga0207693_114246901	97
241	3300025920	Ga0207649_11127599	Ga0207649_111275992	97
242	3300025938	Ga0207704_11471816	Ga0207704_114718162	97
243	3300025940	Ga0207691_10444628	Ga0207691_104446282	97
244	3300025961	Ga0207712_11626692	Ga0207712_116266921	97
245	3300025972	Ga0207668_11334725	Ga0207668_113347251	97
246	3300026067	Ga0207678_10358738	Ga0207678_103587382	97
247	3300026088	Ga0207641_10001569	Ga0207641_1000156912	97
248	3300026088	Ga0207641_12135867	Ga0207641_121358672	97
249	3300026095	Ga0207676_10339672	Ga0207676_103396722	97
250	3300026095	Ga0207676_11357174	Ga0207676_113571742	97
251	3300026116	Ga0207674_10313765	Ga0207674_103137653	97
252	3300028786	Ga0307517_10245211	Ga0307517_102452112	97
253	3300028786	Ga0307517_10495173	Ga0307517_104951731	97
254	3300028794	Ga0307515_10000065	Ga0307515_1000006561	97
255	3300028794	Ga0307515_10036058	Ga0307515_100360586	97
256	3300028794	Ga0307515_10122857	Ga0307515_101228572	97
257	3300030522	Ga0307512_10005567	Ga0307512_100055679	97
258	3300031456	Ga0307513_10266728	Ga0307513_102667281	97
259	3300031730	Ga0307516_10004210	Ga0307516_1000421015	97
260	3300031730	Ga0307516_10035054	Ga0307516_100350543	97
261	3300031731	Ga0307405_10427494	Ga0307405_104274942	97
262	3300031824	Ga0307413_10514630	Ga0307413_105146301	97
263	3300031889	Ga0326468_10005181	Ga0326468_100051812	97
264	3300031889	Ga0326468_10028981	Ga0326468_100289811	97
265	3300031901	Ga0307406_10798445	Ga0307406_107984451	97
266	3300031903	Ga0307407_10245433	Ga0307407_102454332	97
267	3300031903	Ga0307407_10899601	Ga0307407_108996011	97
268	3300031995	Ga0307409_100150636	Ga0307409_1001506361	97
269	3300031995	Ga0307409_100566802	Ga0307409_1005668021	97
270	3300032002	Ga0307416_101050058	Ga0307416_1010500582	97
271	3300032005	Ga0307411_10804453	Ga0307411_108044532	97
272	3300032126	Ga0307415_100001227	Ga0307415_1000012272	97
273	3300032126	Ga0307415_100097965	Ga0307415_1000979652	97
274	3300032126	Ga0307415_100933943	Ga0307415_1009339432	97
275	3300033179	Ga0307507_10317601	Ga0307507_103176011	97
276	3300033180	Ga0307510_10423069	Ga0307510_104230691	97
277	3300035091	Ga0373951_0000316	Ga0373951_0000316_5945_6238	97
278	3300035115	Ga0373941_0218391	Ga0373941_0218391_26_319	97
279	3300035121	Ga0373960_0194832	Ga0373960_0194832_177_479	97
280	3300035691	Ga0373931_0147178	Ga0373931_0147178_585_878	97
281	3300037418	Ga0395900_0027730	Ga0395900_0027730_3865_4158	97
282	3300037466	Ga0395898_0004207	Ga0395898_0004207_7843_8136	97
283	3300037471	Ga0395905_0003823	Ga0395905_0003823_478_771	97
284	3300038443	Ga0395901_1357893	Ga0395901_1357893_359_652	97
285	3300041443	Ga0451789_0347640	Ga0451789_0347640_251_544	97
286	3300041451	Ga0451791_1739790	Ga0451791_1739790_122_415	97
287	3300041453	Ga0451797_0998689	Ga0451797_0998689_334_627	97
288	3300041509	Ga0451843_1771699	Ga0451843_1771699_551_844	97
289	3300041512	Ga0451853_0273355	Ga0451853_0273355_68_361	97
290	3300046460	Ga0495638_0307026	Ga0495638_0307026_320_613	97
291	3300048903	Ga0496100_0002383	Ga0496100_0002383_1361_1663	97
292	3300048904	Ga0496101_0122706	Ga0496101_0122706_773_1075	97
293	3300048905	Ga0496102_0000015	Ga0496102_0000015_264121_264423	97
294	3300048906	Ga0496103_0000160	Ga0496103_0000160_30701_31003	97
295	3300048907	Ga0496104_0091984	Ga0496104_0091984_68_370	97
296	3300048908	Ga0496105_0136211	Ga0496105_0136211_803_1105	97
297	3300048909	Ga0496106_0080735	Ga0496106_0080735_275_577	97
298	3300048910	Ga0496107_0250991	Ga0496107_0250991_162_464	97
299	3300048911	Ga0496108_1242647	Ga0496108_1242647_230_523	97
300	3300048913	Ga0496110_0492479	Ga0496110_0492479_182_475	97
301	3300048919	Ga0496116_0000178	Ga0496116_0000178_40090_40392	97
302	3300048920	Ga0496117_0000047	Ga0496117_0000047_40100_40402	97
303	3300048921	Ga0496118_0000050	Ga0496118_0000050_203147_203449	97
304	3300048922	Ga0496119_0001154	Ga0496119_0001154_17458_17760	97
305	3300048923	Ga0496120_0002668	Ga0496120_0002668_7352_7654	97
306	3300048924	Ga0496121_0018458	Ga0496121_0018458_70_372	97
307	3300048927	Ga0496124_0047065	Ga0496124_0047065_2314_2616	97
308	3300048928	Ga0496125_0055770	Ga0496125_0055770_642_944	97
309	3300048929	Ga0496126_0000049	Ga0496126_0000049_276801_277103	97
310	3300049576	Ga0501040_0274458	Ga0501040_0274458_616_912	97
