F428054

General Info

Members Datasets Scaffolds Average Seq Length
378 242 756 226

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1010615|Ga0265319_10106153
Length 229
Sequence VAVLAALELRGLTRRYGERLALTDVNVSVAAGQTLAVLGPNGAGKTTLLRVLATLLRPHGGEAEVLGHALPAQAWAVRGRIGLLGHEPMLYRELSARENLALYGALHAVPGTQRAQELLASVAMERRADEPLRTLSRGMVARVAVCRALLHDPELLLLDEPRANLDPAASELVEPLIGRASGRTRVIVSHDPAGVLAEADLVMGLVRGRVALLAQAAQTDPQALAELYR

Samples

Sample ID Description Type Environment
1 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
101 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
238 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
239 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
240 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 7.14
Rhizosphere 89.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265319_1010615 3300028563 Bacteria 3831
2 Ga0070658_10084127 3300005327 Bacteria 2616
3 Ga0070658_10111702 3300005327 Bacteria 2265
4 Ga0070683_100169470 3300005329 Bacteria 2072
5 Ga0070670_100124957 3300005331 Bacteria 2221
6 Ga0070682_100026759 3300005337 Bacteria 3455
7 Ga0070682_100142909 3300005337 Bacteria 1633
8 Ga0070682_100342617 3300005337 Bacteria 1112
9 Ga0070660_100041823 3300005339 Bacteria 3495
10 Ga0070660_100043900 3300005339 Bacteria 3417
11 Ga0070660_100047097 3300005339 Bacteria 3307
12 Ga0070689_100130425 3300005340 Bacteria 2015
13 Ga0070687_100390495 3300005343 Bacteria 909
14 Ga0070661_100201490 3300005344 Bacteria 1521
15 Ga0070668_100213412 3300005347 Bacteria 1588
16 Ga0070671_100480011 3300005355 Bacteria 1068
17 Ga0070688_100045831 3300005365 Bacteria 2704
18 Ga0070659_100000002 3300005366 Bacteria 369239
19 Ga0070659_100141565 3300005366 Bacteria 1958
20 Ga0070709_10147170 3300005434 Bacteria 1624
21 Ga0070714_100000170 3300005435 Bacteria 52761
22 Ga0070710_10000006 3300005437 Bacteria 217422
23 Ga0070710_10110946 3300005437 Bacteria 1647
24 Ga0070710_10171472 3300005437 Bacteria 1352
25 Ga0070701_10099287 3300005438 Bacteria 1610
26 Ga0070711_100117223 3300005439 Bacteria 1963
27 Ga0070705_100001402 3300005440 Bacteria 12780
28 Ga0070708_100329784 3300005445 Bacteria 1438
29 Ga0070681_10124109 3300005458 Bacteria 2515
30 Ga0070685_10029920 3300005466 Bacteria 3029
31 Ga0070679_100187362 3300005530 Bacteria 2039
32 Ga0070684_100015188 3300005535 Bacteria 6262
33 Ga0070686_100332849 3300005544 Bacteria 1136
34 Ga0070704_100249251 3300005549 Bacteria 1458
35 Ga0070664_100166335 3300005564 Bacteria 1954
36 Ga0068856_100009716 3300005614 Bacteria 9344
37 Ga0068856_100345783 3300005614 Bacteria 1506
38 Ga0070702_100021732 3300005615 Bacteria 3382
39 Ga0070702_100024690 3300005615 Bacteria 3210
40 Ga0070702_100513799 3300005615 Bacteria 882
41 Ga0068859_100300838 3300005617 Bacteria 1697
42 Ga0068864_100118670 3300005618 Bacteria 2362
43 Ga0068866_10050981 3300005718 Bacteria 2104
44 Ga0068861_100455224 3300005719 Bacteria 1148
45 Ga0068863_100000042 3300005841 Bacteria 154459
46 Ga0081455_10013826 3300005937 Bacteria 7943
47 Ga0081538_10000021 3300005981 Bacteria 138488
48 Ga0081538_10021721 3300005981 Bacteria 4671
49 Ga0081540_1000427 3300005983 Bacteria 41566
50 Ga0070717_10000005 3300006028 Bacteria 357819
51 Ga0070717_10161538 3300006028 Bacteria 1944
52 Ga0070717_10297861 3300006028 Bacteria 1433
53 Ga0075432_10016872 3300006058 Bacteria 2493
54 Ga0075432_10104701 3300006058 Bacteria 1049
55 Ga0070716_100027230 3300006173 Bacteria 3068
56 Ga0070712_100000036 3300006175 Bacteria 67602
57 Ga0070712_100325445 3300006175 Bacteria 1251
58 Ga0070712_100781851 3300006175 Bacteria 818
59 Ga0075428_100037073 3300006844 Bacteria 5370
