F428392

General Info

Members Datasets Scaffolds Average Seq Length
379 178 758 337

Family's Representative Sequence

Representative Sequence 3300030736|Ga0316180_1120947|Ga0316180_11209472
Length 367
Sequence MSTPWDLPDFDAHENLTFFTNPTADFKAIIAVHSTHLGPAAGGARFWHYVEDDQALTDALRLSRGMSYKNAMAGLPLGGGKTVILANKDRTKTPELLAAFGKAVDSLGGRYITAEDVGMNVTDMIEVARHTKFVAGLPVAEGQVGGDPGPHTALGVFLGIKAAVKRRLGKDKVDGLHIALQGAGSVASGVARHAAAEGARLSIADVDQARAQELAKVTDGTVVDPSEIMTLEADVLSPCALGAILTEQSIAALNVPIVAGGANNQLATPADGDRLHARGIHYAPDYVINAGGIINVSTEFLGDGGPELVRSRIEAIPQRLEQIWTESDASGRDPANVADAIAYAVALPRGSVMQEMLITPLSETSWP

Samples

Sample ID Description Type Environment
1 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
100 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
120 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
121 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
122 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
163 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
164 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
165 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
168 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
172 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
173 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
174 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
175 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
176 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
177 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
178 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 0
Isolates 2.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.11
Nodule 0
Rhizoplane 5.01
Rhizosphere 90.5
Stem 0
Stem Tuber 0.26
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316180_1120947 3300030736 Bacteria 2125
2 JGI24736J21556_1003902 3300001904 Bacteria 2567
3 JGI24740J21852_10002855 3300001979 Bacteria 7721
4 JGI24740J21852_10026340 3300001979 Bacteria 1949
5 JGI24739J22299_10007290 3300001989 Bacteria 4155
6 JGI24737J22298_10027372 3300001990 Bacteria 1798
7 JGI24735J21928_10005627 3300002067 Bacteria 4148
8 JGI24751J29686_10000176 3300002459 Bacteria 29723
9 Ga0065715_10149855 3300005293 Bacteria 1742
10 Ga0065707_10085504 3300005295 Bacteria 6102
11 Ga0070658_10025489 3300005327 Bacteria 4740
12 Ga0070658_10137135 3300005327 Bacteria 2042
13 Ga0070683_100044533 3300005329 Bacteria 4092
14 Ga0070670_100000028 3300005331 Bacteria 184816
15 Ga0070670_100297197 3300005331 Bacteria 1412
16 Ga0070666_10043830 3300005335 Bacteria 2996
17 Ga0070680_100002079 3300005336 Bacteria 14778
18 Ga0070680_100031965 3300005336 Bacteria 4233
19 Ga0068868_100218262 3300005338 Bacteria 1595
20 Ga0070660_100005283 3300005339 Bacteria 8931
21 Ga0070661_100005105 3300005344 Bacteria 9049
22 Ga0070661_100024235 3300005344 Bacteria 4352
23 Ga0070661_100028735 3300005344 Bacteria 4012
24 Ga0070661_100038122 3300005344 Bacteria 3498
25 Ga0070661_100078224 3300005344 Bacteria 2439
26 Ga0070692_10000065 3300005345 Bacteria 20952
27 Ga0070692_10103095 3300005345 Bacteria 1567
28 Ga0070668_100036787 3300005347 Bacteria 3736
29 Ga0070669_100000005 3300005353 Bacteria 309134
30 Ga0070669_100105613 3300005353 Bacteria 2131
31 Ga0070675_100474814 3300005354 Bacteria 1124
32 Ga0070671_100000327 3300005355 Bacteria 32467
33 Ga0070671_100001267 3300005355 Bacteria 18928
34 Ga0070671_100044442 3300005355 Bacteria 3692
35 Ga0070673_100166522 3300005364 Bacteria 1878
36 Ga0070673_100235822 3300005364 Bacteria 1589
37 Ga0070659_100016545 3300005366 Bacteria 5537
38 Ga0070659_100099386 3300005366 Bacteria 2340
39 Ga0070667_100004690 3300005367 Bacteria 11472
40 Ga0070714_100014757 3300005435 Bacteria 6278
41 Ga0070714_100077937 3300005435 Bacteria 2879
42 Ga0070714_100243348 3300005435 Bacteria 1661
43 Ga0070714_100435967 3300005435 Bacteria 1243
44 Ga0070663_100063708 3300005455 Bacteria 2663
45 Ga0070663_100146750 3300005455 Bacteria 1805
46 Ga0070663_100201772 3300005455 Bacteria 1552
47 Ga0070679_100015666 3300005530 Bacteria 7288
48 Ga0070679_100024300 3300005530 Bacteria 5938
