F428274

General Info

Members Datasets Scaffolds Average Seq Length
379 201 758 186

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100000399|Ga0070708_10000039926
Length 204
Sequence MIIISRTLLFVNWAVTAVIIAXXXLMVFRMIANYADLNPFAWISLTIRRLTDPFVLPVRRALMGFGVDPKYSPLVVILIVILLGYFVLQLASTIAWTLSGLLFSLQQGAMVSALGFILYGLISIYILLIFIRIIFSWGMVSYSNRIMRFLVNATEPLLGPLRRMIPPLGAMDISPIVAFLILWLFQQAIAGTLLRGAGQLTSTM

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
140 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
148 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
149 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
150 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
151 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
152 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
153 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
154 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
155 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
156 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
159 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
160 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
161 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
162 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
163 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
164 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
165 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
166 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
167 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
168 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
169 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
170 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
171 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
172 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
173 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
174 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
175 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
176 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
177 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
178 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
179 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
180 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
181 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
182 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
183 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
184 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
185 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
186 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
187 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
188 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
189 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
190 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
191 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
192 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
193 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.06
Rhizosphere 98.94
Stem 0
Stem Tuber 0
Unclassified 22.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100000399 3300005445 Bacteria 32870
2 MRS1b_contig_7091305 2162886011 Bacteria 1981
3 MBSR1b_contig_1249590 2162886012 Bacteria 2188
4 JGI24751J29686_10000038 3300002459 Bacteria 80932
5 JGI24751J29686_10000145 3300002459 Bacteria 34775
6 Ga0065714_10064462 3300005288 Bacteria 66145
7 Ga0065704_10196803 3300005289 Bacteria 1156
8 Ga0065704_10264106 3300005289 Unclassified 958
9 Ga0065712_10000135 3300005290 Bacteria 66145
10 Ga0065715_10010495 3300005293 Bacteria 2401
11 Ga0065715_10093694 3300005293 Bacteria 4588
12 Ga0065715_10102113 3300005293 Bacteria 3143
13 Ga0065715_10410521 3300005293 Bacteria 870
