F428030

General Info

Members Datasets Scaffolds Average Seq Length
378 341 186 112

Family's Representative Sequence

Representative Sequence 3300021321|Ga0214542_1002658|Ga0214542_100265816
Length 127
Sequence MQKTSWLNYRRVKCGMDRLSSTLSALADPTRRAIIARLAAGEATVNELAAPFDMSLPAVSKHLKVLERAGLISRGRNAQWRPCRLEAGRLKEIADWVERYRRFWEGSFDRLDSYLDELQRDGKPDHI

Samples

Sample ID Description Type Environment
1 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
2 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
3 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
4 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
5 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
6 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
7 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
8 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
9 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
10 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
11 2516143018 Ensifer sp. BR816 Isolate Nodule
12 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
13 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
14 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
15 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
16 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
17 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
18 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
19 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
20 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
21 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
22 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
23 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
24 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
25 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
26 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
27 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
28 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
29 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
30 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
31 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
32 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
33 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
34 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
35 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
36 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
37 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
38 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
39 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
40 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
41 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
42 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
43 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
44 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
45 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
46 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
47 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
48 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
49 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
50 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
51 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
52 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
53 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
54 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
55 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
56 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
57 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
58 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
59 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
60 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
61 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
62 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
63 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
64 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
65 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
66 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
67 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
68 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
69 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
70 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
71 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
72 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
73 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
74 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
75 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
76 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
77 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
78 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
79 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
80 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
81 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
82 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
83 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
84 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
85 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
86 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
87 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
88 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
89 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
90 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
91 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
92 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
93 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
94 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
95 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
96 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