60 Ga0075428_100130592 3300006844 Bacteria 2733
61 Ga0075428_100455319 3300006844 Bacteria 1370
62 Ga0075430_100026051 3300006846 Bacteria 4975
63 Ga0075431_100016776 3300006847 Bacteria 7438
64 Ga0075429_100053273 3300006880 Bacteria 3521
65 Ga0075429_100169637 3300006880 Bacteria 1912
66 Ga0075429_100376558 3300006880 Bacteria 1243
67 Ga0068865_100103272 3300006881 Bacteria 2090
68 Ga0097620_100300835 3300006931 Bacteria 1697
69 Ga0075435_100277330 3300007076 Bacteria 1431
70 Ga0111539_10010623 3300009094 Bacteria 11592
71 Ga0111539_10055360 3300009094 Bacteria 4715
72 Ga0111539_10180867 3300009094 Bacteria 2462
73 Ga0111539_10585278 3300009094 Bacteria 1300
74 Ga0105245_10103339 3300009098 Bacteria 2640
75 Ga0105245_10296886 3300009098 Bacteria 1584
76 Ga0105245_10408016 3300009098 Bacteria 1359
77 Ga0105247_10188643 3300009101 Bacteria 1379
78 Ga0114129_10188479 3300009147 Bacteria 2802
79 Ga0114129_10789257 3300009147 Bacteria 1212
80 Ga0114129_11085233 3300009147 Bacteria 1003
81 Ga0114129_11474662 3300009147 Bacteria 837
82 Ga0105243_10253310 3300009148 Bacteria 1573
83 Ga0105243_10317499 3300009148 Bacteria 1418
84 Ga0105243_10713823 3300009148 Bacteria 979
85 Ga0105237_10003606 3300009545 Bacteria 18291
86 Ga0105249_10372790 3300009553 Bacteria 1451
87 Ga0105249_10406239 3300009553 Bacteria 1393
88 Ga0105239_10095732 3300010375 Bacteria 3279
89 Ga0105246_10038051 3300011119 Bacteria 3232
90 Ga0157369_10935620 3300013105 Bacteria 888
91 Ga0157374_10701205 3300013296 Bacteria 1025
92 Ga0163162_10401219 3300013306 Bacteria 1504
93 Ga0157372_10779476 3300013307 Bacteria 1111
94 Ga0157375_10188353 3300013308 Bacteria 2217
95 Ga0157375_10379770 3300013308 Bacteria 1580
96 Ga0163163_10182666 3300014325 Bacteria 2145
97 Ga0163163_10522204 3300014325 Bacteria 1250
98 Ga0157380_10817775 3300014326 Bacteria 950
99 Ga0157377_10086704 3300014745 Bacteria 1841
100 Ga0157377_10262400 3300014745 Bacteria 1125
101 Ga0157379_10047840 3300014968 Bacteria 3817
102 Ga0157376_10003520 3300014969 Bacteria 10800
103 Ga0157376_10124362 3300014969 Bacteria 2291
104 Ga0207692_10000001 3300025898 Bacteria 558345
105 Ga0207692_10019242 3300025898 Bacteria 3082
106 Ga0207692_10091891 3300025898 Bacteria 1648
107 Ga0207688_10004383 3300025901 Bacteria 7686
108 Ga0207685_10292723 3300025905 Bacteria 803
109 Ga0207699_10015329 3300025906 Bacteria 3979
110 Ga0207699_10132849 3300025906 Bacteria 1626
111 Ga0207705_10087207 3300025909 Bacteria 2282
112 Ga0207707_10092160 3300025912 Bacteria 2648
113 Ga0207693_10000001 3300025915 Bacteria 469535
114 Ga0207693_10000905 3300025915 Bacteria 26632
115 Ga0207693_10231540 3300025915 Bacteria 1451
116 Ga0207693_10289581 3300025915 Bacteria 1283
117 Ga0207662_10022872 3300025918 Bacteria 3588
118 Ga0207657_10002761 3300025919 Bacteria 18903
119 Ga0207657_10030237 3300025919 Bacteria 4918
120 Ga0207657_10050060 3300025919 Bacteria 3637
121 Ga0207657_10070903 3300025919 Bacteria 2952
122 Ga0207652_10074078 3300025921 Bacteria 2964
123 Ga0207681_10067856 3300025923 Bacteria 2474
124 Ga0207687_10114806 3300025927 Bacteria 2005
125 Ga0207687_10120207 3300025927 Bacteria 1963
126 Ga0207664_10000035 3300025929 Bacteria 173780
127 Ga0207664_10026250 3300025929 Bacteria 4401
128 Ga0207664_10895766 3300025929 Bacteria 797
129 Ga0207690_10000024 3300025932 Bacteria 194416
130 Ga0207706_10046448 3300025933 Bacteria 3844
131 Ga0207709_10662849 3300025935 Bacteria 832
132 Ga0207670_10097682 3300025936 Bacteria 2091
133 Ga0207704_10748513 3300025938 Bacteria 813
134 Ga0207665_10177756 3300025939 Bacteria 1540
135 Ga0207665_10420277 3300025939 Bacteria 1021