49 Ga0070684_100078187 3300005535 Bacteria 2922
50 Ga0070672_100045936 3300005543 Bacteria 3382
51 Ga0070696_100004359 3300005546 Bacteria 9428
52 Ga0070696_100150521 3300005546 Bacteria 1708
53 Ga0070693_100076974 3300005547 Bacteria 1978
54 Ga0070665_100012430 3300005548 Bacteria 8582
55 Ga0070665_100130760 3300005548 Bacteria 2513
56 Ga0068855_100082775 3300005563 Bacteria 3719
57 Ga0068855_100342742 3300005563 Bacteria 1647
58 Ga0068855_100351730 3300005563 Bacteria 1623
59 Ga0070664_100008386 3300005564 Bacteria 8354
60 Ga0070664_100046783 3300005564 Bacteria 3655
61 Ga0070664_100104722 3300005564 Bacteria 2464
62 Ga0068857_100047147 3300005577 Bacteria 3825
63 Ga0068857_100369855 3300005577 Bacteria 1330
64 Ga0068854_100000334 3300005578 Bacteria 30834
65 Ga0068854_100015209 3300005578 Bacteria 5093
66 Ga0068854_100020970 3300005578 Bacteria 4428
67 Ga0068856_100238171 3300005614 Bacteria 1835
68 Ga0068856_100568035 3300005614 Bacteria 1155
69 Ga0068852_100028203 3300005616 Bacteria 4590
70 Ga0068852_100102280 3300005616 Bacteria 2588
71 Ga0068859_100034658 3300005617 Bacteria 5066
72 Ga0068859_100341080 3300005617 Bacteria 1593
73 Ga0068864_100000049 3300005618 Bacteria 143621
74 Ga0068864_100002590 3300005618 Bacteria 14935
75 Ga0068864_100080832 3300005618 Bacteria 2848
76 Ga0068864_100095884 3300005618 Bacteria 2625
77 Ga0068861_100046431 3300005719 Bacteria 3274
78 Ga0068863_100073017 3300005841 Bacteria 3246
79 Ga0068863_100401550 3300005841 Bacteria 1341
80 Ga0068858_100059351 3300005842 Bacteria 3536
81 Ga0068860_100037192 3300005843 Bacteria 4660
82 Ga0068860_100148529 3300005843 Bacteria 2256
83 Ga0068862_100000005 3300005844 Bacteria 350713
84 Ga0068862_100098364 3300005844 Bacteria 2556
85 Ga0068862_100197325 3300005844 Bacteria 1813
86 Ga0081539_10086360 3300005985 Bacteria 1633
87 Ga0097620_100034656 3300006931 Bacteria 5066
88 Ga0097620_100341096 3300006931 Bacteria 1593
89 Ga0105240_10008099 3300009093 Bacteria 15093
90 Ga0105240_10098562 3300009093 Bacteria 3559
91 Ga0105243_10036023 3300009148 Bacteria 3838
92 Ga0105248_10000135 3300009177 Bacteria 85668
93 Ga0105248_10008053 3300009177 Bacteria 11569
94 Ga0105248_10053708 3300009177 Bacteria 4520
95 Ga0105237_10108576 3300009545 Bacteria 2766
96 Ga0105239_10000279 3300010375 Bacteria 75291
97 Ga0157373_10016656 3300013100 Bacteria 5356
98 Ga0157373_10137745 3300013100 Bacteria 1716
99 Ga0157373_10254889 3300013100 Bacteria 1241
100 Ga0157371_10001787 3300013102 Bacteria 21747
101 Ga0157371_10002869 3300013102 Bacteria 16116
102 Ga0157371_10023713 3300013102 Bacteria 4486
103 Ga0157371_10068378 3300013102 Bacteria 2514
104 Ga0157371_10125064 3300013102 Bacteria 1829
105 Ga0157370_10034625 3300013104 Bacteria 4915
106 Ga0157369_10000298 3300013105 Bacteria 66393
107 Ga0157369_10014983 3300013105 Bacteria 8751
108 Ga0157369_10016508 3300013105 Bacteria 8303
109 Ga0157369_10044073 3300013105 Bacteria 4858
110 Ga0157369_10191758 3300013105 Bacteria 2147
111 Ga0157369_10534410 3300013105 Bacteria 1212
112 Ga0157374_10121723 3300013296 Bacteria 2519
113 Ga0157372_10047700 3300013307 Bacteria 4760
114 Ga0157372_10146967 3300013307 Bacteria 2718
115 Ga0157372_10245317 3300013307 Bacteria 2079
116 Ga0157372_10339444 3300013307 Bacteria 1750
117 Ga0163163_10000459 3300014325 Bacteria 37223
118 Ga0163163_10009002 3300014325 Bacteria 8895
119 Ga0157380_10000023 3300014326 Bacteria 113686
120 Ga0157380_10019519 3300014326 Bacteria 5052
121 Ga0163161_10003795 3300017792 Bacteria 10592
122 Ga0207680_10207565 3300025903 Bacteria 1338
123 Ga0207647_10026341 3300025904 Bacteria 3806
124 Ga0207647_10125894 3300025904 Bacteria 1508
125 Ga0207705_10000070 3300025909 Bacteria 130733
126 Ga0207705_10016747 3300025909 Bacteria 5249
127 Ga0207705_10063699 3300025909 Bacteria 2664
128 Ga0207707_10014507 3300025912 Bacteria 6861
129 Ga0207695_10000285 3300025913 Bacteria 125917
130 Ga0207695_10011780 3300025913 Bacteria 10560
131 Ga0207695_10034524 3300025913 Bacteria 5499
132 Ga0207671_10005417 3300025914 Bacteria 11754
133 Ga0207671_10095902 3300025914 Bacteria 2240