14 Ga0065715_10534288 3300005293 Bacteria 753
15 Ga0065707_10001314 3300005295 Bacteria 10907
16 Ga0070676_10399249 3300005328 Bacteria 956
17 Ga0070690_100006155 3300005330 Bacteria 6796
18 Ga0070690_100038405 3300005330 Bacteria 3022
19 Ga0070690_100617906 3300005330 Unclassified 824
20 Ga0070670_100000073 3300005331 Bacteria 98443
21 Ga0070670_100113970 3300005331 Bacteria 2331
22 Ga0070670_100126096 3300005331 Unclassified 2209
23 Ga0070680_100850928 3300005336 Unclassified 786
24 Ga0068868_100035556 3300005338 Bacteria 3851
25 Ga0068868_100038659 3300005338 Bacteria 3704
26 Ga0070689_100037242 3300005340 Bacteria 3720
27 Ga0070687_100224057 3300005343 Unclassified 1153
28 Ga0070687_100276185 3300005343 Bacteria 1056
29 Ga0070687_100502121 3300005343 Bacteria 817
30 Ga0070668_101096339 3300005347 Unclassified 718
31 Ga0070669_100002509 3300005353 Bacteria 13288
32 Ga0070669_100061053 3300005353 Unclassified 2769
33 Ga0070669_100119980 3300005353 Bacteria 2005
34 Ga0070669_100127809 3300005353 Bacteria 1946
35 Ga0070669_100193565 3300005353 Bacteria 1596
36 Ga0070675_100329873 3300005354 Bacteria 1349
37 Ga0070675_100430566 3300005354 Bacteria 1181
38 Ga0070671_100089523 3300005355 Bacteria 2577
39 Ga0070674_100448531 3300005356 Unclassified 1064
40 Ga0070673_100097718 3300005364 Bacteria 2412
41 Ga0070667_100088151 3300005367 Bacteria 2664
42 Ga0070703_10061218 3300005406 Unclassified 1232
43 Ga0070701_10381011 3300005438 Unclassified 889
44 Ga0070705_100803895 3300005440 Bacteria 748
45 Ga0070700_100002140 3300005441 Bacteria 10011
46 Ga0070700_100241178 3300005441 Bacteria 1292
47 Ga0070694_100018958 3300005444 Bacteria 4371
48 Ga0070694_100141534 3300005444 Bacteria 1748
49 Ga0070694_100196096 3300005444 Bacteria 1503
50 Ga0068867_100368418 3300005459 Unclassified 1204
51 Ga0068867_100478392 3300005459 Bacteria 1067
52 Ga0070685_10206801 3300005466 Bacteria 1279
53 Ga0070706_100002666 3300005467 Bacteria 17868
54 Ga0070706_100435239 3300005467 Bacteria 1221
55 Ga0070706_100706913 3300005467 Unclassified 934
56 Ga0070707_100484073 3300005468 Bacteria 1199
57 Ga0070707_100494896 3300005468 Unclassified 1184
58 Ga0070698_100005774 3300005471 Bacteria 13533
59 Ga0070698_100027518 3300005471 Bacteria 5911
60 Ga0070699_100066785 3300005518 Bacteria 3123
61 Ga0070684_101114520 3300005535 Unclassified 742
62 Ga0070697_100180747 3300005536 Unclassified 1788
63 Ga0070697_100262507 3300005536 Bacteria 1479
64 Ga0070697_100625495 3300005536 Unclassified 947
65 Ga0070672_100052680 3300005543 Bacteria 3178
66 Ga0070686_100013136 3300005544 Bacteria 4729
67 Ga0070686_100087265 3300005544 Bacteria 2079
68 Ga0070695_100487899 3300005545 Bacteria 951
69 Ga0070695_100521671 3300005545 Unclassified 922
70 Ga0070696_100045543 3300005546 Bacteria 3039
71 Ga0070696_100134283 3300005546 Bacteria 1803
72 Ga0070693_100012051 3300005547 Bacteria 4366
73 Ga0070693_100414685 3300005547 Bacteria 937
74 Ga0070693_100877993 3300005547 Unclassified 670
75 Ga0070704_100025732 3300005549 Bacteria 3878
76 Ga0070704_100081613 3300005549 Bacteria 2382
77 Ga0070704_100134953 3300005549 Bacteria 1918
78 Ga0070704_100148007 3300005549 Bacteria 1842
79 Ga0070664_100426507 3300005564 Bacteria 1215
80 Ga0068857_100165915 3300005577 Bacteria 2005
81 Ga0068857_100175143 3300005577 Bacteria 1951
82 Ga0068857_100266691 3300005577 Bacteria 1573
83 Ga0068854_100145793 3300005578 Unclassified 1821
84 Ga0070702_100197814 3300005615 Bacteria 1328
85 Ga0070702_100726250 3300005615 Unclassified 760
86 Ga0068852_101020744 3300005616 Bacteria 846
87 Ga0068852_101145806 3300005616 Unclassified 798
88 Ga0068852_101237754 3300005616 Bacteria 768
89 Ga0068859_100166826 3300005617 Unclassified 2282
90 Ga0068859_100285586 3300005617 Bacteria 1743
91 Ga0068859_100394627 3300005617 Bacteria 1479
