F428347

General Info

Members Datasets Scaffolds Average Seq Length
379 245 362 360

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10270871|Ga0105248_102708712
Length 401
Sequence LAPLVEEINSGAVRRDLVRRSQAGIGRLGPAGILAGWDRVKVMATPNLLTPGRIDGFETRNRLMMAPMTRSRALAGGVPSDLAIEYYAQRASAGIIVTEGVAPTAVGLGYARTPAIESREQIAVWKKITAAVKARGGHIFIQFMHVGRIGHSANRYTSDPLVAPSAVRANAQIWTDAHGLQDMDAPRALETSEIPGIIDGFAQATRNALEAGFDGVELHAASGYLPMQFLSTGTNQRTDGYGGSVQNRLRFVVDTLQAMIAAAGEPGKVGMKISPAIPFNDIHDDDPIETYTALVKAVAPMGLGYLHVLRTPPLPNIFEVLRPLYPGTFAVGGAFDFDSGNAAIASGLADFVVFGKPFTSNPDLAERFAGGLELTPFDATTFYTPGPKGYVDYLPAAAQSA

Samples

Sample ID Description Type Environment
1 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
2 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
3 2643221615 Nocardioides sp. Root224 Isolate Unclassified
4 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
5 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
6 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
7 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
8 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
9 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
10 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
11 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
12 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
13 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
14 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
15 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
16 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
17 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
153 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
154 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
167 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
168 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
245 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.72
Metatranscriptomes 0.79
Isolates 4.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 9.5
Nodule 0.26
Rhizoplane 2.37
Rhizosphere 73.09
Stem 0
Stem Tuber 0
Unclassified 14.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1016633 3300003771 Bacteria 2862
2 Ga0055537_1000171 3300003773 Bacteria 48534
3 Ga0055536_1005885 3300003781 Bacteria 5878
4 Ga0055536_1005907 3300003781 Bacteria 5863
5 Ga0055534_1000114 3300003784 Bacteria 59511
6 Ga0055528_1002993 3300003790 Bacteria 8747
7 Ga0055530_10000021 3300003791 Bacteria 139383
8 Ga0055530_10000071 3300003791 Bacteria 86290
9 Ga0055531_10007595 3300003794 Bacteria 5878
10 Ga0055531_10008873 3300003794 Bacteria 5224
11 Ga0055531_10016111 3300003794 Bacteria 3246
12 Ga0058692_1000231 3300003856 Bacteria 32264
13 Ga0065707_10005529 3300005295 Bacteria 5886
14 Ga0070670_100000520 3300005331 Bacteria 30844
15 Ga0070670_100217678 3300005331 Bacteria 1661
16 Ga0070677_10004592 3300005333 Bacteria 4516
17 Ga0068869_100020058 3300005334 Bacteria 4578
18 Ga0068869_100094763 3300005334 Bacteria 2251
19 Ga0070666_10000395 3300005335 Bacteria 27401
20 Ga0070666_10083864 3300005335 Bacteria 2180
21 Ga0070682_100186524 3300005337 Unclassified 1453
22 Ga0068868_100020706 3300005338 Bacteria 4947
23 Ga0068868_100316049 3300005338 Bacteria 1329
24 Ga0070661_100005136 3300005344 Bacteria 9015
25 Ga0070661_100332773 3300005344 Bacteria 1188
26 Ga0070669_100031013 3300005353 Bacteria 3859
27 Ga0070675_100003435 3300005354 Bacteria 12002
28 Ga0070675_100006494 3300005354 Bacteria 8979
29 Ga0070675_100006599 3300005354 Bacteria 8917
30 Ga0070675_100216190 3300005354 Bacteria 1668
31 Ga0070671_100175339 3300005355 Bacteria 1814
32 Ga0070674_100000462 3300005356 Bacteria 20520
33 Ga0070674_100056889 3300005356 Bacteria 2713
34 Ga0070674_100067389 3300005356 Bacteria 2517
35 Ga0070673_100007462 3300005364 Bacteria 7213
36 Ga0070688_100008268 3300005365 Bacteria 5642
37 Ga0070667_100015021 3300005367 Bacteria 6398
38 Ga0070667_100148636 3300005367 Bacteria 2056
39 Ga0070667_100260292 3300005367 Bacteria 1553
40 Ga0070709_10092056 3300005434 Bacteria 2002
41 Ga0070700_100008048 3300005441 Bacteria 5731
42 Ga0070663_100010327 3300005455 Bacteria 5820
43 Ga0070663_100043158 3300005455 Bacteria 3172
44 Ga0070678_100055764 3300005456 Bacteria 2887
45 Ga0070662_100295265 3300005457 Bacteria 1315
46 Ga0068867_100034423 3300005459 Bacteria 3671
47 Ga0070685_10023938 3300005466 Bacteria 3349
48 Ga0070698_100213529 3300005471 Bacteria 1864
49 Ga0070679_100200822 3300005530 Bacteria 1960
50 Ga0070672_100003653 3300005543 Bacteria 9992
51 Ga0070686_100012155 3300005544 Bacteria 4898
52 Ga0070686_100046938 3300005544 Bacteria 2728
53 Ga0070665_100129485 3300005548 Bacteria 2526
54 Ga0070664_100018128 3300005564 Bacteria 5778
55 Ga0068854_100043268 3300005578 Bacteria 3191
56 Ga0068854_100158127 3300005578 Bacteria 1753
57 Ga0068856_100013776 3300005614 Bacteria 7815
58 Ga0070702_100060902 3300005615 Bacteria 2196
59 Ga0068852_100053744 3300005616 Bacteria 3469
60 Ga0068859_100010127 3300005617 Bacteria 9496
61 Ga0068859_100101612 3300005617 Bacteria 2932
62 Ga0068859_100579558 3300005617 Bacteria 1216
63 Ga0068864_100032810 3300005618 Bacteria 4413
64 Ga0068866_10050730 3300005718 Bacteria 2108
65 Ga0068866_10072086 3300005718 Bacteria 1829
66 Ga0068851_10138480 3300005834 Bacteria 1322
67 Ga0068863_100000134 3300005841 Bacteria 78372
68 Ga0068863_100019902 3300005841 Bacteria 6419
69 Ga0068863_100135294 3300005841 Bacteria 2354
70 Ga0068858_100015595 3300005842 Bacteria 7147
71 Ga0068858_100087485 3300005842 Bacteria 2897