97 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
98 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
99 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
100 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
101 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
102 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
103 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
104 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
105 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
106 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
107 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
108 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
109 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
110 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
111 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
112 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
113 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
114 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
115 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
116 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
117 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
118 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
119 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
120 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
121 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
122 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
123 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
124 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
125 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
126 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
127 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
128 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
129 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
130 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
131 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
132 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
133 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
134 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
135 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
136 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
137 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
138 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
139 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
140 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
141 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
142 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
143 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
144 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
145 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
146 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
147 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
148 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
149 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
150 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
151 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
152 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
153 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
154 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
155 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
156 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
157 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
158 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
159 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
160 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
161 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
162 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
163 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
164 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
165 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
166 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
167 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
168 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
169 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
170 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
171 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
172 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
173 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
174 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
175 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
176 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
177 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
178 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
179 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
180 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
181 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
182 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
183 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
184 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
185 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
186 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
187 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
188 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
189 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
190 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
191 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
192 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
193 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
194 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
195 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
196 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
197 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
198 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
199 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
200 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
201 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
202 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
203 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
204 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
205 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
206 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
207 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
208 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
209 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
210 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
211 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
212 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
213 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
214 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
215 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
216 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
217 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
218 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
219 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
220 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
221 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
222 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
223 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
224 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
225 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
226 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
227 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
228 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
229 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
230 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
231 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
232 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
233 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
234 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
235 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
236 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
237 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
238 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
239 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
240 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
254 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
255 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
257 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
258 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
259 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
260 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
261 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
265 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
266 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
267 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
268 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
269 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
270 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
271 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
272 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
273 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
274 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
275 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
276 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
277 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
278 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
279 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
280 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
281 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
282 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
283 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
284 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
285 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
286 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
287 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
288 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
289 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
290 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
291 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
292 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
293 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
294 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
295 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
296 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
297 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
298 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
299 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
300 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
301 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
302 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
303 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
307 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
311 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
315 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
316 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
317 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
318 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
319 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
320 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
321 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
327 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
331 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
332 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