92 Ga0068859_100429530 3300005617 Bacteria 1417
93 Ga0068859_100475795 3300005617 Bacteria 1345
94 Ga0068859_100643431 3300005617 Bacteria 1152
95 Ga0068864_100434915 3300005618 Unclassified 1252
96 Ga0068864_100725099 3300005618 Bacteria 973
97 Ga0068864_100824979 3300005618 Bacteria 913
98 Ga0068864_101132044 3300005618 Bacteria 780
99 Ga0068861_100007856 3300005719 Bacteria 7337
100 Ga0068861_100032364 3300005719 Bacteria 3848
101 Ga0068861_100060079 3300005719 Bacteria 2912
102 Ga0068861_100303154 3300005719 Bacteria 1385
103 Ga0068870_10431254 3300005840 Bacteria 865
104 Ga0068863_100588555 3300005841 Unclassified 1101
105 Ga0068858_100155356 3300005842 Bacteria 2152
106 Ga0068858_100183450 3300005842 Bacteria 1976
107 Ga0068858_100636978 3300005842 Bacteria 1035
108 Ga0068858_101329818 3300005842 Bacteria 707
109 Ga0068860_100127502 3300005843 Bacteria 2439
110 Ga0068860_100205309 3300005843 Bacteria 1910
111 Ga0068860_100261296 3300005843 Bacteria 1687
112 Ga0068862_100008426 3300005844 Bacteria 8532
113 Ga0068862_101111322 3300005844 Bacteria 786
114 Ga0081539_10000346 3300005985 Bacteria 101962
115 Ga0081539_10008924 3300005985 Bacteria 8548
116 Ga0070716_100021693 3300006173 Bacteria 3386
117 Ga0097621_100224630 3300006237 Bacteria 1637
118 Ga0068871_100095442 3300006358 Bacteria 2483
119 Ga0075428_100219652 3300006844 Bacteria 2052
120 Ga0075428_100794357 3300006844 Bacteria 1006
121 Ga0075430_100016042 3300006846 Bacteria 6378
122 Ga0075430_100021684 3300006846 Bacteria 5460
123 Ga0075431_100066505 3300006847 Bacteria 3721
124 Ga0075431_100176992 3300006847 Bacteria 2191
125 Ga0075433_10173969 3300006852 Unclassified 1915
126 Ga0075433_10182511 3300006852 Bacteria 1867
127 Ga0075433_10205984 3300006852 Bacteria 1749
128 Ga0075433_10781900 3300006852 Unclassified 834
129 Ga0075434_100380234 3300006871 Bacteria 1433
130 Ga0075429_100019579 3300006880 Bacteria 5866
131 Ga0068865_100343863 3300006881 Bacteria 1206
132 Ga0075436_100027329 3300006914 Bacteria 3928
133 Ga0097620_100166826 3300006931 Unclassified 2282
134 Ga0097620_100285584 3300006931 Bacteria 1743
135 Ga0097620_100394610 3300006931 Bacteria 1479
136 Ga0097620_100429515 3300006931 Bacteria 1417
137 Ga0097620_100475810 3300006931 Bacteria 1345
138 Ga0097620_100643439 3300006931 Bacteria 1152
139 Ga0111539_11986842 3300009094 Unclassified 674
140 Ga0105245_10088403 3300009098 Bacteria 2846
141 Ga0105245_11125323 3300009098 Bacteria 832
142 Ga0105245_11451778 3300009098 Bacteria 736
143 Ga0105247_10531420 3300009101 Bacteria 862
144 Ga0114129_10030386 3300009147 Bacteria 7643
145 Ga0114129_10119137 3300009147 Bacteria 3636
146 Ga0114129_10427764 3300009147 Bacteria 1740
147 Ga0114129_10583931 3300009147 Unclassified 1450
148 Ga0114129_10630342 3300009147 Bacteria 1386
149 Ga0114129_10679259 3300009147 Bacteria 1326
150 Ga0105243_10022250 3300009148 Bacteria 4816
151 Ga0105243_10100302 3300009148 Bacteria 2402
152 Ga0105243_10777272 3300009148 Bacteria 941
153 Ga0105241_10041576 3300009174 Bacteria 3474
154 Ga0105241_10078754 3300009174 Bacteria 2575
155 Ga0105241_10111659 3300009174 Bacteria 2189
156 Ga0105241_10436287 3300009174 Bacteria 1156
157 Ga0105242_10005755 3300009176 Bacteria 9557
158 Ga0105248_10055262 3300009177 Bacteria 4452
159 Ga0105248_10129081 3300009177 Bacteria 2852
160 Ga0105248_10148275 3300009177 Bacteria 2647
161 Ga0105238_10014743 3300009551 Bacteria 7905
162 Ga0105249_10016780 3300009553 Bacteria 6498
163 Ga0105249_10071345 3300009553 Bacteria 3208
164 Ga0105249_10143451 3300009553 Unclassified 2292
165 Ga0105249_10817855 3300009553 Bacteria 996
166 Ga0105239_10693069 3300010375 Bacteria 1164
167 Ga0105246_10040887 3300011119 Unclassified 3132
168 Ga0105246_10152315 3300011119 Bacteria 1751
169 Ga0105246_10347343 3300011119 Bacteria 1214