72 Ga0068860_100006539 3300005843 Bacteria 11698
73 Ga0068860_100187728 3300005843 Bacteria 1999
74 Ga0068860_100414031 3300005843 Bacteria 1335
75 Ga0068862_100420165 3300005844 Bacteria 1254
76 Ga0081455_10022732 3300005937 Bacteria 5851
77 Ga0070717_10185977 3300006028 Bacteria 1813
78 Ga0075365_10003163 3300006038 Bacteria 8401
79 Ga0075364_10034064 3300006051 Bacteria 3283
80 Ga0075364_10217271 3300006051 Bacteria 1297
81 Ga0075369_10014033 3300006186 Bacteria 3193
82 Ga0097621_100000885 3300006237 Bacteria 20990
83 Ga0097621_100281664 3300006237 Bacteria 1463
84 Ga0068871_100007946 3300006358 Bacteria 7606
85 Ga0068871_100041566 3300006358 Bacteria 3687
86 Ga0068871_100379668 3300006358 Bacteria 1255
87 Ga0068865_100126467 3300006881 Bacteria 1908
88 Ga0068865_100215444 3300006881 Bacteria 1499
89 Ga0097620_100010127 3300006931 Bacteria 9496
90 Ga0097620_100101615 3300006931 Bacteria 2932
91 Ga0097620_100579561 3300006931 Bacteria 1216
92 Ga0105251_10012796 3300009011 Bacteria 4728
93 Ga0111539_10103924 3300009094 Bacteria 3333
94 Ga0105245_10557189 3300009098 Bacteria 1169
95 Ga0105247_10062616 3300009101 Bacteria 2308
96 Ga0105243_10008675 3300009148 Bacteria 7794
97 Ga0105242_10011396 3300009176 Bacteria 6834
98 Ga0105242_10066510 3300009176 Bacteria 2977
99 Ga0105242_10094363 3300009176 Bacteria 2524
100 Ga0105248_10037401 3300009177 Bacteria 5430
101 Ga0105248_10111105 3300009177 Bacteria 3091
102 Ga0105248_10183025 3300009177 Bacteria 2361
103 Ga0105248_10270871 3300009177 Bacteria 1912
104 Ga0105248_10317993 3300009177 Bacteria 1753
105 Ga0105238_10008736 3300009551 Bacteria 10134
106 Ga0157371_10000022 3300013102 Bacteria 295029
107 Ga0157371_10055720 3300013102 Bacteria 2805
108 Ga0157370_10000178 3300013104 Bacteria 79566
109 Ga0157370_10355207 3300013104 Bacteria 1351
110 Ga0157369_10065406 3300013105 Bacteria 3913
111 Ga0157369_10203826 3300013105 Bacteria 2075
112 Ga0157374_10236217 3300013296 Bacteria 1796
113 Ga0157374_10261082 3300013296 Bacteria 1706
114 Ga0157378_10219000 3300013297 Bacteria 1809
115 Ga0163162_10034929 3300013306 Bacteria 5005
116 Ga0163162_10115172 3300013306 Bacteria 2788
117 Ga0163162_10327784 3300013306 Bacteria 1664
118 Ga0157375_10092153 3300013308 Bacteria 3093
119 Ga0163163_10012603 3300014325 Bacteria 7710
120 Ga0163163_10016341 3300014325 Bacteria 6891
121 Ga0163163_10069241 3300014325 Bacteria 3513
122 Ga0163163_10074351 3300014325 Bacteria 3390
123 Ga0157380_10048293 3300014326 Bacteria 3351
124 Ga0157380_10077131 3300014326 Bacteria 2715
125 Ga0182008_10000085 3300014497 Bacteria 72514
126 Ga0182008_10026000 3300014497 Bacteria 2970
127 Ga0157379_10032403 3300014968 Bacteria 4660
128 Ga0157379_10081173 3300014968 Bacteria 2905
129 Ga0157379_10199027 3300014968 Bacteria 1811
130 Ga0157376_10022215 3300014969 Bacteria 4941
131 Ga0157376_10172067 3300014969 Bacteria 1973
132 Ga0182007_10000004 3300015262 Bacteria 485875
133 Ga0182005_1000004 3300015265 Bacteria 609645
134 Ga0182005_1000105 3300015265 Bacteria 63475
135 Ga0163161_10000802 3300017792 Bacteria 24592
136 Ga0163161_10056648 3300017792 Bacteria 2847
137 Ga0163161_10085322 3300017792 Bacteria 2329
138 Ga0209565_1000024 3300025263 Bacteria 379907
139 Ga0209673_1000087 3300025273 Bacteria 205213
140 Ga0209130_1020197 3300025284 Bacteria 1529
141 Ga0209675_1000039 3300025291 Bacteria 247966
142 Ga0209676_1000011 3300025292 Bacteria 860463
143 Ga0209676_1000075 3300025292 Bacteria 303609
144 Ga0209676_1000536 3300025292 Bacteria 58911
145 Ga0209564_1000188 3300025295 Bacteria 144251
146 Ga0209050_1000032 3300025298 Bacteria 456335
147 Ga0209050_1000069 3300025298 Bacteria 297615
148 Ga0209050_1003970 3300025298 Bacteria 10435
149 Ga0209256_1002367 3300025299 Bacteria 15612
150 Ga0209051_1003627 3300025303 Bacteria 10009
151 Ga0209257_1000014 3300025304 Bacteria 946850
152 Ga0209257_1000571 3300025304 Bacteria 61995
153 Ga0209257_1001102 3300025304 Bacteria 35143
154 Ga0209257_1001364 3300025304 Bacteria 29523
155 Ga0207682_10019414 3300025893 Bacteria 2660
156 Ga0207682_10055586 3300025893 Bacteria 1646
157 Ga0207642_10003234 3300025899 Bacteria 5113
158 Ga0207688_10008792 3300025901 Bacteria 5494
159 Ga0207680_10000715 3300025903 Bacteria 15556
160 Ga0207699_10092327 3300025906 Bacteria 1903
161 Ga0207645_10006130 3300025907 Bacteria 8638
162 Ga0207643_10002904 3300025908 Bacteria 9258
163 Ga0207695_10129960 3300025913 Bacteria 2477
164 Ga0207671_10080966 3300025914 Bacteria 2435
165 Ga0207662_10073508 3300025918 Bacteria 2074
166 Ga0207652_10306754 3300025921 Bacteria 1433
167 Ga0207681_10023269 3300025923 Bacteria 3960
168 Ga0207681_10170524 3300025923 Bacteria 1649
169 Ga0207694_10004631 3300025924 Bacteria 10712
170 Ga0207694_10097847 3300025924 Bacteria 2322
171 Ga0207650_10028433 3300025925 Bacteria 4009
172 Ga0207659_10001962 3300025926 Bacteria 12220
173 Ga0207659_10009050 3300025926 Bacteria 6211
174 Ga0207659_10055616 3300025926 Bacteria 2831
175 Ga0207644_10017562 3300025931 Bacteria 4835
176 Ga0207644_10098795 3300025931 Bacteria 2189
177 Ga0207644_10152193 3300025931 Bacteria 1791
178 Ga0207706_10050074 3300025933 Bacteria 3692
179 Ga0207706_10071973 3300025933 Bacteria 3041
180 Ga0207686_10027966 3300025934 Bacteria 3308
181 Ga0207709_10013092 3300025935 Bacteria 4573
182 Ga0207670_10011752 3300025936 Bacteria 5095
183 Ga0207669_10004908 3300025937 Bacteria 5945
184 Ga0207669_10044079 3300025937 Bacteria 2618
185 Ga0207711_10022987 3300025941 Bacteria 5219
186 Ga0207689_10018862 3300025942 Bacteria 5817