333 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
334 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
340 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
341 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 49.21
Metatranscriptomes 0
Isolates 50.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.17
Nodule 52.65
Rhizoplane 1.06
Rhizosphere 38.36
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10022824 3300003215 Bacteria 2296
2 rootH2_10245581 3300003320 Bacteria 2007
3 Ga0055530_10000014 3300003791 Bacteria 151346
4 Ga0055531_10002273 3300003794 Bacteria 12998
5 Ga0065165_1001235 3300005262 Bacteria 29240
6 Ga0070683_100509193 3300005329 Bacteria 1150
7 Ga0070670_100336181 3300005331 Bacteria 1325
8 Ga0068868_100000093 3300005338 Bacteria 54811
9 Ga0070671_102085088 3300005355 Bacteria 505
10 Ga0070709_10033606 3300005434 Bacteria 3103
11 Ga0070708_100363478 3300005445 Bacteria 1364
12 Ga0070698_100319732 3300005471 Bacteria 1483
13 Ga0070698_100536445 3300005471 Bacteria 1109
14 Ga0070684_100526280 3300005535 Bacteria 1096
15 Ga0070695_100667879 3300005545 Bacteria 822
16 Ga0070695_101058293 3300005545 Bacteria 662
17 Ga0070696_100983910 3300005546 Bacteria 704
18 Ga0070693_100634600 3300005547 Bacteria 775
19 Ga0070665_100490611 3300005548 Bacteria 1239
20 Ga0070665_100607070 3300005548 Bacteria 1107
21 Ga0070665_101260770 3300005548 Bacteria 749
22 Ga0070704_100118650 3300005549 Bacteria 2027
23 Ga0068852_100324836 3300005616 Bacteria 1495
24 Ga0068864_100007201 3300005618 Bacteria 9139
25 Ga0068863_100000157 3300005841 Bacteria 72136
26 Ga0068863_100736221 3300005841 Bacteria 981
27 Ga0068858_100000147 3300005842 Bacteria 74022
28 Ga0068858_100293442 3300005842 Bacteria 1550
29 Ga0075365_10019894 3300006038 Bacteria 4153
30 Ga0070715_10359238 3300006163 Bacteria 798
31 Ga0070716_100003568 3300006173 Bacteria 7344
32 Ga0097621_100340370 3300006237 Bacteria 1332
33 Ga0068871_100134672 3300006358 Bacteria 2098
34 Ga0075433_10842154 3300006852 Bacteria 801
35 Ga0075436_100026935 3300006914 Bacteria 3959
36 Ga0105250_10031163 3300009092 Bacteria 2141
37 Ga0111539_10515033 3300009094 Unclassified 1393
38 Ga0105245_10614758 3300009098 Unclassified 1114
39 Ga0105248_10229678 3300009177 Bacteria 2089
40 Ga0105248_11058932 3300009177 Bacteria 916
41 Ga0105248_11068491 3300009177 Bacteria 912
42 Ga0105237_10000071 3300009545 Bacteria 135695
43 Ga0105238_10000736 3300009551 Bacteria 34203
44 Ga0105238_10007170 3300009551 Bacteria 11147
45 Ga0099796_10404754 3300010159 Bacteria 599
46 Ga0105239_10003871 3300010375 Bacteria 18156
47 Ga0105239_10594261 3300010375 Bacteria 1262
48 Ga0157378_10017044 3300013297 Bacteria 6368
49 Ga0163162_12455552 3300013306 Bacteria 599
50 Ga0157375_11019284 3300013308 Bacteria 967
51 Ga0157375_11284632 3300013308 Bacteria 860
52 Ga0163163_10141410 3300014325 Bacteria 2449
53 Ga0157379_10047497 3300014968 Bacteria 3829
54 Ga0157376_13119733 3300014969 Bacteria 502
55 Ga0214544_1004166 3300021320 Bacteria 29216
56 Ga0214542_1002658 3300021321 Bacteria 36789
57 Ga0214543_1002392 3300021327 Bacteria 36788
58 Ga0213876_10064609 3300021384 Bacteria 1931
59 Ga0228711_1002153 3300022739 Bacteria 29962
60 Ga0228710_1000012 3300022740 Bacteria 148650
61 Ga0209758_1000817 3300025297 Bacteria 43865
62 Ga0209050_1000034 3300025298 Bacteria 433906
63 Ga0209257_1000052 3300025304 Bacteria 430947
64 Ga0207699_10027455 3300025906 Bacteria 3152
65 Ga0207671_10000727 3300025914 Bacteria 41799
66 Ga0207694_10001582 3300025924 Bacteria 19287
67 Ga0207694_10055050 3300025924 Bacteria 3088
68 Ga0207644_11033022 3300025931 Bacteria 690
69 Ga0207644_11745699 3300025931 Bacteria 521
70 Ga0207665_10059949 3300025939 Bacteria 2576
71 Ga0207677_10000012 3300026023 Bacteria 194702
72 Ga0207703_10000050 3300026035 Bacteria 145849
73 Ga0207703_10275987 3300026035 Bacteria 1525
74 Ga0207639_10266432 3300026041 Bacteria 1501
75 Ga0207641_10000118 3300026088 Bacteria 117721
76 Ga0207641_10692191 3300026088 Bacteria 1003
77 Ga0207676_10001602 3300026095 Bacteria 16677
78 Ga0207698_10848115 3300026142 Bacteria 918
79 Ga0209281_1000138 3300027111 Bacteria 180979
80 Ga0209281_1002544 3300027111 Bacteria 7153
81 Ga0209282_1000020 3300027666 Bacteria 180986
82 Ga0268266_10000749 3300028379 Bacteria 43458
83 Ga0268266_10147291 3300028379 Bacteria 2118
84 Ga0268266_10548619 3300028379 Bacteria 1107
85 Ga0307515_10765573 3300028794 Bacteria 585
86 Ga0307511_10041514 3300030521 Bacteria 3883
87 Ga0265327_10020067 3300031251 Bacteria 4087
88 Ga0307513_10505093 3300031456 Bacteria 926
89 Ga0307408_100490455 3300031548 Bacteria 1074
90 Ga0307408_100612287 3300031548 Bacteria 969
91 Ga0307408_100993919 3300031548 Bacteria 773
92 Ga0307410_10875953 3300031852 Bacteria 768
93 Ga0307406_10112729 3300031901 Bacteria 1876
94 Ga0307406_10128806 3300031901 Bacteria 1773
95 Ga0307412_12243424 3300031911 Bacteria 509
96 Ga0315914_1002233 3300031967 Bacteria 29620
97 Ga0307409_100670678 3300031995 Bacteria 1033
98 Ga0307416_100105654 3300032002 Bacteria 2465
99 Ga0307416_101169313 3300032002 Bacteria 875
100 Ga0307416_101296092 3300032002 Bacteria 834
101 Ga0307416_101338498 3300032002 Bacteria 822
102 Ga0307414_10235270 3300032004 Bacteria 1513
103 Ga0307411_10530707 3300032005 Bacteria 1001
104 Ga0307415_100117629 3300032126 Bacteria 1985
105 Ga0315913_1000010 3300033430 Bacteria 140890
106 Ga0315915_1000006 3300033464 Bacteria 330709
107 Ga0373934_0017780 3300035086 Bacteria 2716
108 Ga0373923_0038656 3300035111 Bacteria 1957
109 Ga0373923_0260434 3300035111 Bacteria 813
110 Ga0373953_0067511 3300035117 Bacteria 1471
111 Ga0373954_0006404 3300035118 Bacteria 5133
112 Ga0373956_0220019 3300035119 Bacteria 901
113 Ga0373955_0019109 3300035172 Bacteria 3419
114 Ga0373955_0027718 3300035172 Bacteria 2932
115 Ga0373924_0175845 3300035410 Bacteria 941