170 Ga0157374_10195115 3300013296 Bacteria 1981
171 Ga0157378_10040954 3300013297 Bacteria 4109
172 Ga0157378_10224116 3300013297 Unclassified 1788
173 Ga0163162_10151296 3300013306 Bacteria 2439
174 Ga0163162_10459099 3300013306 Bacteria 1405
175 Ga0157375_10031060 3300013308 Bacteria 5043
176 Ga0157375_10239227 3300013308 Bacteria 1975
177 Ga0157375_10588825 3300013308 Bacteria 1272
178 Ga0157375_11678210 3300013308 Unclassified 752
179 Ga0163163_10001840 3300014325 Bacteria 17899
180 Ga0163163_10115748 3300014325 Bacteria 2712
181 Ga0163163_10302077 3300014325 Bacteria 1653
182 Ga0157380_10000386 3300014326 Bacteria 26600
183 Ga0157380_11214780 3300014326 Bacteria 798
184 Ga0157380_11297467 3300014326 Unclassified 775
185 Ga0157377_10026610 3300014745 Bacteria 3098
186 Ga0157377_10279142 3300014745 Bacteria 1094
187 Ga0157379_10915435 3300014968 Bacteria 832
188 Ga0157376_10001691 3300014969 Bacteria 14674
189 Ga0163161_10012419 3300017792 Bacteria 5914
190 Ga0207697_10012148 3300025315 Bacteria 3622
191 Ga0207642_10176007 3300025899 Bacteria 1162
192 Ga0207688_10273704 3300025901 Unclassified 1027
193 Ga0207680_10072032 3300025903 Bacteria 2144
194 Ga0207645_10761418 3300025907 Unclassified 658
195 Ga0207643_10001019 3300025908 Bacteria 16621
196 Ga0207684_10020513 3300025910 Bacteria 5648
197 Ga0207684_10504365 3300025910 Bacteria 1037
198 Ga0207654_10103351 3300025911 Bacteria 1759
199 Ga0207654_10158081 3300025911 Bacteria 1461
200 Ga0207662_10004604 3300025918 Bacteria 7271
201 Ga0207646_10463642 3300025922 Bacteria 1143
202 Ga0207681_10011477 3300025923 Bacteria 5444
203 Ga0207681_10097893 3300025923 Bacteria 2109
204 Ga0207681_10248385 3300025923 Bacteria 1388
205 Ga0207681_10293444 3300025923 Bacteria 1284
206 Ga0207694_10004281 3300025924 Bacteria 11171
207 Ga0207650_10000006 3300025925 Bacteria 544730
208 Ga0207650_10769520 3300025925 Unclassified 815
209 Ga0207659_10159844 3300025926 Bacteria 1768
210 Ga0207687_10405781 3300025927 Bacteria 1122
211 Ga0207644_10032077 3300025931 Bacteria 3663
212 Ga0207706_10233544 3300025933 Bacteria 1608
213 Ga0207709_10021040 3300025935 Bacteria 3689
214 Ga0207709_10636916 3300025935 Bacteria 847
215 Ga0207669_10621550 3300025937 Unclassified 880
216 Ga0207704_10125399 3300025938 Bacteria 1767
217 Ga0207704_10336277 3300025938 Bacteria 1170
218 Ga0207704_10467901 3300025938 Unclassified 1009
219 Ga0207665_10081547 3300025939 Bacteria 2227
220 Ga0207691_10002357 3300025940 Bacteria 18495
221 Ga0207711_10117850 3300025941 Bacteria 2368
222 Ga0207711_10249207 3300025941 Bacteria 1630
223 Ga0207711_10409457 3300025941 Bacteria 1260
224 Ga0207689_10015258 3300025942 Bacteria 6504
225 Ga0207651_10114174 3300025960 Bacteria 2034
226 Ga0207651_10153274 3300025960 Bacteria 1797
227 Ga0207712_10002032 3300025961 Bacteria 13277
228 Ga0207712_10106029 3300025961 Bacteria 2099
229 Ga0207668_10936757 3300025972 Unclassified 772
230 Ga0207640_10117683 3300025981 Unclassified 1897
231 Ga0207640_10231914 3300025981 Bacteria 1421
232 Ga0207677_10814352 3300026023 Bacteria 837
233 Ga0207703_10747672 3300026035 Unclassified 932
234 Ga0207708_10008366 3300026075 Bacteria 7659
235 Ga0207708_10113000 3300026075 Bacteria 2110
236 Ga0207708_10139861 3300026075 Bacteria 1898
237 Ga0207641_10126171 3300026088 Bacteria 2291
238 Ga0207641_10154111 3300026088 Bacteria 2084
239 Ga0207648_10073532 3300026089 Bacteria 2979
240 Ga0207648_10130415 3300026089 Bacteria 2213
241 Ga0207648_10293968 3300026089 Bacteria 1455
242 Ga0207648_10490843 3300026089 Bacteria 1123
243 Ga0207676_10047125 3300026095 Unclassified 3338
244 Ga0207676_10236337 3300026095 Bacteria 1637
245 Ga0207676_10388742 3300026095 Bacteria 1300
246 Ga0207676_10531777 3300026095 Bacteria 1121
247 Ga0207674_10155326 3300026116 Bacteria 2243
