F428278

General Info

Members Datasets Scaffolds Average Seq Length
379 239 758 98

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100599056|Ga0070708_1005990561
Length 98
Sequence MDANAAVGSRLGVPTEKIEALNDYAKSPLFTEAEKVALEYADAITDTRRDVDDELFARLQRLYDDDTIAELTMIIAWENASSRFNRALRIPSQGFWKR

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
231 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
232 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
233 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
234 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
235 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 1.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.57
Nodule 0
Rhizoplane 0.26
Rhizosphere 82.06
Stem 0
Stem Tuber 0
Unclassified 11.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100599056 3300005445 Unclassified 1039
2 Ga0065707_10658860 3300005295 Bacteria 659
3 Ga0070658_10030576 3300005327 Bacteria 4326
4 Ga0070658_10284642 3300005327 Bacteria 1407
5 Ga0070676_10128681 3300005328 Bacteria 1598
6 Ga0070683_100138951 3300005329 Bacteria 2301
7 Ga0070683_101821711 3300005329 Bacteria 585
8 Ga0070690_100419989 3300005330 Bacteria 986
9 Ga0070690_100460350 3300005330 Bacteria 945
10 Ga0070670_101884002 3300005331 Bacteria 551
11 Ga0068869_100209086 3300005334 Bacteria 1542
12 Ga0070666_11172996 3300005335 Bacteria 572
13 Ga0070680_100041477 3300005336 Bacteria 3732
14 Ga0070682_100454323 3300005337 Bacteria 982
15 Ga0070660_100202546 3300005339 Bacteria 1610
16 Ga0070689_100157529 3300005340 Bacteria 1834
17 Ga0070691_10002110 3300005341 Bacteria 8800
18 Ga0070687_100360766 3300005343 Bacteria 941
19 Ga0070661_100105812 3300005344 Bacteria 2097
20 Ga0070692_10504136 3300005345 Unclassified 785
21 Ga0070668_100964330 3300005347 Bacteria 765
22 Ga0070669_100128243 3300005353 Bacteria 1943
23 Ga0070669_101677773 3300005353 Bacteria 554
24 Ga0070675_100101197 3300005354 Bacteria 2428
25 Ga0070675_100205983 3300005354 Bacteria 1708
26 Ga0070674_100382333 3300005356 Bacteria 1146
27 Ga0070674_100899895 3300005356 Bacteria 771
28 Ga0070673_100679993 3300005364 Unclassified 944
29 Ga0070673_102315535 3300005364 Unclassified 511
30 Ga0070688_100265210 3300005365 Bacteria 1228
31 Ga0070659_101099234 3300005366 Bacteria 701
32 Ga0070714_101340235 3300005435 Unclassified 699
33 Ga0070713_100043385 3300005436 Bacteria 3677
34 Ga0070710_10438719 3300005437 Bacteria 883
35 Ga0070701_10756356 3300005438 Bacteria 659
36 Ga0070701_10973581 3300005438 Unclassified 590
37 Ga0070705_100591629 3300005440 Bacteria 857
38 Ga0070708_100136113 3300005445 Bacteria 2276
39 Ga0070678_100220439 3300005456 Bacteria 1576
40 Ga0070681_10072175 3300005458 Bacteria 3415
41 Ga0070681_10667306 3300005458 Bacteria 955
42 Ga0070681_10753972 3300005458 Bacteria 890
43 Ga0070706_100149194 3300005467 Bacteria 2183
44 Ga0070706_100159152 3300005467 Bacteria 2108
45 Ga0070707_100154122 3300005468 Bacteria 2238
46 Ga0070707_100192203 3300005468 Unclassified 1990
47 Ga0070707_101408409 3300005468 Bacteria 664
48 Ga0070698_100009042 3300005471 Bacteria 10709
49 Ga0070698_100013297 3300005471 Bacteria 8711
50 Ga0070698_100050975 3300005471 Bacteria 4217
51 Ga0070699_100095505 3300005518 Bacteria 2603
52 Ga0070699_100190150 3300005518 Bacteria 1823
53 Ga0070699_101289516 3300005518 Unclassified 670
54 Ga0070679_100313451 3300005530 Bacteria 1518
55 Ga0070684_101901690 3300005535 Bacteria 562
56 Ga0070697_100038727 3300005536 Bacteria 3853
57 Ga0070697_100445823 3300005536 Unclassified 1127
58 Ga0070672_100911381 3300005543 Unclassified 777
59 Ga0070672_101797914 3300005543 Bacteria 551