136 Ga0207711_10349861 3300025941 Bacteria 1368
137 Ga0207661_10017781 3300025944 Bacteria 5269
138 Ga0207679_10168513 3300025945 Bacteria 1800
139 Ga0207679_10663033 3300025945 Bacteria 944
140 Ga0207640_10104846 3300025981 Bacteria 1991
141 Ga0207677_10399646 3300026023 Bacteria 1165
142 Ga0207708_10086584 3300026075 Bacteria 2411
143 Ga0207708_10467545 3300026075 Bacteria 1053
144 Ga0207702_10171621 3300026078 Bacteria 1989
145 Ga0207702_10178680 3300026078 Bacteria 1953
146 Ga0207641_10000231 3300026088 Bacteria 72245
147 Ga0207648_10026941 3300026089 Bacteria 5105
148 Ga0207648_10269549 3300026089 Bacteria 1521
149 Ga0207674_10058157 3300026116 Bacteria 3918
150 Ga0207675_100279362 3300026118 Bacteria 1622
151 Ga0207675_100885968 3300026118 Bacteria 908
152 Ga0207683_10145029 3300026121 Bacteria 2140
153 Ga0268266_10397434 3300028379 Bacteria 1303
154 Ga0265326_10000004 3300028558 Bacteria 283947
155 Ga0265319_1009335 3300028563 Bacteria 4187
156 Ga0265319_1023416 3300028563 Bacteria 2239
157 Ga0265334_10000019 3300028573 Bacteria 143921
158 Ga0265318_10017672 3300028577 Bacteria 2923
159 Ga0265336_10001891 3300028666 Bacteria 9055
160 Ga0265338_10024697 3300028800 Bacteria 6131
161 Ga0265338_10158251 3300028800 Bacteria 1752
162 Ga0265324_10004148 3300029957 Bacteria 6625
163 Ga0265320_10025596 3300031240 Bacteria 3100
164 Ga0265320_10072063 3300031240 Bacteria 1626
165 Ga0307408_100822874 3300031548 Bacteria 844
166 Ga0307405_10139659 3300031731 Bacteria 1687
167 Ga0307413_10396869 3300031824 Bacteria 1079
168 Ga0307413_10410394 3300031824 Bacteria 1064
169 Ga0307410_10188360 3300031852 Bacteria 1567
170 Ga0307406_10025903 3300031901 Bacteria 3515
171 Ga0307407_10130652 3300031903 Bacteria 1606
172 Ga0307407_10175017 3300031903 Bacteria 1417
173 Ga0307409_100122425 3300031995 Bacteria 2206
174 Ga0307416_100027544 3300032002 Bacteria 4211
175 Ga0307416_100032942 3300032002 Bacteria 3922
176 Ga0307416_100047344 3300032002 Bacteria 3403
177 Ga0307416_100417788 3300032002 Bacteria 1384
178 Ga0307416_100568973 3300032002 Bacteria 1209
179 Ga0307416_100914128 3300032002 Bacteria 978
180 Ga0307414_10031329 3300032004 Bacteria 3487
181 Ga0307414_10375254 3300032004 Bacteria 1228
182 Ga0307411_10156176 3300032005 Bacteria 1702
183 Ga0307411_10463686 3300032005 Bacteria 1063
184 Ga0307415_100027835 3300032126 Bacteria 3587
185 Ga0307415_100793304 3300032126 Bacteria 864
186 Ga0373929_0070158 3300035085 Bacteria 837
187 Ga0373954_0230962 3300035118 Bacteria 910
188 Ga0373960_0045343 3300035121 Bacteria 1287
189 Ga0373943_0091312 3300035170 Bacteria 1578
190 Ga0373955_0214655 3300035172 Bacteria 1148
191 Ga0373924_0060254 3300035410 Bacteria 1587
192 Ga0373935_0369942 3300035692 Bacteria 1025
193 Ga0373933_0132660 3300035724 Bacteria 1567
194 Ga0373947_0225268 3300035725 Bacteria 1234
195 Ga0373937_0156288 3300036401 Bacteria 2137
196 Ga0373925_0113917 3300037068 Bacteria 2092
197 Ga0395900_0005227 3300037418 Bacteria 13620
198 Ga0395898_0033386 3300037466 Bacteria 5137
199 Ga0395898_0050252 3300037466 Bacteria 4082
200 Ga0395898_0224041 3300037466 Bacteria 1794
201 Ga0436364_0746758 3300037853 Bacteria 4133
202 Ga0436364_1036677 3300037853 Bacteria 11971
203 Ga0395901_0010754 3300038443 Bacteria 9278
204 Ga0395901_0271512 3300038443 Bacteria 1764
205 Ga0436365_0120316 3300039437 Bacteria 4840
206 Ga0436365_0373262 3300039437 Bacteria 2527
207 Ga0436365_0728883 3300039437 Bacteria 6384
208 Ga0436365_1531678 3300039437 Bacteria 1855
209 Ga0436365_1652791 3300039437 Bacteria 22443
210 Ga0436362_0453953 3300039453 Bacteria 912
211 Ga0436362_1303826 3300039453 Bacteria 1663