248 Ga0207674_10509743 3300026116 Bacteria 1162
249 Ga0207675_100008219 3300026118 Bacteria 9834
250 Ga0207675_100067788 3300026118 Bacteria 3336
251 Ga0207675_100096104 3300026118 Bacteria 2789
252 Ga0207675_100275679 3300026118 Bacteria 1633
253 Ga0268265_10054172 3300028380 Bacteria 3042
254 Ga0268265_10476984 3300028380 Bacteria 1171
255 Ga0268265_10652259 3300028380 Bacteria 1012
256 Ga0268264_10127002 3300028381 Bacteria 2255
257 Ga0268264_10179976 3300028381 Bacteria 1919
258 Ga0307405_10053209 3300031731 Unclassified 2521
259 Ga0307405_10321248 3300031731 Bacteria 1182
260 Ga0307405_10669039 3300031731 Unclassified 856
261 Ga0307410_10593893 3300031852 Bacteria 923
262 Ga0307406_10066205 3300031901 Unclassified 2351
263 Ga0307406_10665479 3300031901 Unclassified 866
264 Ga0307407_10072422 3300031903 Bacteria 2055
265 Ga0307407_10232599 3300031903 Bacteria 1253
266 Ga0307409_100200774 3300031995 Unclassified 1784
267 Ga0307416_100016777 3300032002 Bacteria 5102
268 Ga0307414_10033044 3300032004 Unclassified 3415
269 Ga0307411_10047624 3300032005 Bacteria 2773
270 Ga0307411_10127181 3300032005 Unclassified 1855
271 Ga0307415_100083886 3300032126 Bacteria 2284
272 Ga0395901_0543753 3300038443 Bacteria 1178
273 Ga0242422_01791 3300038699 Unclassified 1481
274 Ga0242420_005007 3300038996 Bacteria 2031
275 Ga0439434_0030183 3300042435 Bacteria 1645
276 Ga0495621_0019478 3300046539 Bacteria 2217
277 Ga0496102_0884640 3300048905 Bacteria 815
278 Ga0496104_0635754 3300048907 Bacteria 976
279 Ga0496106_0669660 3300048909 Bacteria 828
280 Ga0496108_0411699 3300048911 Bacteria 1181
281 Ga0501291_017903 3300049514 Bacteria 1096
282 Ga0501292_001254 3300049515 Bacteria 3108
283 Ga0501292_007218 3300049515 Bacteria 1601
284 Ga0501293_010209 3300049516 Bacteria 810
285 Ga0501295_027613 3300049518 Bacteria 1095
286 Ga0501296_001248 3300049519 Bacteria 2566
287 Ga0501296_013428 3300049519 Bacteria 996
288 Ga0501297_008507 3300049520 Bacteria 1132
289 Ga0501298_000571 3300049521 Bacteria 5024
290 Ga0501298_001248 3300049521 Bacteria 3712
291 Ga0501298_003382 3300049521 Unclassified 2473
292 Ga0501298_063428 3300049521 Unclassified 786
293 Ga0501299_016347 3300049522 Bacteria 1313
294 Ga0501299_026903 3300049522 Unclassified 1089
295 Ga0501301_019522 3300049524 Bacteria 640
296 Ga0501303_001078 3300049526 Bacteria 2042
297 Ga0501077_0138712 3300049593 Bacteria 1542
298 Ga0501198_005415 3300049649 Bacteria 1797
299 Ga0501198_011710 3300049649 Bacteria 1311
300 Ga0501198_020916 3300049649 Bacteria 1039
301 Ga0501199_002568 3300049650 Unclassified 1705
302 Ga0501202_009396 3300049652 Unclassified 1797
303 Ga0501202_012784 3300049652 Bacteria 1589
304 Ga0501202_028369 3300049652 Bacteria 1155
305 Ga0501207_005171 3300049654 Unclassified 1800
306 Ga0501209_026385 3300049656 Unclassified 1433
307 Ga0501216_003873 3300049660 Bacteria 2200
308 Ga0501216_058924 3300049660 Bacteria 771
309 Ga0501217_001114 3300049661 Bacteria 4906
310 Ga0501217_001896 3300049661 Bacteria 4013
311 Ga0501217_007472 3300049661 Bacteria 2344
312 Ga0501217_025059 3300049661 Unclassified 1432
313 Ga0501223_003071 3300049663 Bacteria 3648
314 Ga0501223_023390 3300049663 Unclassified 1205
315 Ga0501223_039300 3300049663 Bacteria 918
316 Ga0501224_004933 3300049664 Archaea 1902
317 Ga0501224_021167 3300049664 Unclassified 969
318 Ga0501227_012685 3300049665 Unclassified 1848
319 Ga0501227_048804 3300049665 Unclassified 1063
320 Ga0501228_004650 3300049666 Bacteria 1187
321 Ga0501230_005781 3300049667 Unclassified 1768
322 Ga0501230_039556 3300049667 Bacteria 909
323 Ga0501233_006361 3300049668 Bacteria 2215
324 Ga0501233_007318 3300049668 Unclassified 2098
325 Ga0501233_077378 3300049668 Bacteria 852
326 Ga0501233_097023 3300049668 Bacteria 775
327 Ga0501235_001918 3300049669 Bacteria 4450