60 Ga0070665_100132036 3300005548 Bacteria 2499
61 Ga0070665_102399934 3300005548 Bacteria 530
62 Ga0070704_101221175 3300005549 Bacteria 686
63 Ga0068855_100124715 3300005563 Bacteria 2945
64 Ga0068855_100135292 3300005563 Bacteria 2812
65 Ga0068857_100689481 3300005577 Bacteria 970
66 Ga0068857_101199181 3300005577 Unclassified 735
67 Ga0068857_101981428 3300005577 Bacteria 571
68 Ga0068854_100961911 3300005578 Unclassified 754
69 Ga0068856_100060845 3300005614 Bacteria 3730
70 Ga0068856_100528329 3300005614 Bacteria 1201
71 Ga0068856_101873185 3300005614 Bacteria 611
72 Ga0068852_100269582 3300005616 Bacteria 1638
73 Ga0068859_100714054 3300005617 Bacteria 1093
74 Ga0068859_102902336 3300005617 Bacteria 525
75 Ga0068861_102147564 3300005719 Bacteria 559
76 Ga0068851_10420757 3300005834 Bacteria 789
77 Ga0068863_101134532 3300005841 Bacteria 787
78 Ga0068858_100711104 3300005842 Bacteria 978
79 Ga0068860_100461453 3300005843 Bacteria 1264
80 Ga0068860_100473268 3300005843 Bacteria 1248
81 Ga0068860_101601119 3300005843 Bacteria 673
82 Ga0068862_100801304 3300005844 Bacteria 920
83 Ga0068862_102333761 3300005844 Bacteria 547
84 Ga0068862_102712922 3300005844 Bacteria 507
85 Ga0081455_10080451 3300005937 Bacteria 2671
86 Ga0081455_10408341 3300005937 Unclassified 940
87 Ga0081538_10238012 3300005981 Bacteria 705
88 Ga0081540_1060253 3300005983 Bacteria 1817
89 Ga0081539_10004368 3300005985 Bacteria 15741
90 Ga0070717_10103855 3300006028 Bacteria 2416
91 Ga0075365_10395334 3300006038 Bacteria 975
92 Ga0075365_11058258 3300006038 Bacteria 571
93 Ga0075363_100068734 3300006048 Bacteria 1921
94 Ga0075364_10233599 3300006051 Bacteria 1249
95 Ga0075364_11059094 3300006051 Bacteria 551
96 Ga0075432_10380821 3300006058 Bacteria 605
97 Ga0070715_10780466 3300006163 Bacteria 578
98 Ga0070716_100795078 3300006173 Unclassified 732
99 Ga0070716_101505716 3300006173 Bacteria 550
100 Ga0075362_10058356 3300006177 Bacteria 1740
101 Ga0075362_10067313 3300006177 Bacteria 1629
102 Ga0075362_10087120 3300006177 Bacteria 1446
103 Ga0075362_10128119 3300006177 Bacteria 1205
104 Ga0075362_10513633 3300006177 Bacteria 613
105 Ga0075362_10728041 3300006177 Bacteria 519
106 Ga0075367_10049902 3300006178 Bacteria 2468
107 Ga0075367_10187665 3300006178 Bacteria 1290
108 Ga0075367_10708207 3300006178 Bacteria 640
109 Ga0075369_10046501 3300006186 Bacteria 1868
110 Ga0075369_10052563 3300006186 Bacteria 1766
111 Ga0075369_10056261 3300006186 Bacteria 1710
112 Ga0075369_10089583 3300006186 Bacteria 1372
113 Ga0075369_10249077 3300006186 Bacteria 825
114 Ga0075366_10092140 3300006195 Bacteria 1816
115 Ga0075366_10124129 3300006195 Bacteria 1557
116 Ga0075366_10211490 3300006195 Bacteria 1181
117 Ga0075366_10486269 3300006195 Bacteria 763
118 Ga0075366_10891593 3300006195 Bacteria 554
119 Ga0097621_100402472 3300006237 Bacteria 1226
120 Ga0075370_10130076 3300006353 Bacteria 1468
121 Ga0075370_10383857 3300006353 Bacteria 842
122 Ga0075428_100011832 3300006844 Bacteria 9712
123 Ga0075428_102536211 3300006844 Bacteria 525
124 Ga0075431_100014833 3300006847 Bacteria 7889
125 Ga0075429_100049291 3300006880 Bacteria 3662
126 Ga0097620_100714120 3300006931 Bacteria 1093
127 Ga0097620_102901234 3300006931 Bacteria 525
128 Ga0075435_100547340 3300007076 Bacteria 1002
129 Ga0099794_10014510 3300007265 Bacteria 3453
130 Ga0099794_10121671 3300007265 Bacteria 1313
131 Ga0099794_10380824 3300007265 Bacteria 736
132 Ga0099795_10135642 3300007788 Bacteria 997
133 Ga0099795_10593032 3300007788 Bacteria 526
134 Ga0105250_10464130 3300009092 Unclassified 570
135 Ga0105240_10072506 3300009093 Bacteria 4256