187 Ga0207679_10073258 3300025945 Bacteria 2590
188 Ga0207667_10145531 3300025949 Bacteria 2439
189 Ga0207651_10006434 3300025960 Bacteria 6146
190 Ga0207651_10015433 3300025960 Bacteria 4438
191 Ga0207712_10116468 3300025961 Bacteria 2014
192 Ga0207640_10031438 3300025981 Unclassified 3280
193 Ga0207640_10038049 3300025981 Bacteria 3033
194 Ga0207658_10158629 3300025986 Bacteria 1852
195 Ga0207677_10022093 3300026023 Bacteria 3903
196 Ga0207677_10166155 3300026023 Bacteria 1720
197 Ga0207677_10250577 3300026023 Bacteria 1438
198 Ga0207703_10010878 3300026035 Bacteria 7095
199 Ga0207703_10329405 3300026035 Bacteria 1400
200 Ga0207639_10115147 3300026041 Bacteria 2198
201 Ga0207678_10007147 3300026067 Bacteria 9908
202 Ga0207678_10030373 3300026067 Bacteria 4718
203 Ga0207708_10034970 3300026075 Bacteria 3823
204 Ga0207708_10038977 3300026075 Bacteria 3620
205 Ga0207641_10000076 3300026088 Bacteria 145031
206 Ga0207648_10000429 3300026089 Bacteria 46380
207 Ga0207648_10020571 3300026089 Bacteria 5941
208 Ga0207676_10022401 3300026095 Bacteria 4646
209 Ga0207676_10165992 3300026095 Bacteria 1918
210 Ga0207674_10059630 3300026116 Bacteria 3860
211 Ga0207674_10077746 3300026116 Bacteria 3324
212 Ga0207675_100031820 3300026118 Bacteria 4915
213 Ga0207675_100236072 3300026118 Bacteria 1765
214 Ga0209371_1000007 3300027312 Bacteria 1050654
215 Ga0209974_10035339 3300027876 Bacteria 1660
216 Ga0268266_10022865 3300028379 Bacteria 5321
217 Ga0268266_10031449 3300028379 Bacteria 4507
218 Ga0268266_10331485 3300028379 Bacteria 1426
219 Ga0268265_10139331 3300028380 Bacteria 2029
220 Ga0268265_10385789 3300028380 Bacteria 1290
221 Ga0268264_10000334 3300028381 Bacteria 72930
222 Ga0268264_10352121 3300028381 Bacteria 1402
223 Ga0268256_1000008 3300030500 Bacteria 1050654
224 Ga0316183_1018922 3300030742 Bacteria 3230
225 Ga0316181_1266962 3300030744 Bacteria 2136
226 Ga0307415_100324026 3300032126 Bacteria 1286
227 Ga0373926_0062126 3300035083 Bacteria 1363
228 Ga0373945_0050799 3300035116 Bacteria 1525
229 Ga0373945_0108439 3300035116 Bacteria 1093
230 Ga0373956_0144764 3300035119 Unclassified 1117
231 Ga0373955_0174651 3300035172 Bacteria 1273
232 Ga0373935_0211767 3300035692 Bacteria 1343
233 Ga0373933_0031917 3300035724 Bacteria 3059
234 Ga0373947_0068593 3300035725 Bacteria 2169
235 Ga0395898_0254788 3300037466 Bacteria 1674
236 Ga0237819_01881 3300038705 Bacteria 4815
237 Ga0436361_0664887 3300039447 Bacteria 6560
238 Ga0436361_0873141 3300039447 Bacteria 19210
239 Ga0439453_0011255 3300041408 Bacteria 1489
240 Ga0439432_019851 3300042006 Bacteria 2236
241 Ga0439435_0004690 3300042436 Bacteria 2961
242 Ga0466972_0028892 3300044658 Bacteria 2732
243 Ga0466970_0035757 3300044765 Bacteria 2631
244 Ga0466970_0148934 3300044765 Bacteria 1292
245 Ga0466967_0024714 3300045976 Bacteria 4944
246 Ga0495627_008190 3300046453 Bacteria 3933
247 Ga0495638_0000550 3300046460 Bacteria 42869
248 Ga0495638_0022101 3300046460 Bacteria 4178
249 Ga0495580_0000112 3300046472 Bacteria 55094
250 Ga0495580_0001160 3300046472 Bacteria 23154
251 Ga0495664_0048998 3300046477 Bacteria 2508
252 Ga0495607_0005989 3300046501 Bacteria 8619
253 Ga0495608_0010671 3300046511 Bacteria 6408
254 Ga0495610_0000321 3300046512 Bacteria 51039
255 Ga0495610_0013886 3300046512 Bacteria 4760
256 Ga0495628_0019043 3300046516 Bacteria 5679
257 Ga0495628_0111619 3300046516 Bacteria 2102
258 Ga0495630_0070928 3300046517 Bacteria 2621
259 Ga0495631_0003054 3300046518 Bacteria 9243
260 Ga0495643_0000307 3300046522 Bacteria 67608
261 Ga0495663_0000277 3300046525 Bacteria 19707
262 Ga0495663_0002533 3300046525 Bacteria 5472
263 Ga0495666_0017195 3300046526 Bacteria 3602
264 Ga0495652_0077235 3300046529 Bacteria 2761
265 Ga0495665_0093223 3300046531 Bacteria 1583
266 Ga0495586_0036684 3300046535 Bacteria 2632
267 Ga0495633_0000854 3300046558 Bacteria 26659
268 Ga0495625_0015780 3300046660 Bacteria 5963
269 Ga0495625_0016158 3300046660 Bacteria 5880
270 Ga0495599_0013360 3300046678 Bacteria 5074
271 Ga0495646_0108133 3300046680 Bacteria 1586
272 Ga0495658_0147325 3300046683 Bacteria 1444
273 Ga0495613_0001124 3300046689 Bacteria 20369
274 Ga0495624_0000022 3300046690 Bacteria 99926
275 Ga0495660_0037571 3300046810 Bacteria 2696
276 Ga0495581_0095646 3300047315 Bacteria 1725
277 Ga0495604_0009598 3300047317 Bacteria 7654
278 Ga0495604_0062802 3300047317 Bacteria 2836
279 Ga0495674_0018946 3300047319 Bacteria 6402
280 Ga0495672_0000006 3300047320 Bacteria 589807
281 Ga0495684_0000864 3300047471 Bacteria 24618
282 Ga0495686_0005964 3300047472 Bacteria 9484
283 Ga0495686_0016803 3300047472 Bacteria 4949
284 Ga0496100_0007817 3300048903 Bacteria 5932
285 Ga0496101_0004193 3300048904 Bacteria 9034
286 Ga0496102_0082335 3300048905 Bacteria 2968
287 Ga0496103_0019271 3300048906 Bacteria 4097
288 Ga0496104_0110773 3300048907 Bacteria 2632
289 Ga0496106_0011864 3300048909 Bacteria 6433
290 Ga0496111_0067986 3300048914 Bacteria 2589
291 Ga0496112_0059027 3300048915 Bacteria 3780
292 Ga0496114_0016022 3300048917 Bacteria 6031
293 Ga0496116_0016686 3300048919 Bacteria 5736
294 Ga0496116_0017290 3300048919 Bacteria 5606
295 Ga0496117_0000227 3300048920 Bacteria 106119
296 Ga0496117_0000645 3300048920 Bacteria 56167
297 Ga0496117_0007547 3300048920 Bacteria 10596
298 Ga0496117_0152691 3300048920 Bacteria 1364
299 Ga0496118_0000338 3300048921 Bacteria 80086
300 Ga0496118_0001455 3300048921 Bacteria 35628
301 Ga0496118_0001881 3300048921 Bacteria 29958