328 Ga0501235_010317 3300049669 Unclassified 2042
329 Ga0501235_021284 3300049669 Bacteria 1441
330 Ga0501235_082318 3300049669 Unclassified 770
331 Ga0501236_015555 3300049670 Bacteria 1067
332 Ga0501239_010213 3300049672 Bacteria 1031
333 Ga0501243_006793 3300049675 Bacteria 1740
334 Ga0501243_011275 3300049675 Unclassified 1400
335 Ga0501247_009792 3300049677 Unclassified 1135
336 Ga0501247_011438 3300049677 Unclassified 1070
337 Ga0501249_005328 3300049679 Bacteria 2630
338 Ga0501249_021367 3300049679 Bacteria 1412
339 Ga0501249_027511 3300049679 Bacteria 1258
340 Ga0501250_006052 3300049680 Archaea 1265
341 Ga0501257_007085 3300049686 Bacteria 2500
342 Ga0501257_018080 3300049686 Unclassified 1642
343 Ga0501257_018182 3300049686 Bacteria 1638
344 Ga0501257_103317 3300049686 Unclassified 750
345 Ga0501259_005494 3300049688 Archaea 2006
346 Ga0501259_011832 3300049688 Bacteria 1448
347 Ga0501260_001646 3300049689 Unclassified 1858
348 Ga0501260_011494 3300049689 Bacteria 897
349 Ga0501261_040020 3300049690 Unclassified 736
350 Ga0501221_003053 3300049704 Bacteria 2759
351 Ga0501221_008545 3300049704 Bacteria 1782
352 Ga0501225_0013959 3300049705 Bacteria 2246
353 Ga0501225_0034098 3300049705 Archaea 1401
354 Ga0501225_0038938 3300049705 Bacteria 1310
355 Ga0501232_029213 3300049757 Bacteria 757
356 Ga0501263_003374 3300049760 Bacteria 1701
357 Ga0501263_007160 3300049760 Unclassified 1306
358 Ga0501265_058345 3300049762 Unclassified 624
359 Ga0501266_029660 3300049763 Bacteria 776
360 Ga0501267_010104 3300049764 Bacteria 950
361 Ga0501268_002154 3300049765 Unclassified 2563
362 Ga0501270_003510 3300049767 Unclassified 1698
363 Ga0501273_002760 3300049770 Unclassified 1813
364 Ga0501283_000456 3300049779 Bacteria 5391
365 Ga0501204_003729 3300049850 Unclassified 1618
366 nmdc:mga05p37_1016291_c1 3300050507 Bacteria 879
367 nmdc:mga05p37_24569_c1 3300050507 Bacteria 7325
368 nmdc:mga05p37_52354_c1 3300050507 Bacteria 5020
369 nmdc:mga09592_140567_c1 3300050508 Bacteria 2081
370 nmdc:mga09592_30281_c1 3300050508 Bacteria 4503
371 nmdc:mga0qj67_44001_c1 3300050509 Unclassified 3517
372 nmdc:mga0qj67_93745_c1 3300050509 Bacteria 2415
373 nmdc:mga06r32_106645_c1 3300050510 Bacteria 2753
374 nmdc:mga08y16_229541_c1 3300050511 Unclassified 1920
375 nmdc:mga08y16_472585_c1 3300050511 Unclassified 1276
376 nmdc:mga0n895_1506875_c1 3300050512 Unclassified 639
377 nmdc:mga08x19_10484_c1 3300050514 Bacteria 5565
378 nmdc:mga0a205_274292_c1 3300050515 Bacteria 1563
379 nmdc:mga0a205_512029_c1 3300050515 Unclassified 1057
380 Ga0070708_100000399
381 MRS1b_contig_7091305
382 MBSR1b_contig_1249590
383 JGI24751J29686_10000038
384 JGI24751J29686_10000145
385 Ga0065714_10064462
386 Ga0065704_10196803
387 Ga0065704_10264106
388 Ga0065712_10000135
389 Ga0065715_10010495
390 Ga0065715_10093694
391 Ga0065715_10102113
392 Ga0065715_10410521
393 Ga0065715_10534288
394 Ga0065707_10001314
395 Ga0070676_10399249
396 Ga0070690_100006155
397 Ga0070690_100038405
398 Ga0070690_100617906
399 Ga0070670_100000073
400 Ga0070670_100113970
401 Ga0070670_100126096
402 Ga0070680_100850928
403 Ga0068868_100035556
404 Ga0068868_100038659
405 Ga0070689_100037242
406 Ga0070687_100224057
407 Ga0070687_100276185
408 Ga0070687_100502121
409 Ga0070668_101096339
410 Ga0070669_100002509
411 Ga0070669_100061053
412 Ga0070669_100119980
413 Ga0070669_100127809
414 Ga0070669_100193565
415 Ga0070675_100329873
416 Ga0070675_100430566
417 Ga0070671_100089523
418 Ga0070674_100448531
419 Ga0070673_100097718
420 Ga0070667_100088151
421 Ga0070703_10061218
422 Ga0070701_10381011
423 Ga0070705_100803895
424 Ga0070700_100002140
425 Ga0070700_100241178
426 Ga0070694_100018958
427 Ga0070694_100141534
428 Ga0070694_100196096
429 Ga0068867_100368418
430 Ga0068867_100478392
431 Ga0070685_10206801