212 Ga0466969_0007598 3300044656 Bacteria 5762
213 Ga0466969_0025325 3300044656 Bacteria 3051
214 Ga0466965_0166947 3300044683 Bacteria 1156
215 Ga0466965_0354123 3300044683 Bacteria 805
216 Ga0466966_0062725 3300044684 Bacteria 2343
217 Ga0466966_0079696 3300044684 Bacteria 2041
218 Ga0466966_0113466 3300044684 Bacteria 1669
219 Ga0466961_0035299 3300044693 Bacteria 3211
220 Ga0466963_0000529 3300044694 Bacteria 17918
221 Ga0466963_0013444 3300044694 Bacteria 5026
222 Ga0466963_0268061 3300044694 Bacteria 1199
223 Ga0466971_0004371 3300044719 Bacteria 6097
224 Ga0466971_0018488 3300044719 Bacteria 3087
225 Ga0466971_0126847 3300044719 Bacteria 1183
226 Ga0466968_0003736 3300044735 Bacteria 5643
227 Ga0466968_0011029 3300044735 Bacteria 3515
228 Ga0466968_0087961 3300044735 Bacteria 1373
229 Ga0466968_0103171 3300044735 Bacteria 1275
230 Ga0466968_0206440 3300044735 Bacteria 921
231 Ga0466970_0028628 3300044765 Bacteria 2929
232 Ga0466970_0049211 3300044765 Bacteria 2248
233 Ga0466957_0018548 3300044842 Bacteria 4086
234 Ga0466957_0021739 3300044842 Bacteria 3781
235 Ga0466957_0071497 3300044842 Bacteria 2146
236 Ga0466957_0405401 3300044842 Bacteria 933
237 Ga0466960_0036221 3300044901 Bacteria 2310
238 Ga0466960_0043429 3300044901 Bacteria 2138
239 Ga0466960_0082819 3300044901 Bacteria 1620
240 Ga0466960_0088648 3300044901 Bacteria 1573
241 Ga0466960_0164947 3300044901 Bacteria 1192
242 Ga0466960_0170816 3300044901 Bacteria 1173
243 Ga0466959_0003948 3300045049 Bacteria 9853
244 Ga0466959_0012139 3300045049 Bacteria 6216
245 Ga0466959_0015753 3300045049 Bacteria 5514
246 Ga0466958_0013729 3300045836 Bacteria 4616
247 Ga0466958_0034665 3300045836 Bacteria 3012
248 Ga0466958_0182387 3300045836 Bacteria 1332
249 Ga0466958_0192796 3300045836 Bacteria 1295
250 Ga0466967_0001903 3300045976 Bacteria 12605
251 Ga0466967_0089830 3300045976 Bacteria 2790
252 Ga0466967_0093743 3300045976 Bacteria 2733
253 Ga0466967_1070098 3300045976 Bacteria 803
254 Ga0495592_0085609 3300046454 Bacteria 2272
255 Ga0495603_0301232 3300046455 Bacteria 921
256 Ga0495651_0087392 3300046462 Bacteria 2344
257 Ga0495653_0037735 3300046463 Bacteria 3794
258 Ga0495664_0255201 3300046477 Bacteria 1060
259 Ga0495596_0146772 3300046500 Bacteria 916
260 Ga0495608_0020569 3300046511 Bacteria 4536
261 Ga0495616_0140272 3300046513 Bacteria 1101
262 Ga0495628_0126565 3300046516 Bacteria 1957
263 Ga0495631_0105592 3300046518 Bacteria 1212
264 Ga0495652_0128138 3300046529 Bacteria 2013
265 Ga0495640_0103548 3300046533 Bacteria 1866
266 Ga0495587_0143916 3300046536 Bacteria 1359
267 Ga0495645_0253656 3300046543 Bacteria 1168
268 Ga0495667_0113668 3300046559 Bacteria 1749
269 Ga0495634_0088894 3300046642 Bacteria 2009
270 Ga0495611_0149199 3300046648 Bacteria 1092
271 Ga0495635_0021686 3300046663 Bacteria 4477
272 Ga0495657_0027265 3300046675 Bacteria 4034
273 Ga0495599_0222419 3300046678 Bacteria 1154
274 Ga0495646_0226687 3300046680 Bacteria 1008
275 Ga0495613_0272139 3300046689 Bacteria 1178
276 Ga0495670_0062107 3300046691 Bacteria 1879
277 Ga0495589_0105750 3300046794 Bacteria 1360
278 Ga0495600_0076791 3300046809 Bacteria 2181
279 Ga0495604_0227650 3300047317 Bacteria 1280
280 Ga0495674_0063749 3300047319 Bacteria 3205
281 Ga0495674_0218867 3300047319 Bacteria 1575
282 Ga0495672_0095582 3300047320 Bacteria 1622
283 Ga0495676_0122363 3300047321 Bacteria 1891
284 Ga0495680_0034864 3300047322 Bacteria 4059
285 Ga0495684_0022485 3300047471 Bacteria 4851
286 Ga0495684_0044022 3300047471 Bacteria 3417
287 Ga0495684_0448786 3300047471 Bacteria 897
288 Ga0495686_0026127 3300047472 Bacteria 3822