136 Ga0105240_10184979 3300009093 Bacteria 2455
137 Ga0105240_10258293 3300009093 Unclassified 2011
138 Ga0105240_12228197 3300009093 Bacteria 568
139 Ga0111539_10814683 3300009094 Bacteria 1086
140 Ga0105245_11750038 3300009098 Unclassified 674
141 Ga0114129_10016121 3300009147 Bacteria 10631
142 Ga0114129_11843696 3300009147 Bacteria 734
143 Ga0105248_11722274 3300009177 Bacteria 711
144 Ga0105237_10285738 3300009545 Bacteria 1652
145 Ga0105238_10770951 3300009551 Bacteria 976
146 Ga0105249_10276840 3300009553 Bacteria 1674
147 Ga0105249_11035569 3300009553 Bacteria 890
148 Ga0105249_11285559 3300009553 Bacteria 803
149 Ga0105035_117103 3300009988 Bacteria 674
150 Ga0105035_124676 3300009988 Bacteria 578
151 Ga0099796_10389592 3300010159 Bacteria 609
152 Ga0099796_10432164 3300010159 Bacteria 583
153 Ga0105239_10915333 3300010375 Bacteria 1007
154 Ga0105246_10579187 3300011119 Bacteria 966
155 Ga0105246_10859260 3300011119 Bacteria 810
156 Ga0157373_11258180 3300013100 Bacteria 559
157 Ga0157371_10372624 3300013102 Unclassified 1042
158 Ga0157370_10574871 3300013104 Bacteria 1033
159 Ga0157370_12107749 3300013104 Bacteria 505
160 Ga0157369_10859500 3300013105 Unclassified 931
161 Ga0157374_11697751 3300013296 Unclassified 656
162 Ga0157378_10756120 3300013297 Bacteria 995
163 Ga0163162_10953482 3300013306 Unclassified 969
164 Ga0163162_12665097 3300013306 Bacteria 575
165 Ga0163162_12725863 3300013306 Unclassified 569
166 Ga0163162_13408950 3300013306 Bacteria 507
167 Ga0157372_10366536 3300013307 Bacteria 1679
168 Ga0157372_10504611 3300013307 Bacteria 1410
169 Ga0157375_13329082 3300013308 Bacteria 536
170 Ga0157380_10989244 3300014326 Bacteria 874
171 Ga0157377_11467160 3300014745 Archaea 541
172 Ga0157376_10354925 3300014969 Bacteria 1404
173 Ga0197907_10548203 3300020069 Unclassified 832
174 Ga0197907_10638608 3300020069 Unclassified 585
175 Ga0206352_10481671 3300020078 Unclassified 508
176 Ga0206352_10737638 3300020078 Unclassified 592
177 Ga0213874_10140661 3300021377 Bacteria 835
178 Ga0207426_1009831 3300025302 Bacteria 3751
179 Ga0207426_1012188 3300025302 Bacteria 3241
180 Ga0207697_10400841 3300025315 Bacteria 609
181 Ga0207692_10981249 3300025898 Bacteria 557
182 Ga0207688_10516208 3300025901 Unclassified 749
183 Ga0207680_10425658 3300025903 Bacteria 940
184 Ga0207680_10977965 3300025903 Bacteria 606
185 Ga0207685_10212793 3300025905 Bacteria 915
186 Ga0207705_10012865 3300025909 Bacteria 6041
187 Ga0207684_10106983 3300025910 Bacteria 2393
188 Ga0207684_10253421 3300025910 Bacteria 1518
189 Ga0207707_10007866 3300025912 Bacteria 9269
190 Ga0207707_10526820 3300025912 Bacteria 1006
191 Ga0207707_10589466 3300025912 Archaea 942
192 Ga0207707_11504047 3300025912 Bacteria 533
193 Ga0207663_10459288 3300025916 Bacteria 983
194 Ga0207662_10335755 3300025918 Bacteria 1012
195 Ga0207657_10254271 3300025919 Bacteria 1400
196 Ga0207652_10124906 3300025921 Bacteria 2291
197 Ga0207652_10484905 3300025921 Bacteria 1113
198 Ga0207646_10020651 3300025922 Bacteria 6100
199 Ga0207681_10138089 3300025923 Bacteria 1812
200 Ga0207681_11275119 3300025923 Bacteria 617
201 Ga0207694_10093440 3300025924 Bacteria 2376
202 Ga0207659_10176075 3300025926 Bacteria 1691
203 Ga0207709_10475157 3300025935 Unclassified 971
204 Ga0207670_10024775 3300025936 Bacteria 3755
205 Ga0207670_11428481 3300025936 Bacteria 588
206 Ga0207669_10257612 3300025937 Bacteria 1303
207 Ga0207665_10501505 3300025939 Bacteria 938
208 Ga0207691_10519981 3300025940 Bacteria 1010
209 Ga0207691_10818564 3300025940 Bacteria 782
210 Ga0207711_10866205 3300025941 Bacteria 840