311	3300050509	nmdc:mga0qj67_1578241_c1	nmdc:mga0qj67_1578241_c1_149_442	97
312	3300050510	nmdc:mga06r32_1729157_c1	nmdc:mga06r32_1729157_c1_172_465	97
313	3300053088	Ga0500644_0337445	Ga0500644_0337445_233_526	97
314	3300053143	Ga0500579_152214	Ga0500579_152214_417_710	97
315	3300053149	Ga0500600_0049664	Ga0500600_0049664_448_741	97
316	3300054114	Ga0501084_0248007	Ga0501084_0248007_854_1150	97
317	iso_pu_bacteria	2558860112	2558913468	97
318	iso_pu_bacteria	2558860280	2559427042	97
319	3300001989	JGI24739J22299_10091102	JGI24739J22299_100911021	98
320	3300005331	Ga0070670_101288142	Ga0070670_1012881421	98
321	3300005347	Ga0070668_100371923	Ga0070668_1003719232	98
322	3300005436	Ga0070713_101665988	Ga0070713_1016659881	98
323	3300005843	Ga0068860_100981193	Ga0068860_1009811931	98
324	3300005937	Ga0081455_10021418	Ga0081455_100214186	98
325	3300006028	Ga0070717_11563264	Ga0070717_115632642	98
326	3300006844	Ga0075428_100392249	Ga0075428_1003922492	98
327	3300006846	Ga0075430_100001544	Ga0075430_10000154414	98
328	3300006846	Ga0075430_100002213	Ga0075430_10000221318	98
329	3300006847	Ga0075431_100011435	Ga0075431_10001143510	98
330	3300006880	Ga0075429_100002594	Ga0075429_1000025946	98
331	3300006880	Ga0075429_100025234	Ga0075429_1000252344	98
332	3300009094	Ga0111539_11380290	Ga0111539_113802901	98
333	3300009094	Ga0111539_11663845	Ga0111539_116638451	98
334	3300009147	Ga0114129_10010110	Ga0114129_100101103	98
335	3300009147	Ga0114129_10014058	Ga0114129_100140582	98
336	3300009984	Ga0105029_102423	Ga0105029_1024231	98
337	3300017792	Ga0163161_11440026	Ga0163161_114400262	98
338	3300025928	Ga0207700_11107317	Ga0207700_111073172	98
339	3300028381	Ga0268264_10895597	Ga0268264_108955971	98
340	3300030522	Ga0307512_10010384	Ga0307512_100103843	98
341	3300031456	Ga0307513_10050992	Ga0307513_100509921	98
342	3300031731	Ga0307405_10024315	Ga0307405_100243154	98
343	3300031824	Ga0307413_10171371	Ga0307413_101713712	98
344	3300031852	Ga0307410_10103577	Ga0307410_101035772	98
345	3300031901	Ga0307406_10701879	Ga0307406_107018792	98
346	3300031995	Ga0307409_100001392	Ga0307409_10000139211	98
347	3300031995	Ga0307409_100170573	Ga0307409_1001705732	98
348	3300032002	Ga0307416_100004087	Ga0307416_1000040875	98
349	3300032002	Ga0307416_100360533	Ga0307416_1003605332	98
350	3300032126	Ga0307415_100000010	Ga0307415_10000001083	98
351	3300032126	Ga0307415_100183445	Ga0307415_1001834452	98
352	3300037068	Ga0373925_0290928	Ga0373925_0290928_432_794	98
353	3300037418	Ga0395900_1856614	Ga0395900_1856614_195_491	98
354	3300037853	Ga0436364_0772176	Ga0436364_0772176_9229_9534	98
355	3300039437	Ga0436365_1236773	Ga0436365_1236773_581_889	98
356	3300044656	Ga0466969_0004625	Ga0466969_0004625_3445_3759	98
357	3300044656	Ga0466969_0018478	Ga0466969_0018478_1794_2108	98
358	3300044684	Ga0466966_0071914	Ga0466966_0071914_1812_2126	98
359	3300044693	Ga0466961_0001930	Ga0466961_0001930_1441_1755	98
360	3300044765	Ga0466970_0004813	Ga0466970_0004813_4122_4436	98
361	3300044901	Ga0466960_0020338	Ga0466960_0020338_2430_2729	98
362	3300045049	Ga0466959_0006031	Ga0466959_0006031_5927_6241	98
363	3300045976	Ga0466967_0256173	Ga0466967_0256173_947_1261	98
364	3300045976	Ga0466967_2438547	Ga0466967_2438547_144_458	98
365	3300046471	Ga0495650_0022693	Ga0495650_0022693_176_472	98
366	3300049580	Ga0501046_1215000	Ga0501046_1215000_128_430	98
367	3300050507	nmdc:mga05p37_32353_c1	nmdc:mga05p37_32353_c1_4288_4590	98
368	3300050507	nmdc:mga05p37_45682_c1	nmdc:mga05p37_45682_c1_3539_3847	98
369	3300050508	nmdc:mga09592_107247_c1	nmdc:mga09592_107247_c1_1816_2124	98
370	3300050508	nmdc:mga09592_4891_c1	nmdc:mga09592_4891_c1_5723_6025	98
371	3300050509	nmdc:mga0qj67_10942_c1	nmdc:mga0qj67_10942_c1_1494_1796	98
372	3300050509	nmdc:mga0qj67_759_c1	nmdc:mga0qj67_759_c1_12146_12442	98
373	3300050510	nmdc:mga06r32_475096_c1	nmdc:mga06r32_475096_c1_114_422	98
374	3300050510	nmdc:mga06r32_59571_c1	nmdc:mga06r32_59571_c1_2574_2876	98
375	3300053142	Ga0500577_0037056	Ga0500577_0037056_1342_1641	98
376	3300053157	Ga0500624_144421	Ga0500624_144421_175_471	98
377	3300053159	Ga0500630_215147	Ga0500630_215147_215_511	98
378	3300061719	Ga0466962_0081648	Ga0466962_0081648_359_673	98
379	3300061734	Ga0530510_0029651	Ga0530510_0029651_2539_2838	98