289 Ga0495593_0035828 3300047673 Bacteria 2692
290 Ga0495602_0140229 3300048088 Bacteria 1914
291 Ga0496100_0003477 3300048903 Bacteria 8219
292 Ga0496100_0159183 3300048903 Bacteria 1617
293 Ga0496101_0000505 3300048904 Bacteria 24566
294 Ga0496102_0053500 3300048905 Bacteria 3679
295 Ga0496102_0296705 3300048905 Bacteria 1523
296 Ga0496103_0115732 3300048906 Bacteria 1705
297 Ga0496104_0125249 3300048907 Bacteria 2467
298 Ga0496104_0291251 3300048907 Bacteria 1545
299 Ga0496105_0285999 3300048908 Bacteria 1328
300 Ga0496106_0073562 3300048909 Bacteria 2614
301 Ga0496107_0181024 3300048910 Bacteria 1565
302 Ga0496108_0025366 3300048911 Bacteria 4884
303 Ga0496109_0020718 3300048912 Bacteria 5807
304 Ga0496109_0711983 3300048912 Bacteria 941
305 Ga0496110_0056111 3300048913 Bacteria 3466
306 Ga0496111_0007441 3300048914 Bacteria 7177
307 Ga0496111_0112187 3300048914 Bacteria 2009
308 Ga0496112_0019581 3300048915 Bacteria 6391
309 Ga0496112_0370822 3300048915 Bacteria 1373
310 Ga0496113_0029403 3300048916 Bacteria 3967
311 Ga0496113_0036648 3300048916 Bacteria 3595
312 Ga0496114_0029049 3300048917 Bacteria 4542
313 Ga0496114_0304265 3300048917 Bacteria 1408
314 Ga0496115_0000023 3300048918 Bacteria 163267
315 Ga0496115_0000041 3300048918 Bacteria 122947
316 Ga0496115_0053073 3300048918 Bacteria 3253
317 Ga0496115_0101413 3300048918 Bacteria 2360
318 Ga0496121_0009587 3300048924 Bacteria 11093
319 Ga0496122_0080762 3300048925 Bacteria 2266
320 Ga0501031_0005839 3300049568 Bacteria 8022
321 Ga0501032_0015038 3300049569 Bacteria 5469
322 Ga0501033_0021431 3300049570 Bacteria 4875
323 Ga0501034_0073096 3300049571 Bacteria 3437
324 Ga0501036_0027155 3300049572 Bacteria 4836
325 Ga0501037_0040630 3300049573 Bacteria 3422
326 Ga0501038_0011467 3300049574 Bacteria 8086
327 Ga0501039_0022091 3300049575 Bacteria 4883
328 Ga0501039_0167438 3300049575 Bacteria 1728
329 Ga0501040_0169191 3300049576 Bacteria 1547
330 Ga0501042_0109532 3300049578 Bacteria 1989
331 Ga0501043_0034170 3300049579 Bacteria 3999
332 Ga0501046_0097103 3300049580 Bacteria 2263
333 Ga0501047_0292150 3300049581 Bacteria 1473
334 Ga0501048_0082773 3300049582 Bacteria 2263
335 Ga0501067_0012231 3300049583 Bacteria 4756
336 Ga0501068_0005744 3300049584 Bacteria 6803
337 Ga0501069_0026945 3300049585 Bacteria 3148
338 Ga0501070_0025397 3300049586 Bacteria 4969
339 Ga0501071_0017769 3300049587 Bacteria 4913
340 Ga0501072_0121169 3300049588 Bacteria 2084
341 Ga0501073_0091485 3300049589 Bacteria 2114
342 Ga0501074_0012687 3300049590 Bacteria 6127
343 Ga0501079_0125394 3300049741 Bacteria 1998
344 Ga0501080_0030269 3300049742 Bacteria 5043
345 Ga0501080_0035075 3300049742 Bacteria 4683
346 Ga0501083_0031257 3300049744 Bacteria 3654
347 Ga0501035_0004772 3300049822 Bacteria 12867
348 Ga0501044_0040713 3300049823 Bacteria 4841
349 Ga0501045_0250696 3300049824 Bacteria 1318
350 nmdc:mga05p37_1161541_c1 3300050507 Bacteria 802
351 nmdc:mga05p37_3346_c1 3300050507 Bacteria 18695
352 nmdc:mga05p37_393368_c1 3300050507 Bacteria 1620
353 nmdc:mga05p37_911798_c1 3300050507 Bacteria 946
354 nmdc:mga09592_124028_c1 3300050508 Bacteria 2220
355 nmdc:mga09592_239861_c1 3300050508 Bacteria 1571
356 nmdc:mga09592_410105_c1 3300050508 Bacteria 1171
357 nmdc:mga0qj67_37674_c1 3300050509 Bacteria 3790
358 nmdc:mga0qj67_531155_c1 3300050509 Bacteria 944
359 nmdc:mga0qj67_85407_c1 3300050509 Bacteria 2531
360 nmdc:mga06r32_176470_c1 3300050510 Bacteria 2121
361 nmdc:mga06r32_279523_c1 3300050510 Bacteria 1656
362 nmdc:mga08y16_19647_c1 3300050511 Bacteria 7124
363 nmdc:mga08y16_260368_c1 3300050511 Bacteria 1791