211 Ga0207661_10421408 3300025944 Bacteria 1212
212 Ga0207661_11509801 3300025944 Bacteria 616
213 Ga0207661_11802360 3300025944 Bacteria 557
214 Ga0207667_10143469 3300025949 Bacteria 2458
215 Ga0207667_10280924 3300025949 Bacteria 1701
216 Ga0207667_10401871 3300025949 Bacteria 1395
217 Ga0207651_11511586 3300025960 Bacteria 605
218 Ga0207712_10309190 3300025961 Bacteria 1300
219 Ga0207712_10803943 3300025961 Bacteria 827
220 Ga0207668_10671446 3300025972 Unclassified 909
221 Ga0207640_10511592 3300025981 Bacteria 1002
222 Ga0207658_10926719 3300025986 Unclassified 794
223 Ga0207677_10423815 3300026023 Bacteria 1134
224 Ga0207677_10908525 3300026023 Bacteria 794
225 Ga0207677_11733747 3300026023 Unclassified 579
226 Ga0207703_11105106 3300026035 Bacteria 762
227 Ga0207639_11738235 3300026041 Bacteria 584
228 Ga0207639_12101626 3300026041 Bacteria 526
229 Ga0207708_10246994 3300026075 Bacteria 1437
230 Ga0207702_10431780 3300026078 Bacteria 1275
231 Ga0207702_10773921 3300026078 Bacteria 948
232 Ga0207702_11508897 3300026078 Unclassified 666
233 Ga0207641_12270094 3300026088 Bacteria 542
234 Ga0207674_10097024 3300026116 Bacteria 2932
235 Ga0207674_10630532 3300026116 Bacteria 1035
236 Ga0207675_100880957 3300026118 Bacteria 911
237 Ga0207675_101418289 3300026118 Bacteria 715
238 Ga0207683_10717142 3300026121 Bacteria 927
239 Ga0207698_12283020 3300026142 Bacteria 553
240 Ga0207698_12517639 3300026142 Unclassified 525
241 Ga0209588_1063429 3300027671 Unclassified 1194
242 Ga0209971_1189990 3300027682 Bacteria 506
243 Ga0207428_10886199 3300027907 Bacteria 631
244 Ga0268266_10615368 3300028379 Bacteria 1044
245 Ga0268266_11024147 3300028379 Bacteria 799
246 Ga0268265_10289561 3300028380 Bacteria 1470
247 Ga0268265_10452217 3300028380 Bacteria 1200
248 Ga0268264_11059220 3300028381 Bacteria 819
249 Ga0265332_10363390 3300031238 Bacteria 597
250 Ga0265329_10166654 3300031242 Bacteria 718
251 Ga0265340_10149706 3300031247 Bacteria 1064
252 Ga0265316_10125057 3300031344 Bacteria 1940
253 Ga0307408_100331839 3300031548 Bacteria 1285
254 Ga0307408_101304805 3300031548 Unclassified 680
255 Ga0307412_10741537 3300031911 Bacteria 847
256 Ga0307412_10960981 3300031911 Bacteria 752
257 Ga0307416_101575167 3300032002 Bacteria 762
258 Ga0307416_103102296 3300032002 Bacteria 556
259 Ga0307411_10704924 3300032005 Bacteria 880
260 Ga0373930_0098864 3300034816 Bacteria 692
261 Ga0373940_0126085 3300035088 Bacteria 798
262 Ga0373923_0520936 3300035111 Bacteria 581
263 Ga0373941_0256307 3300035115 Bacteria 685
264 Ga0373931_0078669 3300035691 Bacteria 1815
265 Ga0373931_1291596 3300035691 Bacteria 502
266 Ga0373935_0401311 3300035692 Bacteria 985
267 Ga0373927_0078409 3300035695 Bacteria 2140
268 Ga0373927_0257780 3300035695 Bacteria 1147
269 Ga0373927_0765984 3300035695 Bacteria 638
270 Ga0373927_1076769 3300035695 Bacteria 530
271 Ga0373933_0121865 3300035724 Bacteria 1634
272 Ga0373933_0777117 3300035724 Bacteria 630
273 Ga0373947_0839086 3300035725 Unclassified 627
274 Ga0373937_0515006 3300036401 Bacteria 1137
275 Ga0373925_0665813 3300037068 Bacteria 858
276 Ga0373925_0832499 3300037068 Bacteria 761
277 Ga0395899_0017925 3300037312 Bacteria 5387
278 Ga0395899_0065306 3300037312 Bacteria 2674
279 Ga0395899_0114713 3300037312 Bacteria 1934
280 Ga0395900_0018858 3300037418 Bacteria 7036
281 Ga0395900_0105201 3300037418 Bacteria 2899
282 Ga0395900_0173100 3300037418 Bacteria 2196
283 Ga0395898_0048157 3300037466 Bacteria 4181
284 Ga0395905_1834928 3300037471 Bacteria 512
285 Ga0436364_0264880 3300037853 Unclassified 756
286 Ga0395901_0038109 3300038443 Bacteria 4972