134 Ga0207660_10002559 3300025917 Bacteria 11948
135 Ga0207657_10001281 3300025919 Bacteria 26752
136 Ga0207657_10015911 3300025919 Bacteria 7267
137 Ga0207657_10017871 3300025919 Bacteria 6786
138 Ga0207649_10000816 3300025920 Bacteria 20025
139 Ga0207649_10007968 3300025920 Bacteria 5764
140 Ga0207649_10016899 3300025920 Bacteria 4127
141 Ga0207649_10054504 3300025920 Bacteria 2489
142 Ga0207649_10063313 3300025920 Bacteria 2334
143 Ga0207652_10022957 3300025921 Bacteria 5167
144 Ga0207652_10052153 3300025921 Bacteria 3509
145 Ga0207652_10312674 3300025921 Bacteria 1418
146 Ga0207681_10000003 3300025923 Bacteria 713245
147 Ga0207650_10000012 3300025925 Bacteria 437889
148 Ga0207687_10018842 3300025927 Bacteria 4563
149 Ga0207664_10021194 3300025929 Bacteria 4828
150 Ga0207664_10029600 3300025929 Bacteria 4172
151 Ga0207664_10374016 3300025929 Bacteria 1264
152 Ga0207644_10001320 3300025931 Bacteria 15911
153 Ga0207644_10007621 3300025931 Bacteria 7057
154 Ga0207690_10016994 3300025932 Bacteria 4436
155 Ga0207690_10080164 3300025932 Bacteria 2278
156 Ga0207690_10219096 3300025932 Bacteria 1455
157 Ga0207706_10027529 3300025933 Bacteria 5082
158 Ga0207706_10284925 3300025933 Bacteria 1441
159 Ga0207711_10000944 3300025941 Bacteria 27922
160 Ga0207711_10003334 3300025941 Bacteria 13924
161 Ga0207661_10060923 3300025944 Bacteria 3047
162 Ga0207661_10117216 3300025944 Bacteria 2262
163 Ga0207679_10005765 3300025945 Bacteria 7777
164 Ga0207679_10073085 3300025945 Bacteria 2593
165 Ga0207667_10008511 3300025949 Bacteria 12184
166 Ga0207667_10130439 3300025949 Bacteria 2589
167 Ga0207667_10267935 3300025949 Bacteria 1746
168 Ga0207667_10336462 3300025949 Bacteria 1541
169 Ga0207651_10212516 3300025960 Bacteria 1558
170 Ga0207668_10011393 3300025972 Bacteria 5401
171 Ga0207640_10000344 3300025981 Bacteria 30468
172 Ga0207640_10003657 3300025981 Bacteria 8295
173 Ga0207640_10006924 3300025981 Bacteria 6237
174 Ga0207658_10003269 3300025986 Bacteria 11518
175 Ga0207658_10424456 3300025986 Bacteria 1173
176 Ga0207703_10317188 3300026035 Bacteria 1426
177 Ga0207639_10081218 3300026041 Bacteria 2567
178 Ga0207639_10087031 3300026041 Bacteria 2489
179 Ga0207678_10002360 3300026067 Bacteria 17124
180 Ga0207678_10064511 3300026067 Bacteria 3146
181 Ga0207678_10068571 3300026067 Bacteria 3043
182 Ga0207641_10368808 3300026088 Bacteria 1372
183 Ga0207676_10000009 3300026095 Bacteria 545256
184 Ga0207676_10003937 3300026095 Bacteria 10487
185 Ga0207676_10063035 3300026095 Bacteria 2943
186 Ga0207676_10074421 3300026095 Bacteria 2736
187 Ga0207674_10004780 3300026116 Bacteria 16234
188 Ga0207674_10019152 3300026116 Bacteria 7420
189 Ga0207674_10051357 3300026116 Bacteria 4208
190 Ga0207674_10078583 3300026116 Bacteria 3304
191 Ga0207675_100002595 3300026118 Bacteria 17885
192 Ga0207675_100015841 3300026118 Bacteria 7030
193 Ga0207698_10002776 3300026142 Bacteria 10442
194 Ga0207698_10029979 3300026142 Bacteria 3905
195 Ga0207698_10035921 3300026142 Bacteria 3631
196 Ga0268266_10013502 3300028379 Bacteria 7031
197 Ga0268266_10144292 3300028379 Bacteria 2139
198 Ga0268265_10000001 3300028380 Bacteria 1230727
199 Ga0268265_10026683 3300028380 Bacteria 4112
200 Ga0268265_10042060 3300028380 Bacteria 3387
201 Ga0268264_10045042 3300028381 Bacteria 3662
202 Ga0268264_10269042 3300028381 Bacteria 1591
203 Ga0316176_1202476 3300030732 Bacteria 2469
204 Ga0316182_1088236 3300030745 Bacteria 4724
205 Ga0307408_100088749 3300031548 Bacteria 2329
206 Ga0307405_10108468 3300031731 Bacteria 1876
207 Ga0307405_10146536 3300031731 Bacteria 1654
208 Ga0307413_10001528 3300031824 Bacteria 8881
209 Ga0307413_10040978 3300031824 Bacteria 2708
210 Ga0307413_10045792 3300031824 Bacteria 2596
211 Ga0307410_10002293 3300031852 Bacteria 9183
212 Ga0307410_10002603 3300031852 Bacteria 8771
213 Ga0307410_10226766 3300031852 Bacteria 1440
214 Ga0307406_10169351 3300031901 Bacteria 1579
215 Ga0307406_10206810 3300031901 Bacteria 1449
216 Ga0307407_10006713 3300031903 Bacteria 5148
217 Ga0307407_10052405 3300031903 Bacteria 2343
218 Ga0307412_10057383 3300031911 Bacteria 2599