364 nmdc:mga08y16_263954_c1 3300050511 Bacteria 1778
365 nmdc:mga08y16_370204_c1 3300050511 Bacteria 1470
366 nmdc:mga0rr50_317635_c1 3300050513 Bacteria 1305
367 Ga0495601_0137174 3300053077 Bacteria 1595
368 Ga0495612_0132358 3300053078 Bacteria 1078
369 Ga0495612_0250935 3300053078 Bacteria 787
370 Ga0495619_0015270 3300053085 Bacteria 4856
371 Ga0500556_0001562 3300053104 Bacteria 9304
372 Ga0500614_036078 3300053123 Bacteria 1235
373 Ga0500616_0010915 3300053153 Bacteria 5408
374 Ga0500599_018523 3300053736 Bacteria 974
375 Ga0501084_0077452 3300054114 Bacteria 2788
376 Ga0466962_0009436 3300061719 Bacteria 4678
377 Ga0466962_0052977 3300061719 Bacteria 1939
378 Ga0466962_0211748 3300061719 Bacteria 948
379 Ga0265319_1010615
380 Ga0070658_10084127
381 Ga0070658_10111702
382 Ga0070683_100169470
383 Ga0070670_100124957
384 Ga0070682_100026759
385 Ga0070682_100142909
386 Ga0070682_100342617
387 Ga0070660_100041823
388 Ga0070660_100043900
389 Ga0070660_100047097
390 Ga0070689_100130425
391 Ga0070687_100390495
392 Ga0070661_100201490
393 Ga0070668_100213412
394 Ga0070671_100480011
395 Ga0070688_100045831
396 Ga0070659_100000002
397 Ga0070659_100141565
398 Ga0070709_10147170
399 Ga0070714_100000170
400 Ga0070710_10000006
401 Ga0070710_10110946
402 Ga0070710_10171472
403 Ga0070701_10099287
404 Ga0070711_100117223
405 Ga0070705_100001402
406 Ga0070708_100329784
407 Ga0070681_10124109
408 Ga0070685_10029920
409 Ga0070679_100187362
410 Ga0070684_100015188
411 Ga0070686_100332849
412 Ga0070704_100249251
413 Ga0070664_100166335
414 Ga0068856_100009716
415 Ga0068856_100345783
416 Ga0070702_100021732
417 Ga0070702_100024690
418 Ga0070702_100513799
419 Ga0068859_100300838
420 Ga0068864_100118670
421 Ga0068866_10050981
422 Ga0068861_100455224
423 Ga0068863_100000042
424 Ga0081455_10013826
425 Ga0081538_10000021
426 Ga0081538_10021721
427 Ga0081540_1000427
428 Ga0070717_10000005
429 Ga0070717_10161538
430 Ga0070717_10297861
431 Ga0075432_10016872
432 Ga0075432_10104701
433 Ga0070716_100027230
434 Ga0070712_100000036
435 Ga0070712_100325445
436 Ga0070712_100781851
437 Ga0075428_100037073
438 Ga0075428_100130592
439 Ga0075428_100455319
440 Ga0075430_100026051
441 Ga0075431_100016776
442 Ga0075429_100053273
443 Ga0075429_100169637
444 Ga0075429_100376558
445 Ga0068865_100103272
446 Ga0097620_100300835
447 Ga0075435_100277330
448 Ga0111539_10010623
449 Ga0111539_10055360
450 Ga0111539_10180867
451 Ga0111539_10585278
452 Ga0105245_10103339
453 Ga0105245_10296886
454 Ga0105245_10408016
455 Ga0105247_10188643
456 Ga0114129_10188479
457 Ga0114129_10789257
458 Ga0114129_11085233
459 Ga0114129_11474662
460 Ga0105243_10253310
461 Ga0105243_10317499
462 Ga0105243_10713823
463 Ga0105237_10003606
464 Ga0105249_10372790
465 Ga0105249_10406239
466 Ga0105239_10095732
467 Ga0105246_10038051
468 Ga0157369_10935620
469 Ga0157374_10701205
470 Ga0163162_10401219
471 Ga0157372_10779476
472 Ga0157375_10188353
473 Ga0157375_10379770
474 Ga0163163_10182666
475 Ga0163163_10522204
476 Ga0157380_10817775
477 Ga0157377_10086704
478 Ga0157377_10262400
479 Ga0157379_10047840
480 Ga0157376_10003520
481 Ga0157376_10124362
482 Ga0207692_10000001
483 Ga0207692_10019242
484 Ga0207692_10091891
485 Ga0207688_10004383
486 Ga0207685_10292723
487 Ga0207699_10015329
488 Ga0207699_10132849
489 Ga0207705_10087207
490 Ga0207707_10092160
491 Ga0207693_10000001
492 Ga0207693_10000905
493 Ga0207693_10231540
494 Ga0207693_10289581
495 Ga0207662_10022872
496 Ga0207657_10002761
497 Ga0207657_10030237
498 Ga0207657_10050060
499 Ga0207657_10070903
500 Ga0207652_10074078
501 Ga0207681_10067856
502 Ga0207687_10114806