302 Ga0496118_0008550 3300048921 Bacteria 10553
303 Ga0496118_0010547 3300048921 Bacteria 9136
304 Ga0496118_0022997 3300048921 Bacteria 5428
305 Ga0496118_0034027 3300048921 Bacteria 4168
306 Ga0496118_0082821 3300048921 Bacteria 2246
307 Ga0496118_0103481 3300048921 Bacteria 1915
308 Ga0496119_0000047 3300048922 Bacteria 188401
309 Ga0496119_0026382 3300048922 Bacteria 4030
310 Ga0496120_0000041 3300048923 Bacteria 200518
311 Ga0496120_0066642 3300048923 Bacteria 1991
312 Ga0496121_0010452 3300048924 Bacteria 10470
313 Ga0496121_0024019 3300048924 Bacteria 5843
314 Ga0496121_0139071 3300048924 Bacteria 1804
315 Ga0496122_0004491 3300048925 Bacteria 17255
316 Ga0496122_0007599 3300048925 Bacteria 11981
317 Ga0496122_0010540 3300048925 Bacteria 9500
318 Ga0496122_0031502 3300048925 Bacteria 4411
319 Ga0496123_0008919 3300048926 Bacteria 9117
320 Ga0496123_0017407 3300048926 Bacteria 5784
321 Ga0496123_0033573 3300048926 Bacteria 3691
322 Ga0496123_0048323 3300048926 Bacteria 2863
323 Ga0496124_0000009 3300048927 Bacteria 734820
324 Ga0496124_0000056 3300048927 Bacteria 250907
325 Ga0496124_0004171 3300048927 Bacteria 17039
326 Ga0496124_0007217 3300048927 Bacteria 11872
327 Ga0496124_0008201 3300048927 Bacteria 10958
328 Ga0496124_0012855 3300048927 Bacteria 8223
329 Ga0496124_0026530 3300048927 Bacteria 5220
330 Ga0496124_0304293 3300048927 Bacteria 1150
331 Ga0496125_0000197 3300048928 Bacteria 129154
332 Ga0496125_0000656 3300048928 Bacteria 57618
333 Ga0496125_0045168 3300048928 Bacteria 3712
334 Ga0496126_0000238 3300048929 Bacteria 118994
335 Ga0496126_0001426 3300048929 Bacteria 37638
336 Ga0496126_0021070 3300048929 Bacteria 6376
337 Ga0501317_007961 3300049533 Bacteria 1210
338 Ga0501318_001448 3300049534 Bacteria 1868
339 Ga0501321_002003 3300049537 Bacteria 1711
340 Ga0501036_0393054 3300049572 Bacteria 1157
341 Ga0501037_0134308 3300049573 Bacteria 1773
342 Ga0501039_0193721 3300049575 Bacteria 1598
343 Ga0501040_0118522 3300049576 Bacteria 1856
344 Ga0501046_0042799 3300049580 Bacteria 3610
345 Ga0501067_0036021 3300049583 Bacteria 2748
346 Ga0501068_0131502 3300049584 Bacteria 1565
347 Ga0501071_0171891 3300049587 Bacteria 1622
348 Ga0501072_0125842 3300049588 Bacteria 2042
349 Ga0501075_0015155 3300049591 Bacteria 5529
350 Ga0501081_0065758 3300049743 Bacteria 2521
351 Ga0501035_0152256 3300049822 Bacteria 2006
352 nmdc:mga00v17_862_c2 3300050491 Bacteria 15867
353 nmdc:mga09592_45526_c1 3300050508 Bacteria 3696
354 nmdc:mga08y16_88254_c1 3300050511 Bacteria 3232
355 nmdc:mga0sz30_13500_c1 3300050516 Bacteria 3200
356 Ga0495601_0011449 3300053077 Bacteria 5306
357 Ga0495601_0018657 3300053077 Unclassified 4224
358 Ga0495595_0123509 3300053084 Bacteria 1262
359 Ga0495619_0009486 3300053085 Bacteria 6138
360 Ga0495619_0122969 3300053085 Bacteria 1780
361 Ga0500556_0001677 3300053104 Bacteria 8570
362 Ga0500593_000867 3300053117 Bacteria 11248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0193721 Ga0501039_0193721_583_1563 318
2 3300048914 Ga0496111_0067986 Ga0496111_0067986_258_1241 319
3 3300035116 Ga0373945_0108439 Ga0373945_0108439_79_1074 329
4 3300035119 Ga0373956_0144764 Ga0373956_0144764_87_1088 331
5 3300049576 Ga0501040_0118522 Ga0501040_0118522_109_1134 333
6 3300049580 Ga0501046_0042799 Ga0501046_0042799_1581_2606 333
7 3300049588 Ga0501072_0125842 Ga0501072_0125842_566_1591 333
8 3300049591 Ga0501075_0015155 Ga0501075_0015155_2467_3492 333
9 3300049743 Ga0501081_0065758 Ga0501081_0065758_241_1266 333
10 3300005718 Ga0068866_10072086 Ga0068866_100720862 334
11 3300049537 Ga0501321_002003 Ga0501321_002003_668_1699 336
12 iso_pu_bacteria 2643221615 2644091661 345
13 iso_pu_bacteria 2643221657 2644321464 345
14 iso_pu_bacteria 2857481737 2857482743 345
15 3300006051 Ga0075364_10217271 Ga0075364_102172711 349
16 3300013308 Ga0157375_10092153 Ga0157375_100921531 349
17 3300044658 Ga0466972_0028892 Ga0466972_0028892_280_1350 349
18 3300044765 Ga0466970_0035757 Ga0466970_0035757_1350_2420 349
19 3300044765 Ga0466970_0148934 Ga0466970_0148934_59_1129 349
20 3300045976 Ga0466967_0024714 Ga0466967_0024714_1307_2377 349
21 3300053104 Ga0500556_0001677 Ga0500556_0001677_3762_4832 349
22 3300053117 Ga0500593_000867 Ga0500593_000867_220_1290 349
23 3300006051 Ga0075364_10034064 Ga0075364_100340642 350
24 3300032126 Ga0307415_100324026 Ga0307415_1003240262 350
25 3300037466 Ga0395898_0254788 Ga0395898_0254788_414_1487 350
26 3300046512 Ga0495610_0013886 Ga0495610_0013886_2592_3656 350
27 3300048906 Ga0496103_0019271 Ga0496103_0019271_128_1201 350
28 3300048907 Ga0496104_0110773 Ga0496104_0110773_431_1504 350
29 3300048909 Ga0496106_0011864 Ga0496106_0011864_287_1360 350
30 3300048915 Ga0496112_0059027 Ga0496112_0059027_920_1993 350
31 3300049533 Ga0501317_007961 Ga0501317_007961_29_1111 350
32 3300049534 Ga0501318_001448 Ga0501318_001448_31_1113 350
33 3300050491 nmdc:mga00v17_862_c2 nmdc:mga00v17_862_c2_260_1336 350
34 3300005331 Ga0070670_100217678 Ga0070670_1002176782 351
35 3300005338 Ga0068868_100020706 Ga0068868_1000207066 351
36 3300005434 Ga0070709_10092056 Ga0070709_100920562 351
37 3300005457 Ga0070662_100295265 Ga0070662_1002952651 351
38 3300005530 Ga0070679_100200822 Ga0070679_1002008222 351
39 3300005843 Ga0068860_100414031 Ga0068860_1004140311 351
40 3300005937 Ga0081455_10022732 Ga0081455_100227324 351
41 3300006028 Ga0070717_10185977 Ga0070717_101859772 351
42 3300006237 Ga0097621_100000885 Ga0097621_10000088511 351
43 3300006358 Ga0068871_100007946 Ga0068871_1000079467 351