219 Ga0307412_10100889 3300031911 Bacteria 2041
220 Ga0307412_10133907 3300031911 Bacteria 1805
221 Ga0307409_100000498 3300031995 Bacteria 16923
222 Ga0307409_100011689 3300031995 Bacteria 5550
223 Ga0307409_100076047 3300031995 Bacteria 2691
224 Ga0307409_100239320 3300031995 Bacteria 1651
225 Ga0307409_100359712 3300031995 Bacteria 1376
226 Ga0307409_100418728 3300031995 Bacteria 1284
227 Ga0307416_100001561 3300032002 Bacteria 12546
228 Ga0307416_100047549 3300032002 Bacteria 3397
229 Ga0307414_10000443 3300032004 Bacteria 21946
230 Ga0307414_10001952 3300032004 Bacteria 10670
231 Ga0307414_10023875 3300032004 Bacteria 3887
232 Ga0307414_10037540 3300032004 Bacteria 3245
233 Ga0307414_10047039 3300032004 Bacteria 2966
234 Ga0307414_10070425 3300032004 Bacteria 2518
235 Ga0307414_10086109 3300032004 Bacteria 2317
236 Ga0307414_10156784 3300032004 Bacteria 1803
237 Ga0307411_10007325 3300032005 Bacteria 5607
238 Ga0307411_10019083 3300032005 Bacteria 3951
239 Ga0307411_10033511 3300032005 Bacteria 3186
240 Ga0307411_10092519 3300032005 Bacteria 2115
241 Ga0307411_10113809 3300032005 Bacteria 1942
242 Ga0307411_10128025 3300032005 Bacteria 1850
243 Ga0307411_10193351 3300032005 Bacteria 1555
244 Ga0307415_100002360 3300032126 Bacteria 9391
245 Ga0307415_100151798 3300032126 Bacteria 1784
246 Ga0307415_100184218 3300032126 Bacteria 1641
247 Ga0307415_100358583 3300032126 Bacteria 1230
248 Ga0373937_0003166 3300036401 Bacteria 13770
249 Ga0395899_0001078 3300037312 Bacteria 24590
250 Ga0395899_0001285 3300037312 Bacteria 21753
251 Ga0395899_0017106 3300037312 Bacteria 5524
252 Ga0395899_0028526 3300037312 Bacteria 4202
253 Ga0395899_0036267 3300037312 Bacteria 3699
254 Ga0395899_0093189 3300037312 Bacteria 2180
255 Ga0395899_0142526 3300037312 Bacteria 1704
256 Ga0395900_0002112 3300037418 Bacteria 22261
257 Ga0395900_0002381 3300037418 Bacteria 20768
258 Ga0395900_0009589 3300037418 Bacteria 9925
259 Ga0395900_0012394 3300037418 Bacteria 8719
260 Ga0395900_0017641 3300037418 Bacteria 7284
261 Ga0395900_0077982 3300037418 Bacteria 3404
262 Ga0395900_0082093 3300037418 Bacteria 3311
263 Ga0395900_0126391 3300037418 Bacteria 2622
264 Ga0395900_0264280 3300037418 Bacteria 1717
265 Ga0395900_0346527 3300037418 Bacteria 1460
266 Ga0395898_0009644 3300037466 Bacteria 10135
267 Ga0395898_0009853 3300037466 Bacteria 10014
268 Ga0395898_0025005 3300037466 Bacteria 6020
269 Ga0395898_0028721 3300037466 Bacteria 5574
270 Ga0395898_0033011 3300037466 Bacteria 5167
271 Ga0395898_0036442 3300037466 Bacteria 4884
272 Ga0395898_0046994 3300037466 Bacteria 4238
273 Ga0395905_0002129 3300037471 Bacteria 22450
274 Ga0395905_0003494 3300037471 Bacteria 16772
275 Ga0395905_0026535 3300037471 Bacteria 5461
276 Ga0395905_0068169 3300037471 Bacteria 3333
277 Ga0395905_0070587 3300037471 Bacteria 3274
278 Ga0395905_0115288 3300037471 Bacteria 2525
279 Ga0395905_0217149 3300037471 Bacteria 1790
280 Ga0395905_0226898 3300037471 Bacteria 1747
281 Ga0395905_0299065 3300037471 Bacteria 1496
282 Ga0395901_0000397 3300038443 Bacteria 51973
283 Ga0395901_0011159 3300038443 Bacteria 9104
284 Ga0395901_0013463 3300038443 Bacteria 8316
285 Ga0395901_0029355 3300038443 Bacteria 5661
286 Ga0395901_0041727 3300038443 Bacteria 4756
287 Ga0395901_0059420 3300038443 Bacteria 3977
288 Ga0395901_0065149 3300038443 Bacteria 3793
289 Ga0395901_0442674 3300038443 Bacteria 1330
290 Ga0439445_0001235 3300042004 Bacteria 5530
291 Ga0439448_0014841 3300042005 Bacteria 2354
292 Ga0439455_0040573 3300042012 Bacteria 1190
293 Ga0439458_0000236 3300042157 Bacteria 13195
294 Ga0466966_0000259 3300044684 Bacteria 35163
295 Ga0466966_0014545 3300044684 Bacteria 5208
296 Ga0466961_0006726 3300044693 Bacteria 7315
297 Ga0466963_0002356 3300044694 Bacteria 10545
298 Ga0466963_0022070 3300044694 Bacteria 4027
299 Ga0466964_0037841 3300044706 Bacteria 1939
300 Ga0466964_0060604 3300044706 Bacteria 1574
301 Ga0466971_0036498 3300044719 Bacteria 2204
302 Ga0466957_0002220 3300044842 Bacteria 10409
303 Ga0466957_0003626 3300044842 Bacteria 8508