287 Ga0395901_0094346 3300038443 Bacteria 3135
288 Ga0395901_0193519 3300038443 Bacteria 2132
289 Ga0436365_0302011 3300039437 Bacteria 539
290 Ga0436360_0210056 3300039438 Bacteria 752
291 Ga0436360_0923341 3300039438 Bacteria 4418
292 Ga0436361_0969244 3300039447 Bacteria 716
293 Ga0436363_0169855 3300039450 Bacteria 671
294 Ga0436363_0610712 3300039450 Bacteria 588
295 Ga0436363_0788255 3300039450 Unclassified 835
296 Ga0436363_1426608 3300039450 Bacteria 3018
297 Ga0436362_0166010 3300039453 Bacteria 739
298 Ga0436362_0754246 3300039453 Bacteria 800
299 Ga0439431_0123643 3300041997 Bacteria 723
300 Ga0439448_0067766 3300042005 Bacteria 1186
301 Ga0466963_0012521 3300044694 Bacteria 5195
302 Ga0466963_0037138 3300044694 Bacteria 3180
303 Ga0466964_0059330 3300044706 Bacteria 1589
304 Ga0466964_0288996 3300044706 Bacteria 822
305 Ga0466971_0436682 3300044719 Bacteria 641
306 Ga0451576_0768435 3300045051 Bacteria 1012
307 Ga0466958_0170901 3300045836 Bacteria 1376
308 Ga0466967_0007238 3300045976 Bacteria 7978
309 Ga0466967_0081002 3300045976 Bacteria 2931
310 Ga0495592_0061338 3300046454 Bacteria 2764
311 Ga0495603_0631065 3300046455 Bacteria 613
312 Ga0495639_0330921 3300046475 Bacteria 763
313 Ga0495594_0699236 3300046499 Bacteria 573
314 Ga0495630_0977173 3300046517 Unclassified 644
315 Ga0495598_0287413 3300046537 Bacteria 619
316 Ga0495658_0994493 3300046683 Unclassified 536
317 Ga0495674_1406430 3300047319 Bacteria 520
318 Ga0495602_0394949 3300048088 Bacteria 988
319 Ga0496112_0875111 3300048915 Bacteria 821
320 Ga0496126_0132111 3300048929 Bacteria 2156
321 Ga0501033_0266034 3300049570 Bacteria 1213
322 Ga0501034_0001860 3300049571 Bacteria 26767
323 Ga0501034_0043665 3300049571 Bacteria 4535
324 Ga0501034_0366970 3300049571 Bacteria 1366
325 Ga0501038_1235136 3300049574 Unclassified 542
326 Ga0501041_0558859 3300049577 Bacteria 729
327 Ga0501047_0912021 3300049581 Bacteria 692
328 Ga0501048_0411537 3300049582 Bacteria 967
329 Ga0501068_0003738 3300049584 Bacteria 8233
330 Ga0501068_0746548 3300049584 Bacteria 641
331 Ga0501070_1519914 3300049586 Bacteria 506
332 Ga0501071_0760505 3300049587 Bacteria 747
333 Ga0501072_1157303 3300049588 Bacteria 601
334 Ga0501235_076229 3300049669 Bacteria 798
335 Ga0501079_0379404 3300049741 Bacteria 1108
336 Ga0501081_0138554 3300049743 Bacteria 1743
337 Ga0501083_0880218 3300049744 Bacteria 583
338 Ga0501264_035213 3300049761 Unclassified 593
339 Ga0501035_1203439 3300049822 Bacteria 588
340 Ga0501044_0028843 3300049823 Bacteria 5854
341 Ga0501044_0176730 3300049823 Bacteria 2104
342 Ga0501045_0469960 3300049824 Bacteria 935
343 nmdc:mga03683_33564_c1 3300050489 Bacteria 2072
344 nmdc:mga03683_471445_c1 3300050489 Bacteria 606
345 nmdc:mga03683_549767_c1 3300050489 Unclassified 562
346 nmdc:mga03683_78107_c1 3300050489 Bacteria 1425
347 nmdc:mga03683_96998_c1 3300050489 Bacteria 1292
348 nmdc:mga03n38_343983_c1 3300050490 Bacteria 810
349 nmdc:mga00v17_271053_c1 3300050491 Bacteria 1101
350 nmdc:mga00v17_302694_c1 3300050491 Bacteria 1038
351 nmdc:mga0yw44_1194297_c1 3300050492 Bacteria 513
352 nmdc:mga0yw44_355987_c1 3300050492 Bacteria 986
353 nmdc:mga0yw44_456890_c1 3300050492 Bacteria 866
354 nmdc:mga0yw44_56858_c1 3300050492 Bacteria 2385
355 nmdc:mga0yw44_773910_c1 3300050492 Bacteria 652
356 nmdc:mga0k408_189649_c1 3300050493 Bacteria 1226
357 nmdc:mga0k408_5325_c1 3300050493 Bacteria 4981
358 nmdc:mga0k408_664981_c1 3300050493 Bacteria 612
359 nmdc:mga0k408_83521_c1 3300050493 Bacteria 1872
360 nmdc:mga06z11_168552_c1 3300050494 Bacteria 1256
361 nmdc:mga06z11_60276_c1 3300050494 Bacteria 1975
362 nmdc:mga06z11_699731_c1 3300050494 Bacteria 617