116 Ga0373935_0142192 3300035692 Bacteria 1622
117 Ga0373935_0585838 3300035692 Bacteria 815
118 Ga0373933_0122974 3300035724 Bacteria 1626
119 Ga0373933_0339989 3300035724 Bacteria 974
120 Ga0373937_0017101 3300036401 Bacteria 6450
121 Ga0373937_0053423 3300036401 Bacteria 3706
122 Ga0373937_0590662 3300036401 Bacteria 1054
123 Ga0373925_0925741 3300037068 Bacteria 718
124 Ga0395899_0010541 3300037312 Bacteria 7080
125 Ga0395900_0533943 3300037418 Bacteria 1119
126 Ga0395898_0043544 3300037466 Bacteria 4422
127 Ga0395905_0196084 3300037471 Bacteria 1893
128 Ga0395905_0848940 3300037471 Bacteria 816
129 Ga0395901_0270738 3300038443 Bacteria 1766
130 Ga0436365_1367961 3300039437 Bacteria 8702
131 Ga0436361_0939192 3300039447 Bacteria 1371
132 Ga0439461_0117597 3300041410 Bacteria 662
133 Ga0439465_0244638 3300041413 Bacteria 662
134 Ga0451843_1040248 3300041509 Bacteria 924
135 Ga0439445_0094591 3300042004 Bacteria 844
136 Ga0439449_0006861 3300042007 Bacteria 4340
137 Ga0450912_004080 3300042116 Bacteria 1070
138 Ga0439446_0049832 3300042156 Bacteria 1249
139 Ga0439446_0069336 3300042156 Bacteria 1076
140 Ga0439434_0091794 3300042435 Bacteria 972
141 Ga0451577_0702689 3300042876 Bacteria 916
142 Ga0495592_0316232 3300046454 Bacteria 1010
143 Ga0495603_0114303 3300046455 Unclassified 1574
144 Ga0495651_0050130 3300046462 Bacteria 3222
145 Ga0495580_0156079 3300046472 Bacteria 1580
146 Ga0495664_0475945 3300046477 Bacteria 747
147 Ga0495628_0901882 3300046516 Bacteria 613
148 Ga0495652_0187040 3300046529 Bacteria 1584
149 Ga0495587_0300882 3300046536 Bacteria 897
150 Ga0495668_0568149 3300046616 Bacteria 626
151 Ga0495674_0258554 3300047319 Bacteria 1431
152 Ga0495684_0014777 3300047471 Bacteria 6012
153 Ga0495686_0267159 3300047472 Bacteria 955
154 Ga0495686_0282338 3300047472 Bacteria 922
155 Ga0495602_0672298 3300048088 Bacteria 705
156 Ga0496102_0060877 3300048905 Bacteria 3454
157 Ga0496102_0210147 3300048905 Bacteria 1835
158 Ga0496103_0113251 3300048906 Bacteria 1724
159 Ga0496115_0202602 3300048918 Bacteria 1639
160 Ga0496116_0093144 3300048919 Bacteria 1825
161 Ga0496117_0010332 3300048920 Bacteria 8530
162 Ga0496118_0002674 3300048921 Bacteria 23560
163 Ga0496119_0104221 3300048922 Bacteria 1587
164 Ga0496120_0190270 3300048923 Bacteria 1001
165 Ga0496121_0000042 3300048924 Bacteria 342304
166 Ga0496121_0397566 3300048924 Bacteria 904
167 Ga0501032_0002346 3300049569 Bacteria 14847
168 Ga0501036_1064918 3300049572 Bacteria 661
169 Ga0501037_0009870 3300049573 Bacteria 7003
170 Ga0501038_0856335 3300049574 Bacteria 673
171 Ga0501043_0089401 3300049579 Bacteria 2421
172 Ga0501067_0002688 3300049583 Bacteria 9816
173 Ga0501068_0014697 3300049584 Bacteria 4479
174 Ga0501068_0717456 3300049584 Unclassified 654
175 Ga0501072_0184881 3300049588 Bacteria 1662
176 Ga0501073_0000003 3300049589 Bacteria 294975
177 Ga0501077_0000192 3300049593 Bacteria 35159
178 Ga0501080_0001563 3300049742 Bacteria 19364
179 Ga0501265_035390 3300049762 Unclassified 736
180 nmdc:mga00v17_666520_c1 3300050491 Bacteria 668
181 nmdc:mga0yw44_1237799_c1 3300050492 Bacteria 503
182 nmdc:mga0yw44_14658_c1 3300050492 Bacteria 4170
183 nmdc:mga07m45_42707_c1 3300050496 Bacteria 2542
184 nmdc:mga08x19_19286_c1 3300050514 Bacteria 4183
185 nmdc:mga0a205_808043_c1 3300050515 Bacteria 785
186 Ga0495619_0341195 3300053085 Bacteria 1037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10019894 Ga0075365_100198946 105
2 3300009094 Ga0111539_10515033 Ga0111539_105150333 105
3 3300050491 nmdc:mga00v17_666520_c1 nmdc:mga00v17_666520_c1_276_593 105
4 3300050492 nmdc:mga0yw44_14658_c1 nmdc:mga0yw44_14658_c1_182_499 105
5 iso_pu_bacteria 2511231052 2511497425 105
6 iso_pu_bacteria 2512875026 2512969894 105
7 iso_pu_bacteria 2513237086 2513581972 105
8 iso_pu_bacteria 2513237089 2513602500 105
9 iso_pu_bacteria 2513237091 2513615217 105
10 iso_pu_bacteria 2513237140 2513886066 105
11 iso_pu_bacteria 2513237143 2513901303 105
12 iso_pu_bacteria 2513237156 2513984294 105
13 iso_pu_bacteria 2513237160 2514004680 105
14 iso_pu_bacteria 2515154107 2515609704 105
15 iso_pu_bacteria 2516143018 2516207894 105
16 iso_pu_bacteria 2517487022 2517565225 105
17 iso_pu_bacteria 2551306084 2551682331 105
18 iso_pu_bacteria 2551306085 2551688524 105
19 iso_pu_bacteria 2551306086 2551694515 105
20 iso_pu_bacteria 2551306087 2551703920 105
21 iso_pu_bacteria 2551306090 2551717795 105
22 iso_pu_bacteria 2551306091 2551727960 105
23 iso_pu_bacteria 2551306092 2551733653 105
24 iso_pu_bacteria 2551306093 2551743437 105
25 iso_pu_bacteria 2802428858 2802716321 105
26 iso_pu_bacteria 2802428859 2802722641 105
27 iso_pu_bacteria 2802428860 2802729217 105
28 iso_pu_bacteria 2802428861 2802735609 105
29 iso_pu_bacteria 2802428862 2802741816 105
30 iso_pu_bacteria 2802428863 2802748265 105
31 iso_pu_bacteria 2855825444 2855828256 105
32 iso_pu_bacteria 2855839649 2855843366 105
33 iso_pu_bacteria 2858800743 2858805614 105
34 iso_pu_bacteria 2915980308 2915984578 105
35 iso_pu_bacteria 2915986958 2915992404 105
36 iso_pu_bacteria 2915993759 2915994088 105
37 iso_pu_bacteria 2916000859 2916006104 105
38 iso_pu_bacteria 2916007675 2916010504 105
39 iso_pu_bacteria 2916014648 2916018659 105
40 iso_pu_bacteria 2916021584 2916024897 105
41 iso_pu_bacteria 2916028427 2916029804 105
42 iso_pu_bacteria 2916035215 2916039894 105
43 iso_pu_bacteria 2916041962 2916045726 105
44 iso_pu_bacteria 2916055098 2916059178 105
45 iso_pu_bacteria 2916061851 2916061944 105
46 iso_pu_bacteria 2916068649 2916072448 105
47 iso_pu_bacteria 2920760137 2920764549 105
48 iso_pu_bacteria 2921201388 2921205845 105
49 iso_pu_bacteria 2921208531 2921211015 105
50 iso_pu_bacteria 2921237296 2921239490 105
51 iso_pu_bacteria 2921244191 2921246902 105
52 iso_pu_bacteria 2921250672 2921255852 105
53 iso_pu_bacteria 2921257292 2921258367 105