432 Ga0070706_100002666
433 Ga0070706_100435239
434 Ga0070706_100706913
435 Ga0070707_100484073
436 Ga0070707_100494896
437 Ga0070698_100005774
438 Ga0070698_100027518
439 Ga0070699_100066785
440 Ga0070684_101114520
441 Ga0070697_100180747
442 Ga0070697_100262507
443 Ga0070697_100625495
444 Ga0070672_100052680
445 Ga0070686_100013136
446 Ga0070686_100087265
447 Ga0070695_100487899
448 Ga0070695_100521671
449 Ga0070696_100045543
450 Ga0070696_100134283
451 Ga0070693_100012051
452 Ga0070693_100414685
453 Ga0070693_100877993
454 Ga0070704_100025732
455 Ga0070704_100081613
456 Ga0070704_100134953
457 Ga0070704_100148007
458 Ga0070664_100426507
459 Ga0068857_100165915
460 Ga0068857_100175143
461 Ga0068857_100266691
462 Ga0068854_100145793
463 Ga0070702_100197814
464 Ga0070702_100726250
465 Ga0068852_101020744
466 Ga0068852_101145806
467 Ga0068852_101237754
468 Ga0068859_100166826
469 Ga0068859_100285586
470 Ga0068859_100394627
471 Ga0068859_100429530
472 Ga0068859_100475795
473 Ga0068859_100643431
474 Ga0068864_100434915
475 Ga0068864_100725099
476 Ga0068864_100824979
477 Ga0068864_101132044
478 Ga0068861_100007856
479 Ga0068861_100032364
480 Ga0068861_100060079
481 Ga0068861_100303154
482 Ga0068870_10431254
483 Ga0068863_100588555
484 Ga0068858_100155356
485 Ga0068858_100183450
486 Ga0068858_100636978
487 Ga0068858_101329818
488 Ga0068860_100127502
489 Ga0068860_100205309
490 Ga0068860_100261296
491 Ga0068862_100008426
492 Ga0068862_101111322
493 Ga0081539_10000346
494 Ga0081539_10008924
495 Ga0070716_100021693
496 Ga0097621_100224630
497 Ga0068871_100095442
498 Ga0075428_100219652
499 Ga0075428_100794357
500 Ga0075430_100016042
501 Ga0075430_100021684
502 Ga0075431_100066505
503 Ga0075431_100176992
504 Ga0075433_10173969
505 Ga0075433_10182511
506 Ga0075433_10205984
507 Ga0075433_10781900
508 Ga0075434_100380234
509 Ga0075429_100019579
510 Ga0068865_100343863
511 Ga0075436_100027329
512 Ga0097620_100166826
513 Ga0097620_100285584
514 Ga0097620_100394610
515 Ga0097620_100429515
516 Ga0097620_100475810
517 Ga0097620_100643439
518 Ga0111539_11986842
519 Ga0105245_10088403
520 Ga0105245_11125323
521 Ga0105245_11451778
522 Ga0105247_10531420
523 Ga0114129_10030386
524 Ga0114129_10119137
525 Ga0114129_10427764
526 Ga0114129_10583931
527 Ga0114129_10630342
528 Ga0114129_10679259
529 Ga0105243_10022250
530 Ga0105243_10100302
531 Ga0105243_10777272
532 Ga0105241_10041576
533 Ga0105241_10078754
534 Ga0105241_10111659
535 Ga0105241_10436287
536 Ga0105242_10005755
537 Ga0105248_10055262
538 Ga0105248_10129081
539 Ga0105248_10148275
540 Ga0105238_10014743
541 Ga0105249_10016780
542 Ga0105249_10071345
543 Ga0105249_10143451
544 Ga0105249_10817855
545 Ga0105239_10693069
546 Ga0105246_10040887
547 Ga0105246_10152315
548 Ga0105246_10347343
549 Ga0157374_10195115
550 Ga0157378_10040954
551 Ga0157378_10224116
552 Ga0163162_10151296
553 Ga0163162_10459099
554 Ga0157375_10031060
555 Ga0157375_10239227
556 Ga0157375_10588825
557 Ga0157375_11678210
558 Ga0163163_10001840
559 Ga0163163_10115748
560 Ga0163163_10302077
561 Ga0157380_10000386
562 Ga0157380_11214780
563 Ga0157380_11297467
564 Ga0157377_10026610
565 Ga0157377_10279142
566 Ga0157379_10915435
567 Ga0157376_10001691
568 Ga0163161_10012419
569 Ga0207697_10012148
570 Ga0207642_10176007
571 Ga0207688_10273704
572 Ga0207680_10072032
573 Ga0207645_10761418
574 Ga0207643_10001019
575 Ga0207684_10020513
576 Ga0207684_10504365
577 Ga0207654_10103351
578 Ga0207654_10158081
579 Ga0207662_10004604
580 Ga0207646_10463642
581 Ga0207681_10011477
582 Ga0207681_10097893
583 Ga0207681_10248385
584 Ga0207681_10293444
585 Ga0207694_10004281
586 Ga0207650_10000006
587 Ga0207650_10769520
588 Ga0207659_10159844
589 Ga0207687_10405781
590 Ga0207644_10032077
591 Ga0207706_10233544
592 Ga0207709_10021040