363 nmdc:mga06z11_892126_c1 3300050494 Bacteria 542
364 nmdc:mga07m45_2469_c1 3300050496 Bacteria 6120
365 nmdc:mga05p37_810665_c1 3300050507 Bacteria 1023
366 nmdc:mga09592_70310_c1 3300050508 Bacteria 2970
367 nmdc:mga08y16_1079047_c1 3300050511 Bacteria 779
368 nmdc:mga0sz30_407492_c1 3300050516 Bacteria 609
369 nmdc:mga0sz30_421_c2 3300050516 Bacteria 9052
370 Ga0495612_0369669 3300053078 Bacteria 649
371 Ga0500644_0125776 3300053088 Bacteria 1004
372 Ga0500583_0367530 3300053092 Bacteria 695
373 Ga0500641_0001051 3300053096 Bacteria 9840
374 Ga0500555_119576 3300053103 Bacteria 659
375 Ga0500655_023393 3300053133 Bacteria 1167
376 Ga0500616_0003370 3300053153 Bacteria 12275
377 Ga0500552_001106 3300053733 Bacteria 2552
378 Ga0501084_0530377 3300054114 Bacteria 995
379 Ga0530510_0338553 3300061734 Bacteria 1129
380 Ga0070708_100599056
381 Ga0065707_10658860
382 Ga0070658_10030576
383 Ga0070658_10284642
384 Ga0070676_10128681
385 Ga0070683_100138951
386 Ga0070683_101821711
387 Ga0070690_100419989
388 Ga0070690_100460350
389 Ga0070670_101884002
390 Ga0068869_100209086
391 Ga0070666_11172996
392 Ga0070680_100041477
393 Ga0070682_100454323
394 Ga0070660_100202546
395 Ga0070689_100157529
396 Ga0070691_10002110
397 Ga0070687_100360766
398 Ga0070661_100105812
399 Ga0070692_10504136
400 Ga0070668_100964330
401 Ga0070669_100128243
402 Ga0070669_101677773
403 Ga0070675_100101197
404 Ga0070675_100205983
405 Ga0070674_100382333
406 Ga0070674_100899895
407 Ga0070673_100679993
408 Ga0070673_102315535
409 Ga0070688_100265210
410 Ga0070659_101099234
411 Ga0070714_101340235
412 Ga0070713_100043385
413 Ga0070710_10438719
414 Ga0070701_10756356
415 Ga0070701_10973581
416 Ga0070705_100591629
417 Ga0070708_100136113
418 Ga0070678_100220439
419 Ga0070681_10072175
420 Ga0070681_10667306
421 Ga0070681_10753972
422 Ga0070706_100149194
423 Ga0070706_100159152
424 Ga0070707_100154122
425 Ga0070707_100192203
426 Ga0070707_101408409
427 Ga0070698_100009042
428 Ga0070698_100013297
429 Ga0070698_100050975
430 Ga0070699_100095505
431 Ga0070699_100190150
432 Ga0070699_101289516
433 Ga0070679_100313451
434 Ga0070684_101901690
435 Ga0070697_100038727
436 Ga0070697_100445823
437 Ga0070672_100911381
438 Ga0070672_101797914
439 Ga0070665_100132036
440 Ga0070665_102399934
441 Ga0070704_101221175
442 Ga0068855_100124715
443 Ga0068855_100135292
444 Ga0068857_100689481
445 Ga0068857_101199181
446 Ga0068857_101981428
447 Ga0068854_100961911
448 Ga0068856_100060845
449 Ga0068856_100528329
450 Ga0068856_101873185
451 Ga0068852_100269582
452 Ga0068859_100714054
453 Ga0068859_102902336
454 Ga0068861_102147564
455 Ga0068851_10420757
456 Ga0068863_101134532
457 Ga0068858_100711104
458 Ga0068860_100461453
459 Ga0068860_100473268
460 Ga0068860_101601119
461 Ga0068862_100801304
462 Ga0068862_102333761
463 Ga0068862_102712922
464 Ga0081455_10080451
465 Ga0081455_10408341
466 Ga0081538_10238012
467 Ga0081540_1060253
468 Ga0081539_10004368
469 Ga0070717_10103855
470 Ga0075365_10395334
471 Ga0075365_11058258
472 Ga0075363_100068734
473 Ga0075364_10233599
474 Ga0075364_11059094
475 Ga0075432_10380821
476 Ga0070715_10780466
477 Ga0070716_100795078
478 Ga0070716_101505716
479 Ga0075362_10058356
480 Ga0075362_10067313
481 Ga0075362_10087120
482 Ga0075362_10128119
483 Ga0075362_10513633
484 Ga0075362_10728041
485 Ga0075367_10049902
486 Ga0075367_10187665
487 Ga0075367_10708207
488 Ga0075369_10046501
489 Ga0075369_10052563
490 Ga0075369_10056261
491 Ga0075369_10089583
492 Ga0075369_10249077
493 Ga0075366_10092140
494 Ga0075366_10124129
495 Ga0075366_10211490
496 Ga0075366_10486269
497 Ga0075366_10891593