54 iso_pu_bacteria 2921263974 2921267197 105
55 iso_pu_bacteria 2921282425 2921284900 105
56 iso_pu_bacteria 2921289301 2921291530 105
57 iso_pu_bacteria 2921296804 2921296888 105
58 iso_pu_bacteria 2924144063 2924144241 105
59 iso_pu_bacteria 2924150972 2924151163 105
60 iso_pu_bacteria 2924158325 2924158494 105
61 iso_pu_bacteria 2924165586 2924166382 105
62 iso_pu_bacteria 2924172951 2924173083 105
63 iso_pu_bacteria 2924179722 2924179788 105
64 iso_pu_bacteria 2924186466 2924186966 105
65 iso_pu_bacteria 2924193448 2924198377 105
66 iso_pu_bacteria 2924200457 2924202393 105
67 iso_pu_bacteria 2924207177 2924210370 105
68 iso_pu_bacteria 2924214083 2924221481 105
69 iso_pu_bacteria 2924221636 2924226933 105
70 iso_pu_bacteria 2924228884 2924230771 105
71 iso_pu_bacteria 2936996657 2936996829 105
72 iso_pu_bacteria 2937002841 2937004844 105
73 iso_pu_bacteria 2937009748 2937013576 105
74 iso_pu_bacteria 2937016420 2937016646 105
75 iso_pu_bacteria 2937023124 2937026505 105
76 iso_pu_bacteria 2937029754 2937030896 105
77 iso_pu_bacteria 2937036028 2937039578 105
78 iso_pu_bacteria 2937042894 2937046802 105
79 iso_pu_bacteria 2937049772 2937054701 105
80 iso_pu_bacteria 2937056579 2937057073 105
81 iso_pu_bacteria 2937063883 2937066966 105
82 iso_pu_bacteria 2937071275 2937073531 105
83 iso_pu_bacteria 2937078374 2937081310 105
84 iso_pu_bacteria 2937084907 2937088035 105
85 iso_pu_bacteria 2937091812 2937095521 105
86 iso_pu_bacteria 2937098957 2937099014 105
87 iso_pu_bacteria 2937106411 2937108842 105
88 iso_pu_bacteria 2937113482 2937119179 105
89 iso_pu_bacteria 2937119839 2937121504 105
90 iso_pu_bacteria 2937126314 2937131740 105
91 iso_pu_bacteria 2957375807 2957377052 105
92 iso_pu_bacteria 2957382221 2957388362 105
93 iso_pu_bacteria 2957388812 2957392290 105
94 iso_pu_bacteria 2957395598 2957395733 105
95 iso_pu_bacteria 2957402308 2957402531 105
96 iso_pu_bacteria 2957415311 2957418446 105
97 iso_pu_bacteria 2957422303 2957429819 105
98 iso_pu_bacteria 2957430029 2957433374 105
99 iso_pu_bacteria 2957437181 2957442933 105
100 iso_pu_bacteria 2957443900 2957444223 105
101 iso_pu_bacteria 2957450854 2957455491 105
102 iso_pu_bacteria 2957457609 2957458607 105
103 iso_pu_bacteria 2957464669 2957468859 105
104 iso_pu_bacteria 2957471148 2957471253 105
105 iso_pu_bacteria 2957478035 2957482708 105
106 iso_pu_bacteria 2957484790 2957488282 105
107 iso_pu_bacteria 2957491536 2957493336 105
108 iso_pu_bacteria 2957498199 2957500913 105
109 iso_pu_bacteria 2957505466 2957508833 105
110 iso_pu_bacteria 2960584000 2960588225 105
111 iso_pu_bacteria 2960591022 2960592319 105
112 iso_pu_bacteria 2960597568 2960599516 105
113 iso_pu_bacteria 2960603979 2960606528 105
114 iso_pu_bacteria 2960617483 2960619388 105
115 iso_pu_bacteria 2960631154 2960631394 105
116 iso_pu_bacteria 2960637947 2960639999 105
117 iso_pu_bacteria 2960645483 2960651063 105
118 iso_pu_bacteria 2960652885 2960652982 105
119 iso_pu_bacteria 2960660292 2960662456 105
120 iso_pu_bacteria 2960667422 2960669186 105
121 iso_pu_bacteria 2960674078 2960678089 105
122 iso_pu_bacteria 2960680706 2960682782 105
123 iso_pu_bacteria 2960693952 2960699433 105
124 iso_pu_bacteria 2964607997 2964612407 105
125 iso_pu_bacteria 2964615318 2964617361 105
126 iso_pu_bacteria 2964621998 2964626187 105
127 iso_pu_bacteria 2964628898 2964630345 105
128 iso_pu_bacteria 2964636051 2964638253 105
129 iso_pu_bacteria 2964643177 2964645188 105
130 iso_pu_bacteria 2964649959 2964651930 105
131 iso_pu_bacteria 2964656573 2964659695 105
132 iso_pu_bacteria 2964663802 2964667249 105
133 iso_pu_bacteria 2964670856 2964676572 105
134 iso_pu_bacteria 2964678106 2964682200 105
135 iso_pu_bacteria 2964685014 2964687724 105
136 iso_pu_bacteria 2964691889 2964695961 105
137 iso_pu_bacteria 2964698721 2964704865 105
138 iso_pu_bacteria 2964705432 2964705654 105
139 iso_pu_bacteria 2964712639 2964714969 105
140 iso_pu_bacteria 2964719344 2964719928 105
141 iso_pu_bacteria 2967664464 2967665093 105
142 iso_pu_bacteria 2967671571 2967675763 105
143 iso_pu_bacteria 2967678726 2967682415 105
144 iso_pu_bacteria 2967686174 2967689089 105
145 iso_pu_bacteria 2967693043 2967697229 105
146 iso_pu_bacteria 2967699805 2967700642 105
147 iso_pu_bacteria 2967706974 2967707092 105
148 iso_pu_bacteria 2967714385 2967717680 105
149 iso_pu_bacteria 2967721400 2967727884 105
150 iso_pu_bacteria 2967728569 2967731643 105
151 iso_pu_bacteria 2967735183 2967740549 105
152 iso_pu_bacteria 2967748971 2967753028 105
153 iso_pu_bacteria 2967755722 2967759182 105
154 iso_pu_bacteria 2967762386 2967766829 105
155 iso_pu_bacteria 2967769361 2967771194 105
156 iso_pu_bacteria 2967775926 2967780264 105
157 iso_pu_bacteria 2970019648 2970022281 105
158 iso_pu_bacteria 2970026789 2970026863 105
159 iso_pu_bacteria 2970033650 2970036300 105
160 iso_pu_bacteria 2970040964 2970041249 105
161 iso_pu_bacteria 2970047711 2970047977 105
162 iso_pu_bacteria 2970054988 2970055124 105
163 iso_pu_bacteria 2970061556 2970065242 105
164 iso_pu_bacteria 2970068827 2970071832 105
165 iso_pu_bacteria 2970076120 2970076205 105
166 iso_pu_bacteria 2970082768 2970082950 105
167 iso_pu_bacteria 2970088815 2970090921 105
168 iso_pu_bacteria 2970095765 2970102231 105
169 iso_pu_bacteria 2970102677 2970104858 105
170 iso_pu_bacteria 2970109326 2970109495 105
171 iso_pu_bacteria 2970116247 2970116286 105
172 iso_pu_bacteria 2970122695 2970124795 105
173 iso_pu_bacteria 2970129317 2970132670 105
174 iso_pu_bacteria 2970136068 2970137179 105
175 iso_pu_bacteria 2970143518 2970144721 105
176 iso_pu_bacteria 2970149975 2970150116 105
177 iso_pu_bacteria 2970156795 2970159063 105
178 iso_pu_bacteria 2970164137 2970166116 105
179 iso_pu_bacteria 2970170962 2970175194 105
180 iso_pu_bacteria 2970184632 2970186666 105
181 iso_pu_bacteria 2970191845 2970195245 105