304 Ga0466957_0020585 3300044842 Bacteria 3882
305 Ga0466959_0194051 3300045049 Bacteria 1416
306 Ga0466958_0000054 3300045836 Bacteria 34351
307 Ga0466958_0000590 3300045836 Bacteria 15450
308 Ga0466967_0000059 3300045976 Bacteria 40142
309 Ga0466967_0000801 3300045976 Bacteria 16438
310 Ga0466967_0023295 3300045976 Bacteria 5071
311 Ga0466967_0049384 3300045976 Bacteria 3679
312 Ga0466967_0066556 3300045976 Bacteria 3211
313 Ga0466967_0125225 3300045976 Bacteria 2379
314 Ga0466967_0149479 3300045976 Bacteria 2182
315 Ga0495663_0035117 3300046525 Bacteria 1504
316 Ga0495663_0045412 3300046525 Bacteria 1347
317 Ga0495609_0035322 3300046538 Bacteria 2263
318 Ga0495597_0010726 3300046542 Bacteria 4467
319 Ga0495668_0003707 3300046616 Bacteria 11250
320 Ga0495668_0009397 3300046616 Bacteria 6011
321 Ga0495668_0026507 3300046616 Bacteria 3288
322 Ga0495669_0003748 3300046684 Bacteria 6248
323 Ga0495669_0031527 3300046684 Bacteria 2328
324 Ga0495669_0031994 3300046684 Bacteria 2311
325 Ga0495669_0053911 3300046684 Bacteria 1809
326 Ga0495669_0058987 3300046684 Bacteria 1732
327 Ga0495670_0041385 3300046691 Bacteria 2299
328 Ga0495670_0119384 3300046691 Bacteria 1369
329 Ga0495670_0141672 3300046691 Bacteria 1257
330 Ga0495686_0032629 3300047472 Bacteria 3368
331 Ga0495602_0011898 3300048088 Bacteria 8976
332 Ga0496100_0003605 3300048903 Bacteria 8080
333 Ga0496101_0005969 3300048904 Bacteria 7806
334 Ga0496101_0015920 3300048904 Bacteria 5074
335 Ga0496106_0000612 3300048909 Bacteria 25476
336 Ga0496107_0000238 3300048910 Bacteria 28814
337 Ga0496108_0073582 3300048911 Bacteria 2885
338 Ga0496109_0001676 3300048912 Bacteria 18462
339 Ga0496109_0102795 3300048912 Bacteria 2652
340 Ga0496110_0009606 3300048913 Bacteria 7830
341 Ga0496110_0033790 3300048913 Bacteria 4427
342 Ga0496111_0001277 3300048914 Bacteria 14106
343 Ga0496111_0073918 3300048914 Bacteria 2482
344 Ga0496112_0003263 3300048915 Bacteria 13387
345 Ga0496112_0211385 3300048915 Bacteria 1897
346 Ga0496113_0027518 3300048916 Bacteria 4077
347 Ga0496114_0009772 3300048917 Bacteria 7621
348 Ga0496114_0017017 3300048917 Bacteria 5863
349 Ga0496115_0001778 3300048918 Bacteria 15423
350 Ga0496115_0096536 3300048918 Bacteria 2420
351 Ga0496121_0010476 3300048924 Bacteria 10450
352 Ga0496121_0019377 3300048924 Bacteria 6804
353 Ga0496126_0020862 3300048929 Bacteria 6414
354 Ga0501034_0016729 3300049571 Bacteria 7520
355 Ga0501068_0133037 3300049584 Bacteria 1556
356 Ga0501069_0097868 3300049585 Bacteria 1664
357 Ga0501070_0313168 3300049586 Bacteria 1277
358 Ga0501071_0044222 3300049587 Bacteria 3194
359 Ga0501073_0242075 3300049589 Bacteria 1246
360 Ga0501074_0065012 3300049590 Bacteria 2626
361 Ga0501074_0234827 3300049590 Bacteria 1305
362 Ga0501080_0296945 3300049742 Bacteria 1466
363 Ga0500651_0033258 3300053093 Bacteria 3252
364 Ga0500642_0001008 3300053130 Bacteria 8079
365 Ga0500655_000546 3300053133 Bacteria 7572
366 Ga0500658_0000963 3300053134 Bacteria 11749
367 Ga0500568_0003893 3300053139 Bacteria 8129
368 Ga0500590_000967 3300053148 Bacteria 11087
369 Ga0500604_0000004 3300053151 Bacteria 146374
370 Ga0500622_0027771 3300053156 Bacteria 2983
371 Ga0466962_0003813 3300061719 Bacteria 7203
372 2585260200 2582581305 Bacteria 4895574
373 2643729931 2643221541 Bacteria 5498788
374 2643949654 2643221588 Bacteria 3692460
375 2644045440 2643221606 Bacteria 5588032
376 2644392957 2643221671 Bacteria 5496681
377 2644550389 2643221699 Bacteria 5731501
378 2885428244 2885427238 Bacteria 2291351
379 2896430190 2896429255 Bacteria 2557483
380 Ga0316180_1120947
381 JGI24736J21556_1003902
382 JGI24740J21852_10002855
383 JGI24740J21852_10026340
384 JGI24739J22299_10007290
385 JGI24737J22298_10027372
386 JGI24735J21928_10005627
387 JGI24751J29686_10000176
388 Ga0065715_10149855
389 Ga0065707_10085504
390 Ga0070658_10025489
391 Ga0070658_10137135
392 Ga0070683_100044533
393 Ga0070670_100000028
394 Ga0070670_100297197
395 Ga0070666_10043830
396 Ga0070680_100002079
397 Ga0070680_100031965
398 Ga0068868_100218262
399 Ga0070660_100005283
400 Ga0070661_100005105
401 Ga0070661_100024235