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

22

111

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2ebb-assembly1.cif.gz_A-2	crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426	0.973	5	95
3jst-assembly2.cif.gz_B	crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis	0.9727	3	93
3hxa-assembly1.cif.gz_D	crystal structure of dcoh1thr51ser	0.939	1	95
1usm-assembly1.cif.gz_A-2	dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant	0.9326	20	91
3jst-assembly2.cif.gz_B	crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis	0.9326	3	93

ID	Description	Score	Start	End	Superfamily
af_P9WI93_1_93_3.30.1360.20	Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase	0.9775	4	91	3.30.1360.20
2ebbA00	Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase	0.973	5	95	3.30.1360.20
af_Q6MX13_31_126_3.30.1360.20	Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase	0.9522	4	98	3.30.1360.20
af_Q4CYK3_54_151_3.30.1360.20	Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase	0.9458	1	93	3.30.1360.20
af_Q6MX13_31_126_3.30.1360.20	Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase	0.9333	4	98	3.30.1360.20

ID	Description	Score	Start	End	GO Terms
AF-A0A3D5AM23-F1-model_v4	Putative pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)	1	26	96	GO:0006729 GO:0008124
AF-A0A365H715-F1-model_v4	Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD)	0.9972	1	96	GO:0006729 GO:0008124
AF-A0A2W2G190-F1-model_v4	Putative pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)	0.9958	4	97	GO:0006729 GO:0008124
AF-A0A3Q7RW02-F1-model_v4	4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96)	0.9945	26	95	GO:0006729 GO:0008124
AF-A0A6L7Y8T6-F1-model_v4	Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD)	0.9916	1	93	GO:0006729 GO:0008124

Feature Viewer

pLDDT	pTM	Quality
96.23	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F428415

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

22

111

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map