182 iso_pu_bacteria 2977523885 2977526986 105
183 iso_pu_bacteria 2977530762 2977533017 105
184 iso_pu_bacteria 2977537788 2977544157 105
185 iso_pu_bacteria 2977544691 2977545042 105
186 iso_pu_bacteria 2977551784 2977553981 105
187 iso_pu_bacteria 2977558990 2977561213 105
188 iso_pu_bacteria 2977565890 2977568089 105
189 iso_pu_bacteria 2977572785 2977572806 105
190 iso_pu_bacteria 2977579622 2977582703 105
191 iso_pu_bacteria 648276728 648736956 105
192 iso_pu_bacteria 8003992118 8003995945 105
193 iso_pu_bacteria 8003999396 8004003706 105
194 3300035086 Ga0373934_0017780 Ga0373934_0017780_327_716 106
195 3300035111 Ga0373923_0038656 Ga0373923_0038656_1306_1695 106
196 3300035117 Ga0373953_0067511 Ga0373953_0067511_140_529 106
197 3300035172 Ga0373955_0019109 Ga0373955_0019109_1971_2360 106
198 3300035724 Ga0373933_0122974 Ga0373933_0122974_553_942 106
199 3300036401 Ga0373937_0053423 Ga0373937_0053423_1504_1893 106
200 3300046454 Ga0495592_0316232 Ga0495592_0316232_141_530 106
201 3300046462 Ga0495651_0050130 Ga0495651_0050130_1655_2044 106
202 3300046536 Ga0495587_0300882 Ga0495587_0300882_219_608 106
203 3300047471 Ga0495684_0014777 Ga0495684_0014777_2036_2425 106
204 3300048088 Ga0495602_0672298 Ga0495602_0672298_127_516 106
205 iso_pu_bacteria 2524023207 2524451289 106
206 iso_pu_bacteria 2791355091 2792619271 106
207 3300037312 Ga0395899_0010541 Ga0395899_0010541_4994_5320 107
208 3300037418 Ga0395900_0533943 Ga0395900_0533943_16_342 107
209 3300037466 Ga0395898_0043544 Ga0395898_0043544_697_1023 107
210 3300037471 Ga0395905_0196084 Ga0395905_0196084_16_342 107
211 3300038443 Ga0395901_0270738 Ga0395901_0270738_1204_1530 107
212 3300031251 Ga0265327_10020067 Ga0265327_100200675 108
213 3300021320 Ga0214544_1004166 Ga0214544_100416617 109
214 3300022739 Ga0228711_1002153 Ga0228711_10021539 109
215 3300022740 Ga0228710_1000012 Ga0228710_100001211 109
216 3300027111 Ga0209281_1000138 Ga0209281_100013864 109
217 3300027111 Ga0209281_1002544 Ga0209281_10025441 109
218 3300027666 Ga0209282_1000020 Ga0209282_100002064 109
219 3300031548 Ga0307408_100612287 Ga0307408_1006122871 109
220 3300031852 Ga0307410_10875953 Ga0307410_108759531 109
221 3300031967 Ga0315914_1002233 Ga0315914_10022338 109
222 3300033430 Ga0315913_1000010 Ga0315913_10000108 109
223 3300033464 Ga0315915_1000006 Ga0315915_100000662 109
224 3300041413 Ga0439465_0244638 Ga0439465_0244638_136_474 109
225 3300042007 Ga0439449_0006861 Ga0439449_0006861_3568_3906 109
226 iso_pu_bacteria 2996310559 2996316471 109
227 3300032002 Ga0307416_101169313 Ga0307416_1011693132 110
228 3300003320 rootH2_10245581 rootH2_102455812 111
229 3300009177 Ga0105248_11068491 Ga0105248_110684912 111
230 3300032002 Ga0307416_101296092 Ga0307416_1012960922 111
231 3300035692 Ga0373935_0585838 Ga0373935_0585838_27_398 111
232 3300036401 Ga0373937_0590662 Ga0373937_0590662_46_405 111
233 3300041509 Ga0451843_1040248 Ga0451843_1040248_251_607 111
234 3300005355 Ga0070671_102085088 Ga0070671_1020850881 112
235 3300005535 Ga0070684_100526280 Ga0070684_1005262801 112
236 3300021321 Ga0214542_1002658 Ga0214542_100265816 112
237 3300021327 Ga0214543_1002392 Ga0214543_100239216 112
238 3300025931 Ga0207644_11033022 Ga0207644_110330222 112
239 3300031901 Ga0307406_10128806 Ga0307406_101288064 112
240 3300031995 Ga0307409_100670678 Ga0307409_1006706781 112
241 3300032002 Ga0307416_100105654 Ga0307416_1001056541 112
242 3300032126 Ga0307415_100117629 Ga0307415_1001176293 112
243 3300037471 Ga0395905_0848940 Ga0395905_0848940_19_366 112
244 3300042435 Ga0439434_0091794 Ga0439434_0091794_460_804 112
245 3300005329 Ga0070683_100509193 Ga0070683_1005091932 113
246 3300005338 Ga0068868_100000093 Ga0068868_10000009310 113
247 3300005434 Ga0070709_10033606 Ga0070709_100336062 113
248 3300005445 Ga0070708_100363478 Ga0070708_1003634783 113
249 3300005471 Ga0070698_100536445 Ga0070698_1005364452 113
250 3300005545 Ga0070695_101058293 Ga0070695_1010582931 113
251 3300005547 Ga0070693_100634600 Ga0070693_1006346002 113
252 3300005548 Ga0070665_100490611 Ga0070665_1004906112 113
253 3300005548 Ga0070665_101260770 Ga0070665_1012607702 113
254 3300005842 Ga0068858_100293442 Ga0068858_1002934422 113
255 3300006163 Ga0070715_10359238 Ga0070715_103592381 113
256 3300006173 Ga0070716_100003568 Ga0070716_1000035686 113
257 3300006852 Ga0075433_10842154 Ga0075433_108421542 113
258 3300006914 Ga0075436_100026935 Ga0075436_1000269352 113
259 3300009098 Ga0105245_10614758 Ga0105245_106147583 113
260 3300013306 Ga0163162_12455552 Ga0163162_124555521 113
261 3300013308 Ga0157375_11019284 Ga0157375_110192842 113
262 3300025906 Ga0207699_10027455 Ga0207699_100274552 113
263 3300025914 Ga0207671_10000727 Ga0207671_1000072724 113
264 3300025939 Ga0207665_10059949 Ga0207665_100599492 113
265 3300026023 Ga0207677_10000012 Ga0207677_10000012137 113
266 3300026035 Ga0207703_10275987 Ga0207703_102759871 113
267 3300028379 Ga0268266_10000749 Ga0268266_100007494 113
268 3300028379 Ga0268266_10147291 Ga0268266_101472913 113
269 3300035111 Ga0373923_0260434 Ga0373923_0260434_79_453 113
270 3300035118 Ga0373954_0006404 Ga0373954_0006404_845_1219 113
271 3300035119 Ga0373956_0220019 Ga0373956_0220019_442_816 113
272 3300035172 Ga0373955_0027718 Ga0373955_0027718_703_1077 113
273 3300035410 Ga0373924_0175845 Ga0373924_0175845_434_808 113
274 3300035692 Ga0373935_0142192 Ga0373935_0142192_863_1237 113
275 3300035724 Ga0373933_0339989 Ga0373933_0339989_567_941 113
276 3300036401 Ga0373937_0017101 Ga0373937_0017101_3294_3668 113
277 3300037068 Ga0373925_0925741 Ga0373925_0925741_309_686 113
278 3300046472 Ga0495580_0156079 Ga0495580_0156079_975_1346 113
279 3300046477 Ga0495664_0475945 Ga0495664_0475945_83_457 113
280 3300046516 Ga0495628_0901882 Ga0495628_0901882_86_460 113
281 3300046529 Ga0495652_0187040 Ga0495652_0187040_1077_1451 113
282 3300047319 Ga0495674_0258554 Ga0495674_0258554_64_441 113