402 Ga0070661_100028735
403 Ga0070661_100038122
404 Ga0070661_100078224
405 Ga0070692_10000065
406 Ga0070692_10103095
407 Ga0070668_100036787
408 Ga0070669_100000005
409 Ga0070669_100105613
410 Ga0070675_100474814
411 Ga0070671_100000327
412 Ga0070671_100001267
413 Ga0070671_100044442
414 Ga0070673_100166522
415 Ga0070673_100235822
416 Ga0070659_100016545
417 Ga0070659_100099386
418 Ga0070667_100004690
419 Ga0070714_100014757
420 Ga0070714_100077937
421 Ga0070714_100243348
422 Ga0070714_100435967
423 Ga0070663_100063708
424 Ga0070663_100146750
425 Ga0070663_100201772
426 Ga0070679_100015666
427 Ga0070679_100024300
428 Ga0070684_100078187
429 Ga0070672_100045936
430 Ga0070696_100004359
431 Ga0070696_100150521
432 Ga0070693_100076974
433 Ga0070665_100012430
434 Ga0070665_100130760
435 Ga0068855_100082775
436 Ga0068855_100342742
437 Ga0068855_100351730
438 Ga0070664_100008386
439 Ga0070664_100046783
440 Ga0070664_100104722
441 Ga0068857_100047147
442 Ga0068857_100369855
443 Ga0068854_100000334
444 Ga0068854_100015209
445 Ga0068854_100020970
446 Ga0068856_100238171
447 Ga0068856_100568035
448 Ga0068852_100028203
449 Ga0068852_100102280
450 Ga0068859_100034658
451 Ga0068859_100341080
452 Ga0068864_100000049
453 Ga0068864_100002590
454 Ga0068864_100080832
455 Ga0068864_100095884
456 Ga0068861_100046431
457 Ga0068863_100073017
458 Ga0068863_100401550
459 Ga0068858_100059351
460 Ga0068860_100037192
461 Ga0068860_100148529
462 Ga0068862_100000005
463 Ga0068862_100098364
464 Ga0068862_100197325
465 Ga0081539_10086360
466 Ga0097620_100034656
467 Ga0097620_100341096
468 Ga0105240_10008099
469 Ga0105240_10098562
470 Ga0105243_10036023
471 Ga0105248_10000135
472 Ga0105248_10008053
473 Ga0105248_10053708
474 Ga0105237_10108576
475 Ga0105239_10000279
476 Ga0157373_10016656
477 Ga0157373_10137745
478 Ga0157373_10254889
479 Ga0157371_10001787
480 Ga0157371_10002869
481 Ga0157371_10023713
482 Ga0157371_10068378
483 Ga0157371_10125064
484 Ga0157370_10034625
485 Ga0157369_10000298
486 Ga0157369_10014983
487 Ga0157369_10016508
488 Ga0157369_10044073
489 Ga0157369_10191758
490 Ga0157369_10534410
491 Ga0157374_10121723
492 Ga0157372_10047700
493 Ga0157372_10146967
494 Ga0157372_10245317
495 Ga0157372_10339444
496 Ga0163163_10000459
497 Ga0163163_10009002
498 Ga0157380_10000023
499 Ga0157380_10019519
500 Ga0163161_10003795
501 Ga0207680_10207565
502 Ga0207647_10026341
503 Ga0207647_10125894
504 Ga0207705_10000070
505 Ga0207705_10016747
506 Ga0207705_10063699
507 Ga0207707_10014507
508 Ga0207695_10000285
509 Ga0207695_10011780
510 Ga0207695_10034524
511 Ga0207671_10005417
512 Ga0207671_10095902
513 Ga0207660_10002559
514 Ga0207657_10001281
515 Ga0207657_10015911
516 Ga0207657_10017871
517 Ga0207649_10000816
518 Ga0207649_10007968
519 Ga0207649_10016899
520 Ga0207649_10054504
521 Ga0207649_10063313
522 Ga0207652_10022957
523 Ga0207652_10052153
524 Ga0207652_10312674
525 Ga0207681_10000003
526 Ga0207650_10000012
527 Ga0207687_10018842
528 Ga0207664_10021194
529 Ga0207664_10029600
530 Ga0207664_10374016
531 Ga0207644_10001320
532 Ga0207644_10007621
533 Ga0207690_10016994
534 Ga0207690_10080164
535 Ga0207690_10219096
536 Ga0207706_10027529
537 Ga0207706_10284925
538 Ga0207711_10000944
539 Ga0207711_10003334
540 Ga0207661_10060923
541 Ga0207661_10117216
542 Ga0207679_10005765
543 Ga0207679_10073085
544 Ga0207667_10008511
545 Ga0207667_10130439
546 Ga0207667_10267935
547 Ga0207667_10336462
548 Ga0207651_10212516
549 Ga0207668_10011393
550 Ga0207640_10000344
551 Ga0207640_10003657
552 Ga0207640_10006924
553 Ga0207658_10003269
554 Ga0207658_10424456
555 Ga0207703_10317188
556 Ga0207639_10081218
557 Ga0207639_10087031
558 Ga0207678_10002360
559 Ga0207678_10064511
560 Ga0207678_10068571
561 Ga0207641_10368808
562 Ga0207676_10000009
563 Ga0207676_10003937
564 Ga0207676_10063035
565 Ga0207676_10074421
566 Ga0207674_10004780
567 Ga0207674_10019152
568 Ga0207674_10051357
569 Ga0207674_10078583
570 Ga0207675_100002595
571 Ga0207675_100015841
572 Ga0207698_10002776
573 Ga0207698_10029979
574 Ga0207698_10035921
575 Ga0268266_10013502