498 Ga0097621_100402472
499 Ga0075370_10130076
500 Ga0075370_10383857
501 Ga0075428_100011832
502 Ga0075428_102536211
503 Ga0075431_100014833
504 Ga0075429_100049291
505 Ga0097620_100714120
506 Ga0097620_102901234
507 Ga0075435_100547340
508 Ga0099794_10014510
509 Ga0099794_10121671
510 Ga0099794_10380824
511 Ga0099795_10135642
512 Ga0099795_10593032
513 Ga0105250_10464130
514 Ga0105240_10072506
515 Ga0105240_10184979
516 Ga0105240_10258293
517 Ga0105240_12228197
518 Ga0111539_10814683
519 Ga0105245_11750038
520 Ga0114129_10016121
521 Ga0114129_11843696
522 Ga0105248_11722274
523 Ga0105237_10285738
524 Ga0105238_10770951
525 Ga0105249_10276840
526 Ga0105249_11035569
527 Ga0105249_11285559
528 Ga0105035_117103
529 Ga0105035_124676
530 Ga0099796_10389592
531 Ga0099796_10432164
532 Ga0105239_10915333
533 Ga0105246_10579187
534 Ga0105246_10859260
535 Ga0157373_11258180
536 Ga0157371_10372624
537 Ga0157370_10574871
538 Ga0157370_12107749
539 Ga0157369_10859500
540 Ga0157374_11697751
541 Ga0157378_10756120
542 Ga0163162_10953482
543 Ga0163162_12665097
544 Ga0163162_12725863
545 Ga0163162_13408950
546 Ga0157372_10366536
547 Ga0157372_10504611
548 Ga0157375_13329082
549 Ga0157380_10989244
550 Ga0157377_11467160
551 Ga0157376_10354925
552 Ga0197907_10548203
553 Ga0197907_10638608
554 Ga0206352_10481671
555 Ga0206352_10737638
556 Ga0213874_10140661
557 Ga0207426_1009831
558 Ga0207426_1012188
559 Ga0207697_10400841
560 Ga0207692_10981249
561 Ga0207688_10516208
562 Ga0207680_10425658
563 Ga0207680_10977965
564 Ga0207685_10212793
565 Ga0207705_10012865
566 Ga0207684_10106983
567 Ga0207684_10253421
568 Ga0207707_10007866
569 Ga0207707_10526820
570 Ga0207707_10589466
571 Ga0207707_11504047
572 Ga0207663_10459288
573 Ga0207662_10335755
574 Ga0207657_10254271
575 Ga0207652_10124906
576 Ga0207652_10484905
577 Ga0207646_10020651
578 Ga0207681_10138089
579 Ga0207681_11275119
580 Ga0207694_10093440
581 Ga0207659_10176075
582 Ga0207709_10475157
583 Ga0207670_10024775
584 Ga0207670_11428481
585 Ga0207669_10257612
586 Ga0207665_10501505
587 Ga0207691_10519981
588 Ga0207691_10818564
589 Ga0207711_10866205
590 Ga0207661_10421408
591 Ga0207661_11509801
592 Ga0207661_11802360
593 Ga0207667_10143469
594 Ga0207667_10280924
595 Ga0207667_10401871
596 Ga0207651_11511586
597 Ga0207712_10309190
598 Ga0207712_10803943
599 Ga0207668_10671446
600 Ga0207640_10511592
601 Ga0207658_10926719
602 Ga0207677_10423815
603 Ga0207677_10908525
604 Ga0207677_11733747
605 Ga0207703_11105106
606 Ga0207639_11738235
607 Ga0207639_12101626
608 Ga0207708_10246994
609 Ga0207702_10431780
610 Ga0207702_10773921
611 Ga0207702_11508897
612 Ga0207641_12270094
613 Ga0207674_10097024
614 Ga0207674_10630532
615 Ga0207675_100880957
616 Ga0207675_101418289
617 Ga0207683_10717142
618 Ga0207698_12283020
619 Ga0207698_12517639
620 Ga0209588_1063429
621 Ga0209971_1189990
622 Ga0207428_10886199
623 Ga0268266_10615368
624 Ga0268266_11024147
625 Ga0268265_10289561
626 Ga0268265_10452217
627 Ga0268264_11059220
628 Ga0265332_10363390
629 Ga0265329_10166654
630 Ga0265340_10149706
631 Ga0265316_10125057
632 Ga0307408_100331839
633 Ga0307408_101304805
634 Ga0307412_10741537
635 Ga0307412_10960981
636 Ga0307416_101575167
637 Ga0307416_103102296
638 Ga0307411_10704924
639 Ga0373930_0098864
640 Ga0373940_0126085
641 Ga0373923_0520936
642 Ga0373941_0256307
643 Ga0373931_0078669
644 Ga0373931_1291596
645 Ga0373935_0401311
646 Ga0373927_0078409
647 Ga0373927_0257780
648 Ga0373927_0765984
649 Ga0373927_1076769
650 Ga0373933_0121865
651 Ga0373933_0777117
652 Ga0373947_0839086
653 Ga0373937_0515006
654 Ga0373925_0665813
655 Ga0373925_0832499