503 Ga0207687_10120207
504 Ga0207664_10000035
505 Ga0207664_10026250
506 Ga0207664_10895766
507 Ga0207690_10000024
508 Ga0207706_10046448
509 Ga0207709_10662849
510 Ga0207670_10097682
511 Ga0207704_10748513
512 Ga0207665_10177756
513 Ga0207665_10420277
514 Ga0207711_10349861
515 Ga0207661_10017781
516 Ga0207679_10168513
517 Ga0207679_10663033
518 Ga0207640_10104846
519 Ga0207677_10399646
520 Ga0207708_10086584
521 Ga0207708_10467545
522 Ga0207702_10171621
523 Ga0207702_10178680
524 Ga0207641_10000231
525 Ga0207648_10026941
526 Ga0207648_10269549
527 Ga0207674_10058157
528 Ga0207675_100279362
529 Ga0207675_100885968
530 Ga0207683_10145029
531 Ga0268266_10397434
532 Ga0265326_10000004
533 Ga0265319_1009335
534 Ga0265319_1023416
535 Ga0265334_10000019
536 Ga0265318_10017672
537 Ga0265336_10001891
538 Ga0265338_10024697
539 Ga0265338_10158251
540 Ga0265324_10004148
541 Ga0265320_10025596
542 Ga0265320_10072063
543 Ga0307408_100822874
544 Ga0307405_10139659
545 Ga0307413_10396869
546 Ga0307413_10410394
547 Ga0307410_10188360
548 Ga0307406_10025903
549 Ga0307407_10130652
550 Ga0307407_10175017
551 Ga0307409_100122425
552 Ga0307416_100027544
553 Ga0307416_100032942
554 Ga0307416_100047344
555 Ga0307416_100417788
556 Ga0307416_100568973
557 Ga0307416_100914128
558 Ga0307414_10031329
559 Ga0307414_10375254
560 Ga0307411_10156176
561 Ga0307411_10463686
562 Ga0307415_100027835
563 Ga0307415_100793304
564 Ga0373929_0070158
565 Ga0373954_0230962
566 Ga0373960_0045343
567 Ga0373943_0091312
568 Ga0373955_0214655
569 Ga0373924_0060254
570 Ga0373935_0369942
571 Ga0373933_0132660
572 Ga0373947_0225268
573 Ga0373937_0156288
574 Ga0373925_0113917
575 Ga0395900_0005227
576 Ga0395898_0033386
577 Ga0395898_0050252
578 Ga0395898_0224041
579 Ga0436364_0746758
580 Ga0436364_1036677
581 Ga0395901_0010754
582 Ga0395901_0271512
583 Ga0436365_0120316
584 Ga0436365_0373262
585 Ga0436365_0728883
586 Ga0436365_1531678
587 Ga0436365_1652791
588 Ga0436362_0453953
589 Ga0436362_1303826
590 Ga0466969_0007598
591 Ga0466969_0025325
592 Ga0466965_0166947
593 Ga0466965_0354123
594 Ga0466966_0062725
595 Ga0466966_0079696
596 Ga0466966_0113466
597 Ga0466961_0035299
598 Ga0466963_0000529
599 Ga0466963_0013444
600 Ga0466963_0268061
601 Ga0466971_0004371
602 Ga0466971_0018488
603 Ga0466971_0126847
604 Ga0466968_0003736
605 Ga0466968_0011029
606 Ga0466968_0087961
607 Ga0466968_0103171
608 Ga0466968_0206440
609 Ga0466970_0028628
610 Ga0466970_0049211
611 Ga0466957_0018548
612 Ga0466957_0021739
613 Ga0466957_0071497
614 Ga0466957_0405401
615 Ga0466960_0036221
616 Ga0466960_0043429
617 Ga0466960_0082819
618 Ga0466960_0088648
619 Ga0466960_0164947
620 Ga0466960_0170816
621 Ga0466959_0003948
622 Ga0466959_0012139
623 Ga0466959_0015753
624 Ga0466958_0013729
625 Ga0466958_0034665
626 Ga0466958_0182387
627 Ga0466958_0192796
628 Ga0466967_0001903
629 Ga0466967_0089830
630 Ga0466967_0093743
631 Ga0466967_1070098
632 Ga0495592_0085609
633 Ga0495603_0301232
634 Ga0495651_0087392
635 Ga0495653_0037735
636 Ga0495664_0255201
637 Ga0495596_0146772
638 Ga0495608_0020569
639 Ga0495616_0140272
640 Ga0495628_0126565
641 Ga0495631_0105592
642 Ga0495652_0128138
643 Ga0495640_0103548
644 Ga0495587_0143916
645 Ga0495645_0253656
646 Ga0495667_0113668
647 Ga0495634_0088894
648 Ga0495611_0149199
649 Ga0495635_0021686
650 Ga0495657_0027265
651 Ga0495599_0222419
652 Ga0495646_0226687
653 Ga0495613_0272139
654 Ga0495670_0062107
655 Ga0495589_0105750
656 Ga0495600_0076791
657 Ga0495604_0227650
658 Ga0495674_0063749
659 Ga0495674_0218867
660 Ga0495672_0095582
661 Ga0495676_0122363
662 Ga0495680_0034864
663 Ga0495684_0022485
664 Ga0495684_0044022