576 Ga0268266_10144292
577 Ga0268265_10000001
578 Ga0268265_10026683
579 Ga0268265_10042060
580 Ga0268264_10045042
581 Ga0268264_10269042
582 Ga0316176_1202476
583 Ga0316182_1088236
584 Ga0307408_100088749
585 Ga0307405_10108468
586 Ga0307405_10146536
587 Ga0307413_10001528
588 Ga0307413_10040978
589 Ga0307413_10045792
590 Ga0307410_10002293
591 Ga0307410_10002603
592 Ga0307410_10226766
593 Ga0307406_10169351
594 Ga0307406_10206810
595 Ga0307407_10006713
596 Ga0307407_10052405
597 Ga0307412_10057383
598 Ga0307412_10100889
599 Ga0307412_10133907
600 Ga0307409_100000498
601 Ga0307409_100011689
602 Ga0307409_100076047
603 Ga0307409_100239320
604 Ga0307409_100359712
605 Ga0307409_100418728
606 Ga0307416_100001561
607 Ga0307416_100047549
608 Ga0307414_10000443
609 Ga0307414_10001952
610 Ga0307414_10023875
611 Ga0307414_10037540
612 Ga0307414_10047039
613 Ga0307414_10070425
614 Ga0307414_10086109
615 Ga0307414_10156784
616 Ga0307411_10007325
617 Ga0307411_10019083
618 Ga0307411_10033511
619 Ga0307411_10092519
620 Ga0307411_10113809
621 Ga0307411_10128025
622 Ga0307411_10193351
623 Ga0307415_100002360
624 Ga0307415_100151798
625 Ga0307415_100184218
626 Ga0307415_100358583
627 Ga0373937_0003166
628 Ga0395899_0001078
629 Ga0395899_0001285
630 Ga0395899_0017106
631 Ga0395899_0028526
632 Ga0395899_0036267
633 Ga0395899_0093189
634 Ga0395899_0142526
635 Ga0395900_0002112
636 Ga0395900_0002381
637 Ga0395900_0009589
638 Ga0395900_0012394
639 Ga0395900_0017641
640 Ga0395900_0077982
641 Ga0395900_0082093
642 Ga0395900_0126391
643 Ga0395900_0264280
644 Ga0395900_0346527
645 Ga0395898_0009644
646 Ga0395898_0009853
647 Ga0395898_0025005
648 Ga0395898_0028721
649 Ga0395898_0033011
650 Ga0395898_0036442
651 Ga0395898_0046994
652 Ga0395905_0002129
653 Ga0395905_0003494
654 Ga0395905_0026535
655 Ga0395905_0068169
656 Ga0395905_0070587
657 Ga0395905_0115288
658 Ga0395905_0217149
659 Ga0395905_0226898
660 Ga0395905_0299065
661 Ga0395901_0000397
662 Ga0395901_0011159
663 Ga0395901_0013463
664 Ga0395901_0029355
665 Ga0395901_0041727
666 Ga0395901_0059420
667 Ga0395901_0065149
668 Ga0395901_0442674
669 Ga0439445_0001235
670 Ga0439448_0014841
671 Ga0439455_0040573
672 Ga0439458_0000236
673 Ga0466966_0000259
674 Ga0466966_0014545
675 Ga0466961_0006726
676 Ga0466963_0002356
677 Ga0466963_0022070
678 Ga0466964_0037841
679 Ga0466964_0060604
680 Ga0466971_0036498
681 Ga0466957_0002220
682 Ga0466957_0003626
683 Ga0466957_0020585
684 Ga0466959_0194051
685 Ga0466958_0000054
686 Ga0466958_0000590
687 Ga0466967_0000059
688 Ga0466967_0000801
689 Ga0466967_0023295
690 Ga0466967_0049384
691 Ga0466967_0066556
692 Ga0466967_0125225
693 Ga0466967_0149479
694 Ga0495663_0035117
695 Ga0495663_0045412
696 Ga0495609_0035322
697 Ga0495597_0010726
698 Ga0495668_0003707
699 Ga0495668_0009397
700 Ga0495668_0026507
701 Ga0495669_0003748
702 Ga0495669_0031527
703 Ga0495669_0031994
704 Ga0495669_0053911
705 Ga0495669_0058987
706 Ga0495670_0041385
707 Ga0495670_0119384
708 Ga0495670_0141672
709 Ga0495686_0032629
710 Ga0495602_0011898
711 Ga0496100_0003605
712 Ga0496101_0005969
713 Ga0496101_0015920
714 Ga0496106_0000612
715 Ga0496107_0000238
716 Ga0496108_0073582
717 Ga0496109_0001676
718 Ga0496109_0102795
719 Ga0496110_0009606
720 Ga0496110_0033790
721 Ga0496111_0001277
722 Ga0496111_0073918
723 Ga0496112_0003263
724 Ga0496112_0211385
725 Ga0496113_0027518
726 Ga0496114_0009772
727 Ga0496114_0017017
728 Ga0496115_0001778
729 Ga0496115_0096536
730 Ga0496121_0010476
731 Ga0496121_0019377
732 Ga0496126_0020862
733 Ga0501034_0016729
734 Ga0501068_0133037
735 Ga0501069_0097868
736 Ga0501070_0313168
737 Ga0501071_0044222
738 Ga0501073_0242075
739 Ga0501074_0065012
740 Ga0501074_0234827
741 Ga0501080_0296945
742 Ga0500651_0033258
743 Ga0500642_0001008
744 Ga0500655_000546
745 Ga0500658_0000963
746 Ga0500568_0003893
747 Ga0500590_000967
748 Ga0500604_0000004
749 Ga0500622_0027771
750 Ga0466962_0003813
751 2585260200
752 2643729931
753 2643949654
754 2644045440
755 2644392957
756 2644550389
757 2885428244
758 2896430190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02812