656 Ga0395899_0017925
657 Ga0395899_0065306
658 Ga0395899_0114713
659 Ga0395900_0018858
660 Ga0395900_0105201
661 Ga0395900_0173100
662 Ga0395898_0048157
663 Ga0395905_1834928
664 Ga0436364_0264880
665 Ga0395901_0038109
666 Ga0395901_0094346
667 Ga0395901_0193519
668 Ga0436365_0302011
669 Ga0436360_0210056
670 Ga0436360_0923341
671 Ga0436361_0969244
672 Ga0436363_0169855
673 Ga0436363_0610712
674 Ga0436363_0788255
675 Ga0436363_1426608
676 Ga0436362_0166010
677 Ga0436362_0754246
678 Ga0439431_0123643
679 Ga0439448_0067766
680 Ga0466963_0012521
681 Ga0466963_0037138
682 Ga0466964_0059330
683 Ga0466964_0288996
684 Ga0466971_0436682
685 Ga0451576_0768435
686 Ga0466958_0170901
687 Ga0466967_0007238
688 Ga0466967_0081002
689 Ga0495592_0061338
690 Ga0495603_0631065
691 Ga0495639_0330921
692 Ga0495594_0699236
693 Ga0495630_0977173
694 Ga0495598_0287413
695 Ga0495658_0994493
696 Ga0495674_1406430
697 Ga0495602_0394949
698 Ga0496112_0875111
699 Ga0496126_0132111
700 Ga0501033_0266034
701 Ga0501034_0001860
702 Ga0501034_0043665
703 Ga0501034_0366970
704 Ga0501038_1235136
705 Ga0501041_0558859
706 Ga0501047_0912021
707 Ga0501048_0411537
708 Ga0501068_0003738
709 Ga0501068_0746548
710 Ga0501070_1519914
711 Ga0501071_0760505
712 Ga0501072_1157303
713 Ga0501235_076229
714 Ga0501079_0379404
715 Ga0501081_0138554
716 Ga0501083_0880218
717 Ga0501264_035213
718 Ga0501035_1203439
719 Ga0501044_0028843
720 Ga0501044_0176730
721 Ga0501045_0469960
722 nmdc:mga03683_33564_c1
723 nmdc:mga03683_471445_c1
724 nmdc:mga03683_549767_c1
725 nmdc:mga03683_78107_c1
726 nmdc:mga03683_96998_c1
727 nmdc:mga03n38_343983_c1
728 nmdc:mga00v17_271053_c1
729 nmdc:mga00v17_302694_c1
730 nmdc:mga0yw44_1194297_c1
731 nmdc:mga0yw44_355987_c1
732 nmdc:mga0yw44_456890_c1
733 nmdc:mga0yw44_56858_c1
734 nmdc:mga0yw44_773910_c1
735 nmdc:mga0k408_189649_c1
736 nmdc:mga0k408_5325_c1
737 nmdc:mga0k408_664981_c1
738 nmdc:mga0k408_83521_c1
739 nmdc:mga06z11_168552_c1
740 nmdc:mga06z11_60276_c1
741 nmdc:mga06z11_699731_c1
742 nmdc:mga06z11_892126_c1
743 nmdc:mga07m45_2469_c1
744 nmdc:mga05p37_810665_c1
745 nmdc:mga09592_70310_c1
746 nmdc:mga08y16_1079047_c1
747 nmdc:mga0sz30_407492_c1
748 nmdc:mga0sz30_421_c2
749 Ga0495612_0369669
750 Ga0500644_0125776
751 Ga0500583_0367530
752 Ga0500641_0001051
753 Ga0500555_119576
754 Ga0500655_023393
755 Ga0500616_0003370
756 Ga0500552_001106
757 Ga0501084_0530377
758 Ga0530510_0338553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.8688 8 82
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.8388 1 82
6k40-assembly5.cif.gz_K crystal structure of alkyl hydroperoxide reductase from d. radiodurans r1 0.8273 16 82
2oyo-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution 0.824 16 82
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.814 8 81
ID Description Score Start End Superfamily
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9216 8 76 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9076 7 76 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8877 8 82 1.20.1290.10
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8473 2 85 1.20.1290.10
af_O53905_23_180_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8299 7 82 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A561Q0K7-F1-model_v4 AhpD family alkylhydroperoxidase 0.9383 10 68 GO:0051920
AF-A0A818GPX8-F1-model_v4 Uncharacterized protein 0.9362 7 68
AF-A0A817MQ18-F1-model_v4 Uncharacterized protein 0.9359 7 69
AF-A0A417Y0Q2-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9308 8 68 GO:0051920
AF-A0A3D5DDP5-F1-model_v4 HECT domain-containing protein 0.9273 8 76 GO:0004842

Map