44 3300006358 Ga0068871_100041566 Ga0068871_1000415662 351
45 3300009098 Ga0105245_10557189 Ga0105245_105571891 351
46 3300009176 Ga0105242_10011396 Ga0105242_100113963 351
47 3300009177 Ga0105248_10037401 Ga0105248_100374015 351
48 3300009177 Ga0105248_10183025 Ga0105248_101830252 351
49 3300013296 Ga0157374_10261082 Ga0157374_102610822 351
50 3300013306 Ga0163162_10115172 Ga0163162_101151723 351
51 3300014325 Ga0163163_10012603 Ga0163163_100126035 351
52 3300014969 Ga0157376_10172067 Ga0157376_101720672 351
53 3300025906 Ga0207699_10092327 Ga0207699_100923272 351
54 3300025921 Ga0207652_10306754 Ga0207652_103067542 351
55 3300025925 Ga0207650_10028433 Ga0207650_100284333 351
56 3300025931 Ga0207644_10152193 Ga0207644_101521931 351
57 3300025933 Ga0207706_10071973 Ga0207706_100719731 351
58 3300025941 Ga0207711_10022987 Ga0207711_100229875 351
59 3300026023 Ga0207677_10022093 Ga0207677_100220932 351
60 3300026089 Ga0207648_10020571 Ga0207648_100205716 351
61 3300028379 Ga0268266_10031449 Ga0268266_100314495 351
62 3300028380 Ga0268265_10139331 Ga0268265_101393311 351
63 3300028381 Ga0268264_10352121 Ga0268264_103521211 351
64 3300035083 Ga0373926_0062126 Ga0373926_0062126_190_1251 351
65 3300035116 Ga0373945_0050799 Ga0373945_0050799_187_1248 351
66 3300035172 Ga0373955_0174651 Ga0373955_0174651_46_1107 351
67 3300035692 Ga0373935_0211767 Ga0373935_0211767_257_1318 351
68 3300035724 Ga0373933_0031917 Ga0373933_0031917_790_1851 351
69 3300035725 Ga0373947_0068593 Ga0373947_0068593_176_1237 351
70 3300041408 Ga0439453_0011255 Ga0439453_0011255_163_1224 351
71 3300042436 Ga0439435_0004690 Ga0439435_0004690_435_1496 351
72 3300046477 Ga0495664_0048998 Ga0495664_0048998_947_2008 351
73 3300046511 Ga0495608_0010671 Ga0495608_0010671_984_2045 351
74 3300046516 Ga0495628_0111619 Ga0495628_0111619_596_1657 351
75 3300046531 Ga0495665_0093223 Ga0495665_0093223_355_1416 351
76 3300046535 Ga0495586_0036684 Ga0495586_0036684_1518_2579 351
77 3300046689 Ga0495613_0001124 Ga0495613_0001124_9713_10774 351
78 3300047315 Ga0495581_0095646 Ga0495581_0095646_571_1632 351
79 3300047317 Ga0495604_0062802 Ga0495604_0062802_659_1720 351
80 3300047319 Ga0495674_0018946 Ga0495674_0018946_5010_6071 351
81 3300047471 Ga0495684_0000864 Ga0495684_0000864_12897_13958 351
82 3300048903 Ga0496100_0007817 Ga0496100_0007817_1154_2215 351
83 3300048904 Ga0496101_0004193 Ga0496101_0004193_1862_2923 351
84 3300048905 Ga0496102_0082335 Ga0496102_0082335_789_1850 351
85 3300048917 Ga0496114_0016022 Ga0496114_0016022_4901_5962 351
86 3300053077 Ga0495601_0011449 Ga0495601_0011449_2599_3660 351
87 3300053077 Ga0495601_0018657 Ga0495601_0018657_1219_2280 351
88 3300053084 Ga0495595_0123509 Ga0495595_0123509_20_1081 351
89 3300053085 Ga0495619_0009486 Ga0495619_0009486_4756_5817 351
90 3300053085 Ga0495619_0122969 Ga0495619_0122969_431_1492 351
91 3300005471 Ga0070698_100213529 Ga0070698_1002135292 352
92 3300009101 Ga0105247_10062616 Ga0105247_100626162 352
93 3300014325 Ga0163163_10069241 Ga0163163_100692413 352
94 3300014968 Ga0157379_10032403 Ga0157379_100324034 352
95 3300046683 Ga0495658_0147325 Ga0495658_0147325_134_1225 352
96 3300005295 Ga0065707_10005529 Ga0065707_100055292 353
97 3300005331 Ga0070670_100000520 Ga0070670_1000005203 353
98 3300005333 Ga0070677_10004592 Ga0070677_100045923 353
99 3300005334 Ga0068869_100020058 Ga0068869_1000200583 353
100 3300005334 Ga0068869_100094763 Ga0068869_1000947631 353
101 3300005335 Ga0070666_10000395 Ga0070666_1000039520 353
102 3300005335 Ga0070666_10083864 Ga0070666_100838643 353
103 3300005337 Ga0070682_100186524 Ga0070682_1001865241 353
104 3300005338 Ga0068868_100316049 Ga0068868_1003160491 353
105 3300005344 Ga0070661_100005136 Ga0070661_1000051369 353
106 3300005344 Ga0070661_100332773 Ga0070661_1003327731 353
107 3300005353 Ga0070669_100031013 Ga0070669_1000310133 353
108 3300005354 Ga0070675_100003435 Ga0070675_1000034354 353
109 3300005354 Ga0070675_100006494 Ga0070675_1000064944 353
110 3300005354 Ga0070675_100006599 Ga0070675_1000065993 353
111 3300005355 Ga0070671_100175339 Ga0070671_1001753392 353
112 3300005356 Ga0070674_100000462 Ga0070674_1000004627 353
113 3300005356 Ga0070674_100056889 Ga0070674_1000568892 353
114 3300005356 Ga0070674_100067389 Ga0070674_1000673891 353
115 3300005365 Ga0070688_100008268 Ga0070688_1000082682 353
116 3300005367 Ga0070667_100015021 Ga0070667_1000150212 353
117 3300005367 Ga0070667_100148636 Ga0070667_1001486362 353
118 3300005367 Ga0070667_100260292 Ga0070667_1002602922 353
119 3300005441 Ga0070700_100008048 Ga0070700_1000080483 353
120 3300005455 Ga0070663_100010327 Ga0070663_1000103272 353
121 3300005455 Ga0070663_100043158 Ga0070663_1000431581 353
122 3300005456 Ga0070678_100055764 Ga0070678_1000557642 353
123 3300005459 Ga0068867_100034423 Ga0068867_1000344231 353
124 3300005466 Ga0070685_10023938 Ga0070685_100239382 353
125 3300005543 Ga0070672_100003653 Ga0070672_1000036533 353
126 3300005544 Ga0070686_100012155 Ga0070686_1000121554 353
127 3300005544 Ga0070686_100046938 Ga0070686_1000469381 353
128 3300005548 Ga0070665_100129485 Ga0070665_1001294851 353
129 3300005564 Ga0070664_100018128 Ga0070664_1000181285 353
130 3300005578 Ga0068854_100043268 Ga0068854_1000432683 353
131 3300005578 Ga0068854_100158127 Ga0068854_1001581272 353
132 3300005614 Ga0068856_100013776 Ga0068856_1000137762 353
133 3300005615 Ga0070702_100060902 Ga0070702_1000609022 353
134 3300005616 Ga0068852_100053744 Ga0068852_1000537443 353
135 3300005617 Ga0068859_100010127 Ga0068859_1000101274 353