ELFV_dehydrog_N

Glu/Leu/Phe/Val dehydrogenase, dimerisation domain

13

133

0.93

PF00208

ELFV_dehydrog

Glutamate/Leucine/Phenylalanine/Valine dehydrogenase

201

349

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vid-assembly1.cif.gz_A the crystal structure of l-leucine dehydrogenase from pseudomonas aeruginosa 0.9559 12 346
8gxd-assembly1.cif.gz_A l-leucine dehydrogenase from exiguobacterium sibiricum 0.9509 7 345
6ach-assembly1.cif.gz_A structure of nad+-bound leucine dehydrogenase from geobacillus stearothermophilus by cryo-em 0.9327 13 345
6acf-assembly1.cif.gz_A structure of leucine dehydrogenase from geobacillus stearothermophilus by cryo-em 0.9316 13 345
7vid-assembly1.cif.gz_A the crystal structure of l-leucine dehydrogenase from pseudomonas aeruginosa 0.9286 12 346
ID Description Score Start End Superfamily
1lehB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9736 146 338 3.40.50.720
5b37E02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9585 147 337 3.40.50.720
6acfA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9509 13 133 3.40.50.10860
1c1dA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9452 136 337 3.40.50.720
af_A0A0P0WM81_180_403_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9414 175 204 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A838QI03-F1-model_v4 Glu/Leu/Phe/Val dehydrogenase 0.9886 1 221 GO:0006520
GO:0016639
AF-A0A838QI03-F1-model_v4 Glu/Leu/Phe/Val dehydrogenase 0.9842 1 221 GO:0006520
GO:0016639
AF-A0A2N3AUJ4-F1-model_v4 Amino acid dehydrogenase 0.98 1 113 GO:0006520
GO:0016639
AF-A0A520I208-F1-model_v4 Amino acid dehydrogenase 0.9792 228 348 GO:0006520
GO:0016639
AF-A0A449IGD4-F1-model_v4 Glutamate/Leucine/Phenylalanine/Valine dehydrogenase (EC 1.4.1.9) 0.9774 180 344 GO:0006520
GO:0050049

Map