593 Ga0207709_10636916
594 Ga0207669_10621550
595 Ga0207704_10125399
596 Ga0207704_10336277
597 Ga0207704_10467901
598 Ga0207665_10081547
599 Ga0207691_10002357
600 Ga0207711_10117850
601 Ga0207711_10249207
602 Ga0207711_10409457
603 Ga0207689_10015258
604 Ga0207651_10114174
605 Ga0207651_10153274
606 Ga0207712_10002032
607 Ga0207712_10106029
608 Ga0207668_10936757
609 Ga0207640_10117683
610 Ga0207640_10231914
611 Ga0207677_10814352
612 Ga0207703_10747672
613 Ga0207708_10008366
614 Ga0207708_10113000
615 Ga0207708_10139861
616 Ga0207641_10126171
617 Ga0207641_10154111
618 Ga0207648_10073532
619 Ga0207648_10130415
620 Ga0207648_10293968
621 Ga0207648_10490843
622 Ga0207676_10047125
623 Ga0207676_10236337
624 Ga0207676_10388742
625 Ga0207676_10531777
626 Ga0207674_10155326
627 Ga0207674_10509743
628 Ga0207675_100008219
629 Ga0207675_100067788
630 Ga0207675_100096104
631 Ga0207675_100275679
632 Ga0268265_10054172
633 Ga0268265_10476984
634 Ga0268265_10652259
635 Ga0268264_10127002
636 Ga0268264_10179976
637 Ga0307405_10053209
638 Ga0307405_10321248
639 Ga0307405_10669039
640 Ga0307410_10593893
641 Ga0307406_10066205
642 Ga0307406_10665479
643 Ga0307407_10072422
644 Ga0307407_10232599
645 Ga0307409_100200774
646 Ga0307416_100016777
647 Ga0307414_10033044
648 Ga0307411_10047624
649 Ga0307411_10127181
650 Ga0307415_100083886
651 Ga0395901_0543753
652 Ga0242422_01791
653 Ga0242420_005007
654 Ga0439434_0030183
655 Ga0495621_0019478
656 Ga0496102_0884640
657 Ga0496104_0635754
658 Ga0496106_0669660
659 Ga0496108_0411699
660 Ga0501291_017903
661 Ga0501292_001254
662 Ga0501292_007218
663 Ga0501293_010209
664 Ga0501295_027613
665 Ga0501296_001248
666 Ga0501296_013428
667 Ga0501297_008507
668 Ga0501298_000571
669 Ga0501298_001248
670 Ga0501298_003382
671 Ga0501298_063428
672 Ga0501299_016347
673 Ga0501299_026903
674 Ga0501301_019522
675 Ga0501303_001078
676 Ga0501077_0138712
677 Ga0501198_005415
678 Ga0501198_011710
679 Ga0501198_020916
680 Ga0501199_002568
681 Ga0501202_009396
682 Ga0501202_012784
683 Ga0501202_028369
684 Ga0501207_005171
685 Ga0501209_026385
686 Ga0501216_003873
687 Ga0501216_058924
688 Ga0501217_001114
689 Ga0501217_001896
690 Ga0501217_007472
691 Ga0501217_025059
692 Ga0501223_003071
693 Ga0501223_023390
694 Ga0501223_039300
695 Ga0501224_004933
696 Ga0501224_021167
697 Ga0501227_012685
698 Ga0501227_048804
699 Ga0501228_004650
700 Ga0501230_005781
701 Ga0501230_039556
702 Ga0501233_006361
703 Ga0501233_007318
704 Ga0501233_077378
705 Ga0501233_097023
706 Ga0501235_001918
707 Ga0501235_010317
708 Ga0501235_021284
709 Ga0501235_082318
710 Ga0501236_015555
711 Ga0501239_010213
712 Ga0501243_006793
713 Ga0501243_011275
714 Ga0501247_009792
715 Ga0501247_011438
716 Ga0501249_005328
717 Ga0501249_021367
718 Ga0501249_027511
719 Ga0501250_006052
720 Ga0501257_007085
721 Ga0501257_018080
722 Ga0501257_018182
723 Ga0501257_103317
724 Ga0501259_005494
725 Ga0501259_011832
726 Ga0501260_001646
727 Ga0501260_011494
728 Ga0501261_040020
729 Ga0501221_003053
730 Ga0501221_008545
731 Ga0501225_0013959
732 Ga0501225_0034098
733 Ga0501225_0038938
734 Ga0501232_029213
735 Ga0501263_003374
736 Ga0501263_007160
737 Ga0501265_058345
738 Ga0501266_029660
739 Ga0501267_010104
740 Ga0501268_002154
741 Ga0501270_003510
742 Ga0501273_002760
743 Ga0501283_000456
744 Ga0501204_003729
745 nmdc:mga05p37_1016291_c1
746 nmdc:mga05p37_24569_c1
747 nmdc:mga05p37_52354_c1
748 nmdc:mga09592_140567_c1
749 nmdc:mga09592_30281_c1
750 nmdc:mga0qj67_44001_c1
751 nmdc:mga0qj67_93745_c1
752 nmdc:mga06r32_106645_c1
753 nmdc:mga08y16_229541_c1
754 nmdc:mga08y16_472585_c1
755 nmdc:mga0n895_1506875_c1
756 nmdc:mga08x19_10484_c1
757 nmdc:mga0a205_274292_c1
758 nmdc:mga0a205_512029_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02325

YGGT

YGGT family

119

189

0.93

Map