136 3300005617 Ga0068859_100101612 Ga0068859_1001016123 353
137 3300005617 Ga0068859_100579558 Ga0068859_1005795581 353
138 3300005618 Ga0068864_100032810 Ga0068864_1000328103 353
139 3300005718 Ga0068866_10050730 Ga0068866_100507302 353
140 3300005834 Ga0068851_10138480 Ga0068851_101384802 353
141 3300005841 Ga0068863_100000134 Ga0068863_10000013463 353
142 3300005841 Ga0068863_100019902 Ga0068863_1000199026 353
143 3300005842 Ga0068858_100015595 Ga0068858_1000155953 353
144 3300005842 Ga0068858_100087485 Ga0068858_1000874851 353
145 3300005843 Ga0068860_100006539 Ga0068860_10000653911 353
146 3300005843 Ga0068860_100187728 Ga0068860_1001877283 353
147 3300005844 Ga0068862_100420165 Ga0068862_1004201651 353
148 3300006237 Ga0097621_100281664 Ga0097621_1002816641 353
149 3300006358 Ga0068871_100379668 Ga0068871_1003796681 353
150 3300006881 Ga0068865_100126467 Ga0068865_1001264672 353
151 3300006881 Ga0068865_100215444 Ga0068865_1002154442 353
152 3300006931 Ga0097620_100010127 Ga0097620_1000101274 353
153 3300006931 Ga0097620_100101615 Ga0097620_1001016153 353
154 3300006931 Ga0097620_100579561 Ga0097620_1005795611 353
155 3300009094 Ga0111539_10103924 Ga0111539_101039243 353
156 3300009148 Ga0105243_10008675 Ga0105243_100086752 353
157 3300009176 Ga0105242_10066510 Ga0105242_100665102 353
158 3300009176 Ga0105242_10094363 Ga0105242_100943632 353
159 3300009177 Ga0105248_10111105 Ga0105248_101111052 353
160 3300009177 Ga0105248_10317993 Ga0105248_103179932 353
161 3300009551 Ga0105238_10008736 Ga0105238_100087366 353
162 3300013102 Ga0157371_10055720 Ga0157371_100557202 353
163 3300013105 Ga0157369_10203826 Ga0157369_102038262 353
164 3300013296 Ga0157374_10236217 Ga0157374_102362171 353
165 3300013297 Ga0157378_10219000 Ga0157378_102190001 353
166 3300013306 Ga0163162_10034929 Ga0163162_100349291 353
167 3300013306 Ga0163162_10327784 Ga0163162_103277842 353
168 3300014325 Ga0163163_10016341 Ga0163163_100163411 353
169 3300014325 Ga0163163_10074351 Ga0163163_100743512 353
170 3300014326 Ga0157380_10048293 Ga0157380_100482932 353
171 3300014326 Ga0157380_10077131 Ga0157380_100771312 353
172 3300014968 Ga0157379_10081173 Ga0157379_100811734 353
173 3300014968 Ga0157379_10199027 Ga0157379_101990271 353
174 3300014969 Ga0157376_10022215 Ga0157376_100222155 353
175 3300025893 Ga0207682_10019414 Ga0207682_100194142 353
176 3300025893 Ga0207682_10055586 Ga0207682_100555861 353
177 3300025899 Ga0207642_10003234 Ga0207642_100032342 353
178 3300025901 Ga0207688_10008792 Ga0207688_100087923 353
179 3300025903 Ga0207680_10000715 Ga0207680_100007152 353
180 3300025907 Ga0207645_10006130 Ga0207645_100061302 353
181 3300025908 Ga0207643_10002904 Ga0207643_100029042 353
182 3300025913 Ga0207695_10129960 Ga0207695_101299602 353
183 3300025914 Ga0207671_10080966 Ga0207671_100809662 353
184 3300025918 Ga0207662_10073508 Ga0207662_100735081 353
185 3300025923 Ga0207681_10023269 Ga0207681_100232692 353
186 3300025923 Ga0207681_10170524 Ga0207681_101705241 353
187 3300025924 Ga0207694_10004631 Ga0207694_100046318 353
188 3300025924 Ga0207694_10097847 Ga0207694_100978472 353
189 3300025926 Ga0207659_10001962 Ga0207659_100019621 353
190 3300025926 Ga0207659_10009050 Ga0207659_100090503 353
191 3300025926 Ga0207659_10055616 Ga0207659_100556162 353
192 3300025931 Ga0207644_10098795 Ga0207644_100987952 353
193 3300025933 Ga0207706_10050074 Ga0207706_100500742 353
194 3300025934 Ga0207686_10027966 Ga0207686_100279662 353
195 3300025935 Ga0207709_10013092 Ga0207709_100130922 353
196 3300025936 Ga0207670_10011752 Ga0207670_100117523 353
197 3300025937 Ga0207669_10004908 Ga0207669_100049083 353
198 3300025937 Ga0207669_10044079 Ga0207669_100440793 353
199 3300025942 Ga0207689_10018862 Ga0207689_100188623 353
200 3300025945 Ga0207679_10073258 Ga0207679_100732583 353
201 3300025949 Ga0207667_10145531 Ga0207667_101455312 353
202 3300025960 Ga0207651_10006434 Ga0207651_100064342 353
203 3300025961 Ga0207712_10116468 Ga0207712_101164682 353
204 3300025981 Ga0207640_10031438 Ga0207640_100314382 353
205 3300025981 Ga0207640_10038049 Ga0207640_100380491 353
206 3300025986 Ga0207658_10158629 Ga0207658_101586292 353
207 3300026023 Ga0207677_10166155 Ga0207677_101661552 353
208 3300026023 Ga0207677_10250577 Ga0207677_102505771 353
209 3300026035 Ga0207703_10010878 Ga0207703_100108783 353
210 3300026035 Ga0207703_10329405 Ga0207703_103294051 353
211 3300026041 Ga0207639_10115147 Ga0207639_101151472 353
212 3300026067 Ga0207678_10007147 Ga0207678_100071472 353
213 3300026067 Ga0207678_10030373 Ga0207678_100303733 353
214 3300026075 Ga0207708_10034970 Ga0207708_100349703 353
215 3300026075 Ga0207708_10038977 Ga0207708_100389772 353
216 3300026088 Ga0207641_10000076 Ga0207641_1000007650 353
217 3300026089 Ga0207648_10000429 Ga0207648_100004293 353
218 3300026095 Ga0207676_10022401 Ga0207676_100224013 353
219 3300026095 Ga0207676_10165992 Ga0207676_101659921 353
220 3300026116 Ga0207674_10059630 Ga0207674_100596303 353
221 3300026116 Ga0207674_10077746 Ga0207674_100777463 353
222 3300026118 Ga0207675_100031820 Ga0207675_1000318201 353
223 3300026118 Ga0207675_100236072 Ga0207675_1002360722 353
224 3300027876 Ga0209974_10035339 Ga0209974_100353392 353
225 3300028379 Ga0268266_10022865 Ga0268266_100228651 353
226 3300028379 Ga0268266_10331485 Ga0268266_103314852 353
227 3300028380 Ga0268265_10385789 Ga0268265_103857891 353
228 3300028381 Ga0268264_10000334 Ga0268264_1000033458 353
229 3300049587 Ga0501071_0171891 Ga0501071_0171891_56_1141 353