665 Ga0495684_0448786
666 Ga0495686_0026127
667 Ga0495593_0035828
668 Ga0495602_0140229
669 Ga0496100_0003477
670 Ga0496100_0159183
671 Ga0496101_0000505
672 Ga0496102_0053500
673 Ga0496102_0296705
674 Ga0496103_0115732
675 Ga0496104_0125249
676 Ga0496104_0291251
677 Ga0496105_0285999
678 Ga0496106_0073562
679 Ga0496107_0181024
680 Ga0496108_0025366
681 Ga0496109_0020718
682 Ga0496109_0711983
683 Ga0496110_0056111
684 Ga0496111_0007441
685 Ga0496111_0112187
686 Ga0496112_0019581
687 Ga0496112_0370822
688 Ga0496113_0029403
689 Ga0496113_0036648
690 Ga0496114_0029049
691 Ga0496114_0304265
692 Ga0496115_0000023
693 Ga0496115_0000041
694 Ga0496115_0053073
695 Ga0496115_0101413
696 Ga0496121_0009587
697 Ga0496122_0080762
698 Ga0501031_0005839
699 Ga0501032_0015038
700 Ga0501033_0021431
701 Ga0501034_0073096
702 Ga0501036_0027155
703 Ga0501037_0040630
704 Ga0501038_0011467
705 Ga0501039_0022091
706 Ga0501039_0167438
707 Ga0501040_0169191
708 Ga0501042_0109532
709 Ga0501043_0034170
710 Ga0501046_0097103
711 Ga0501047_0292150
712 Ga0501048_0082773
713 Ga0501067_0012231
714 Ga0501068_0005744
715 Ga0501069_0026945
716 Ga0501070_0025397
717 Ga0501071_0017769
718 Ga0501072_0121169
719 Ga0501073_0091485
720 Ga0501074_0012687
721 Ga0501079_0125394
722 Ga0501080_0030269
723 Ga0501080_0035075
724 Ga0501083_0031257
725 Ga0501035_0004772
726 Ga0501044_0040713
727 Ga0501045_0250696
728 nmdc:mga05p37_1161541_c1
729 nmdc:mga05p37_3346_c1
730 nmdc:mga05p37_393368_c1
731 nmdc:mga05p37_911798_c1
732 nmdc:mga09592_124028_c1
733 nmdc:mga09592_239861_c1
734 nmdc:mga09592_410105_c1
735 nmdc:mga0qj67_37674_c1
736 nmdc:mga0qj67_531155_c1
737 nmdc:mga0qj67_85407_c1
738 nmdc:mga06r32_176470_c1
739 nmdc:mga06r32_279523_c1
740 nmdc:mga08y16_19647_c1
741 nmdc:mga08y16_260368_c1
742 nmdc:mga08y16_263954_c1
743 nmdc:mga08y16_370204_c1
744 nmdc:mga0rr50_317635_c1
745 Ga0495601_0137174
746 Ga0495612_0132358
747 Ga0495612_0250935
748 Ga0495619_0015270
749 Ga0500556_0001562
750 Ga0500614_036078
751 Ga0500616_0010915
752 Ga0500599_018523
753 Ga0501084_0077452
754 Ga0466962_0009436
755 Ga0466962_0052977
756 Ga0466962_0211748

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

22

163

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9329 10 209
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9307 10 209
6cvl-assembly1.cif.gz_D crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.9294 11 210
6cvl-assembly1.cif.gz_C crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.9239 11 210
8bms-assembly1.cif.gz_A cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation 0.9183 11 212
ID Description Score Start End Superfamily
af_D3ZCF8_477_737_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.937 9 212 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9307 9 209 3.40.50.300
af_A4HV32_726_961_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9285 8 212 3.40.50.300
af_P37624_8_264_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9284 9 210 3.40.50.300
af_A4HRM7_2286_2560_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9278 10 212 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7J9YT85-F1-model_v4 ATP-binding cassette domain-containing protein 0.9471 1 212 GO:0005524
GO:0016887
AF-A0A2R6XXS0-F1-model_v4 ABC transporter, ATP-binding protein 0.9467 10 209 GO:0005524
GO:0016887
AF-A0A7X8XW61-F1-model_v4 ABC transporter ATP-binding protein 0.9368 8 212 GO:0005524
GO:0005886
GO:0016887
AF-A0A2W7B2T3-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9343 10 205 GO:0005524
GO:0016887
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9339 11 212 GO:0005524
GO:0016887

Map