230 3300050508 nmdc:mga09592_45526_c1 nmdc:mga09592_45526_c1_81_1166 353
231 3300050511 nmdc:mga08y16_88254_c1 nmdc:mga08y16_88254_c1_1992_3077 353
232 3300006038 Ga0075365_10003163 Ga0075365_100031637 354
233 3300049583 Ga0501067_0036021 Ga0501067_0036021_1541_2650 355
234 3300049584 Ga0501068_0131502 Ga0501068_0131502_164_1273 355
235 3300005354 Ga0070675_100216190 Ga0070675_1002161901 356
236 3300005364 Ga0070673_100007462 Ga0070673_1000074624 356
237 3300005841 Ga0068863_100135294 Ga0068863_1001352941 356
238 3300009177 Ga0105248_10270871 Ga0105248_102708712 356
239 3300025931 Ga0207644_10017562 Ga0207644_100175623 356
240 3300025960 Ga0207651_10015433 Ga0207651_100154334 356
241 3300042006 Ga0439432_019851 Ga0439432_019851_1136_2206 356
242 3300048920 Ga0496117_0152691 Ga0496117_0152691_277_1347 356
243 3300048921 Ga0496118_0001881 Ga0496118_0001881_26397_27467 356
244 3300048926 Ga0496123_0033573 Ga0496123_0033573_2474_3544 356
245 3300039447 Ga0436361_0664887 Ga0436361_0664887_1983_3077 357
246 iso_pu_bacteria 2524023210 2524469219 357
247 iso_pu_bacteria 2842757796 2842758146 357
248 3300039447 Ga0436361_0873141 Ga0436361_0873141_16309_17409 359
249 3300048927 Ga0496124_0304293 Ga0496124_0304293_36_1115 359
250 iso_pu_bacteria 2747842428 2747950488 359
251 iso_pu_bacteria 2765235840 2765579451 359
252 iso_pu_bacteria 2576861471 2578458093 360
253 iso_pu_bacteria 2852649853 2852650552 360
254 iso_pu_bacteria 2857442823 2857446063 360
255 iso_pu_bacteria 2939589442 2939593258 360
256 iso_pu_bacteria 2939622612 2939624117 360
257 iso_pu_bacteria 2941475908 2941476081 360
258 iso_pu_bacteria 2974307012 2974308635 360
259 iso_pu_bacteria 2977247770 2977249376 360
260 iso_pu_bacteria 2984514374 2984516155 360
261 3300013104 Ga0157370_10000178 Ga0157370_1000017849 361
262 3300015265 Ga0182005_1000004 Ga0182005_100000438 361
263 3300046501 Ga0495607_0005989 Ga0495607_0005989_3750_4835 361
264 3300046525 Ga0495663_0000277 Ga0495663_0000277_697_1782 361
265 3300046558 Ga0495633_0000854 Ga0495633_0000854_23944_25029 361
266 3300048921 Ga0496118_0103481 Ga0496118_0103481_394_1479 361
267 3300049572 Ga0501036_0393054 Ga0501036_0393054_53_1138 361
268 3300049573 Ga0501037_0134308 Ga0501037_0134308_315_1400 361
269 3300049822 Ga0501035_0152256 Ga0501035_0152256_652_1737 361
270 3300050516 nmdc:mga0sz30_13500_c1 nmdc:mga0sz30_13500_c1_808_1893 361
271 iso_pu_bacteria 2842780639 2842781018 362
272 3300003856 Ga0058692_1000231 Ga0058692_10002313 363
273 3300006186 Ga0075369_10014033 Ga0075369_100140333 363
274 3300013105 Ga0157369_10065406 Ga0157369_100654063 363
275 3300025292 Ga0209676_1000075 Ga0209676_1000075245 363
276 3300025298 Ga0209050_1003970 Ga0209050_10039705 363
277 3300025304 Ga0209257_1001102 Ga0209257_100110228 363
278 3300027312 Ga0209371_1000007 Ga0209371_100000727 363
279 3300030500 Ga0268256_1000008 Ga0268256_1000008923 363
280 3300038705 Ga0237819_01881 Ga0237819_01881_1520_2611 363
281 3300046472 Ga0495580_0000112 Ga0495580_0000112_36393_37508 363
282 3300046472 Ga0495580_0001160 Ga0495580_0001160_21742_22857 363
283 3300046516 Ga0495628_0019043 Ga0495628_0019043_2222_3337 363
284 3300046517 Ga0495630_0070928 Ga0495630_0070928_1247_2362 363
285 3300046526 Ga0495666_0017195 Ga0495666_0017195_186_1301 363
286 3300046529 Ga0495652_0077235 Ga0495652_0077235_1096_2211 363
287 3300046678 Ga0495599_0013360 Ga0495599_0013360_3657_4772 363
288 3300046680 Ga0495646_0108133 Ga0495646_0108133_20_1135 363
289 3300046690 Ga0495624_0000022 Ga0495624_0000022_35191_36306 363
290 3300047317 Ga0495604_0009598 Ga0495604_0009598_781_1896 363
291 3300048922 Ga0496119_0026382 Ga0496119_0026382_1535_2626 363
292 3300048923 Ga0496120_0066642 Ga0496120_0066642_670_1761 363
293 3300048925 Ga0496122_0004491 Ga0496122_0004491_1283_2377 363
294 3300048929 Ga0496126_0001426 Ga0496126_0001426_16783_17898 363
295 3300048929 Ga0496126_0021070 Ga0496126_0021070_2213_3307 363
296 3300003771 Ga0055526_1016633 Ga0055526_10166332 364
297 3300003773 Ga0055537_1000171 Ga0055537_10001712 364
298 3300003781 Ga0055536_1005885 Ga0055536_10058853 364
299 3300003781 Ga0055536_1005907 Ga0055536_10059073 364
300 3300003784 Ga0055534_1000114 Ga0055534_100011425 364
301 3300003790 Ga0055528_1002993 Ga0055528_10029933 364
302 3300003791 Ga0055530_10000021 Ga0055530_10000021123 364
303 3300003791 Ga0055530_10000071 Ga0055530_1000007151 364
304 3300003794 Ga0055531_10007595 Ga0055531_100075953 364
305 3300003794 Ga0055531_10008873 Ga0055531_100088735 364
306 3300003794 Ga0055531_10016111 Ga0055531_100161113 364
307 3300009011 Ga0105251_10012796 Ga0105251_100127961 364
308 3300013102 Ga0157371_10000022 Ga0157371_100000227 364
309 3300013104 Ga0157370_10355207 Ga0157370_103552071 364
310 3300014497 Ga0182008_10000085 Ga0182008_1000008534 364
311 3300014497 Ga0182008_10026000 Ga0182008_100260001 364
312 3300015262 Ga0182007_10000004 Ga0182007_1000000485 364
313 3300015265 Ga0182005_1000105 Ga0182005_10001054 364
314 3300017792 Ga0163161_10000802 Ga0163161_100008023 364
315 3300017792 Ga0163161_10056648 Ga0163161_100566482 364
316 3300017792 Ga0163161_10085322 Ga0163161_100853222 364
317 3300025263 Ga0209565_1000024 Ga0209565_1000024308 364
318 3300025273 Ga0209673_1000087 Ga0209673_100008725 364
319 3300025284 Ga0209130_1020197 Ga0209130_10201971 364
320 3300025291 Ga0209675_1000039 Ga0209675_1000039139 364
321 3300025292 Ga0209676_1000011 Ga0209676_1000011176 364
322 3300025292 Ga0209676_1000536 Ga0209676_10005365 364
323 3300025295 Ga0209564_1000188 Ga0209564_100018874 364
324 3300025298 Ga0209050_1000032 Ga0209050_100003255 364
325 3300025298 Ga0209050_1000069 Ga0209050_100006954 364
326 3300025299 Ga0209256_1002367 Ga0209256_10023672 364
327 3300025303 Ga0209051_1003627 Ga0209051_10036273 364
328 3300025304 Ga0209257_1000014 Ga0209257_1000014235 364
329 3300025304 Ga0209257_1000571 Ga0209257_100057154 364
330 3300025304 Ga0209257_1001364 Ga0209257_100136420 364
331 3300030742 Ga0316183_1018922 Ga0316183_10189222 364
332 3300030744 Ga0316181_1266962 Ga0316181_12669622 364
333 3300046453 Ga0495627_008190 Ga0495627_008190_1615_2712 364
334 3300046460 Ga0495638_0000550 Ga0495638_0000550_6804_7907 364
335 3300046460 Ga0495638_0022101 Ga0495638_0022101_557_1657 364
336 3300046512 Ga0495610_0000321 Ga0495610_0000321_34679_35773 364
337 3300046518 Ga0495631_0003054 Ga0495631_0003054_387_1481 364
338 3300046522 Ga0495643_0000307 Ga0495643_0000307_29550_30644 364
339 3300046525 Ga0495663_0002533 Ga0495663_0002533_1836_2939 364
340 3300046660 Ga0495625_0015780 Ga0495625_0015780_3286_4386 364
341 3300046660 Ga0495625_0016158 Ga0495625_0016158_1499_2593 364
342 3300046810 Ga0495660_0037571 Ga0495660_0037571_1127_2221 364
343 3300047320 Ga0495672_0000006 Ga0495672_0000006_59251_60345 364
344 3300047472 Ga0495686_0005964 Ga0495686_0005964_894_2003 364
345 3300047472 Ga0495686_0016803 Ga0495686_0016803_594_1688 364
346 3300048919 Ga0496116_0016686 Ga0496116_0016686_1954_3048 364
347 3300048919 Ga0496116_0017290 Ga0496116_0017290_3007_4101 364
348 3300048920 Ga0496117_0000227 Ga0496117_0000227_40205_41302 364
349 3300048920 Ga0496117_0000645 Ga0496117_0000645_40319_41419 364
350 3300048920 Ga0496117_0007547 Ga0496117_0007547_5000_6097 364
351 3300048921 Ga0496118_0000338 Ga0496118_0000338_40416_41516 364
352 3300048921 Ga0496118_0001455 Ga0496118_0001455_5528_6625 364
353 3300048921 Ga0496118_0008550 Ga0496118_0008550_5912_7009 364
354 3300048921 Ga0496118_0010547 Ga0496118_0010547_2078_3181 364
355 3300048921 Ga0496118_0022997 Ga0496118_0022997_1128_2222 364
356 3300048921 Ga0496118_0034027 Ga0496118_0034027_76_1170 364
357 3300048921 Ga0496118_0082821 Ga0496118_0082821_708_1802 364
358 3300048922 Ga0496119_0000047 Ga0496119_0000047_145996_147090 364
359 3300048923 Ga0496120_0000041 Ga0496120_0000041_58656_59750 364
360 3300048924 Ga0496121_0010452 Ga0496121_0010452_8917_10011 364
361 3300048924 Ga0496121_0024019 Ga0496121_0024019_2175_3272 364
362 3300048924 Ga0496121_0139071 Ga0496121_0139071_482_1576 364
363 3300048925 Ga0496122_0007599 Ga0496122_0007599_2644_3741 364
364 3300048925 Ga0496122_0010540 Ga0496122_0010540_6009_7106 364
365 3300048925 Ga0496122_0031502 Ga0496122_0031502_3191_4285 364
366 3300048926 Ga0496123_0008919 Ga0496123_0008919_2375_3472 364
367 3300048926 Ga0496123_0017407 Ga0496123_0017407_2175_3272 364
368 3300048926 Ga0496123_0048323 Ga0496123_0048323_1640_2734 364
369 3300048927 Ga0496124_0000009 Ga0496124_0000009_242340_243452 364
370 3300048927 Ga0496124_0000056 Ga0496124_0000056_217588_218697 364
371 3300048927 Ga0496124_0004171 Ga0496124_0004171_3039_4142 364
372 3300048927 Ga0496124_0007217 Ga0496124_0007217_4280_5380 364
373 3300048927 Ga0496124_0008201 Ga0496124_0008201_3124_4221 364
374 3300048927 Ga0496124_0012855 Ga0496124_0012855_2380_3477 364
375 3300048927 Ga0496124_0026530 Ga0496124_0026530_2441_3535 364
376 3300048928 Ga0496125_0000197 Ga0496125_0000197_59962_61056 364
377 3300048928 Ga0496125_0000656 Ga0496125_0000656_48885_49979 364
378 3300048928 Ga0496125_0045168 Ga0496125_0045168_1015_2112 364
379 3300048929 Ga0496126_0000238 Ga0496126_0000238_75425_76519 364

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00724

Oxidored_FMN

NADH:flavin oxidoreductase / NADH oxidase family

47

375

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jip-assembly1.cif.gz_A crystal structure of glycerol trinitrate reductase nera from agrobacterium radiobacter in complex with 4-hydroxybenzaldehyde 0.9763 8 358
5epd-assembly1.cif.gz_A crystal structure of glycerol trinitrate reductase xdpb from agrobacterium sp. r89-1 (apo form) 0.9741 8 359
6uff-assembly2.cif.gz_B structure of ene-reductase 1 nostocer1 from cyanobacteria 0.9647 8 358
4a3u-assembly2.cif.gz_B x-structure of the old yellow enzyme homologue from zymomonas mobilis (ncr) 0.9642 8 356
6s32-assembly3.cif.gz_C crystal structure of ene-reductase ctoye from chroococcidiopsis thermalis. 0.9638 8 358
ID Description Score Start End Superfamily
4jicB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9729 8 358 3.20.20.70
4a3uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9651 8 358 3.20.20.70
af_E9AGH7_3_365_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9639 8 358 3.20.20.70
4awuA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9575 8 358 3.20.20.70
af_E9AGH8_6_374_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.956 8 358 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A164GDP6-F1-model_v4 NADH-dependent flavin oxidoreductase yqiG-like protein 1.001 158 253 GO:0005829
GO:0010181
GO:0016491
AF-Q5H1L7-F1-model_v4 GTN reductase 0.9944 1 358 GO:0005829
GO:0010181
GO:0016491
AF-G7UWI1-F1-model_v4 GTN reductase 0.9901 2 358 GO:0005829
GO:0010181
GO:0016491
AF-A0A0C2C0X1-F1-model_v4 N-ethylmaleimide reductase 0.9874 10 358 GO:0005829
GO:0010181
GO:0016491
AF-Q5H1L7-F1-model_v4 GTN reductase 0.9862 1 358 GO:0005829
GO:0010181
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.21 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map