283 3300048918 Ga0496115_0202602 Ga0496115_0202602_36_410 113
284 3300049762 Ga0501265_035390 Ga0501265_035390_344_691 113
285 3300050492 nmdc:mga0yw44_1237799_c1 nmdc:mga0yw44_1237799_c1_132_479 113
286 3300050514 nmdc:mga08x19_19286_c1 nmdc:mga08x19_19286_c1_2003_2356 113
287 3300050515 nmdc:mga0a205_808043_c1 nmdc:mga0a205_808043_c1_190_543 113
288 3300053085 Ga0495619_0341195 Ga0495619_0341195_425_799 113
289 3300003215 JGI25153J46596_10022824 JGI25153J46596_100228244 114
290 3300003791 Ga0055530_10000014 Ga0055530_10000014126 114
291 3300003794 Ga0055531_10002273 Ga0055531_100022734 114
292 3300005262 Ga0065165_1001235 Ga0065165_100123522 114
293 3300005331 Ga0070670_100336181 Ga0070670_1003361811 114
294 3300005471 Ga0070698_100319732 Ga0070698_1003197322 114
295 3300005545 Ga0070695_100667879 Ga0070695_1006678792 114
296 3300005546 Ga0070696_100983910 Ga0070696_1009839101 114
297 3300005548 Ga0070665_100607070 Ga0070665_1006070702 114
298 3300005549 Ga0070704_100118650 Ga0070704_1001186503 114
299 3300005616 Ga0068852_100324836 Ga0068852_1003248363 114
300 3300005618 Ga0068864_100007201 Ga0068864_1000072013 114
301 3300005841 Ga0068863_100000157 Ga0068863_1000001573 114
302 3300005841 Ga0068863_100736221 Ga0068863_1007362213 114
303 3300005842 Ga0068858_100000147 Ga0068858_1000001476 114
304 3300006237 Ga0097621_100340370 Ga0097621_1003403702 114
305 3300006358 Ga0068871_100134672 Ga0068871_1001346722 114
306 3300009092 Ga0105250_10031163 Ga0105250_100311633 114
307 3300009177 Ga0105248_10229678 Ga0105248_102296781 114
308 3300009177 Ga0105248_11058932 Ga0105248_110589321 114
309 3300009545 Ga0105237_10000071 Ga0105237_1000007126 114
310 3300009551 Ga0105238_10000736 Ga0105238_1000073627 114
311 3300009551 Ga0105238_10007170 Ga0105238_1000717011 114
312 3300010159 Ga0099796_10404754 Ga0099796_104047542 114
313 3300010375 Ga0105239_10003871 Ga0105239_100038713 114
314 3300010375 Ga0105239_10594261 Ga0105239_105942613 114
315 3300013297 Ga0157378_10017044 Ga0157378_100170443 114
316 3300013308 Ga0157375_11284632 Ga0157375_112846322 114
317 3300014325 Ga0163163_10141410 Ga0163163_101414102 114
318 3300014968 Ga0157379_10047497 Ga0157379_100474973 114
319 3300014969 Ga0157376_13119733 Ga0157376_131197332 114
320 3300021384 Ga0213876_10064609 Ga0213876_100646092 114
321 3300025297 Ga0209758_1000817 Ga0209758_100081721 114
322 3300025298 Ga0209050_1000034 Ga0209050_100003421 114
323 3300025304 Ga0209257_1000052 Ga0209257_1000052389 114
324 3300025924 Ga0207694_10001582 Ga0207694_100015822 114
325 3300025924 Ga0207694_10055050 Ga0207694_100550503 114
326 3300025931 Ga0207644_11745699 Ga0207644_117456992 114
327 3300026035 Ga0207703_10000050 Ga0207703_1000005074 114
328 3300026041 Ga0207639_10266432 Ga0207639_102664323 114
329 3300026088 Ga0207641_10000118 Ga0207641_1000011872 114
330 3300026088 Ga0207641_10692191 Ga0207641_106921913 114
331 3300026095 Ga0207676_10001602 Ga0207676_100016028 114
332 3300026142 Ga0207698_10848115 Ga0207698_108481152 114
333 3300028379 Ga0268266_10548619 Ga0268266_105486191 114
334 3300028794 Ga0307515_10765573 Ga0307515_107655731 114
335 3300030521 Ga0307511_10041514 Ga0307511_100415144 114
336 3300031456 Ga0307513_10505093 Ga0307513_105050932 114
337 3300031548 Ga0307408_100490455 Ga0307408_1004904552 114
338 3300031548 Ga0307408_100993919 Ga0307408_1009939192 114
339 3300031901 Ga0307406_10112729 Ga0307406_101127292 114
340 3300031911 Ga0307412_12243424 Ga0307412_122434242 114
341 3300032002 Ga0307416_101338498 Ga0307416_1013384982 114
342 3300032004 Ga0307414_10235270 Ga0307414_102352702 114
343 3300032005 Ga0307411_10530707 Ga0307411_105307071 114
344 3300039437 Ga0436365_1367961 Ga0436365_1367961_4470_4826 114
345 3300039447 Ga0436361_0939192 Ga0436361_0939192_105_458 114
346 3300041410 Ga0439461_0117597 Ga0439461_0117597_152_505 114
347 3300042004 Ga0439445_0094591 Ga0439445_0094591_375_728 114
348 3300042116 Ga0450912_004080 Ga0450912_004080_507_860 114
349 3300042156 Ga0439446_0049832 Ga0439446_0049832_343_696 114
350 3300042156 Ga0439446_0069336 Ga0439446_0069336_711_1064 114
351 3300042876 Ga0451577_0702689 Ga0451577_0702689_18_371 114
352 3300046455 Ga0495603_0114303 Ga0495603_0114303_651_1004 114
353 3300046616 Ga0495668_0568149 Ga0495668_0568149_130_483 114
354 3300047472 Ga0495686_0267159 Ga0495686_0267159_448_798 114
355 3300047472 Ga0495686_0282338 Ga0495686_0282338_503_853 114
356 3300048905 Ga0496102_0060877 Ga0496102_0060877_2987_3340 114
357 3300048905 Ga0496102_0210147 Ga0496102_0210147_1412_1762 114
358 3300048906 Ga0496103_0113251 Ga0496103_0113251_396_749 114
359 3300048919 Ga0496116_0093144 Ga0496116_0093144_113_466 114
360 3300048920 Ga0496117_0010332 Ga0496117_0010332_7194_7547 114
361 3300048921 Ga0496118_0002674 Ga0496118_0002674_13098_13451 114
362 3300048922 Ga0496119_0104221 Ga0496119_0104221_480_833 114
363 3300048923 Ga0496120_0190270 Ga0496120_0190270_512_865 114
364 3300048924 Ga0496121_0000042 Ga0496121_0000042_774_1127 114
365 3300048924 Ga0496121_0397566 Ga0496121_0397566_242_598 114
366 3300049569 Ga0501032_0002346 Ga0501032_0002346_13194_13547 114
367 3300049572 Ga0501036_1064918 Ga0501036_1064918_41_394 114
368 3300049573 Ga0501037_0009870 Ga0501037_0009870_3807_4160 114
369 3300049574 Ga0501038_0856335 Ga0501038_0856335_69_422 114
370 3300049579 Ga0501043_0089401 Ga0501043_0089401_1178_1531 114
371 3300049583 Ga0501067_0002688 Ga0501067_0002688_3157_3510 114
372 3300049584 Ga0501068_0014697 Ga0501068_0014697_343_696 114
373 3300049584 Ga0501068_0717456 Ga0501068_0717456_31_393 114
374 3300049588 Ga0501072_0184881 Ga0501072_0184881_1023_1376 114
375 3300049589 Ga0501073_0000003 Ga0501073_0000003_115858_116211 114
376 3300049593 Ga0501077_0000192 Ga0501077_0000192_31597_31950 114
377 3300049742 Ga0501080_0001563 Ga0501080_0001563_16315_16668 114
378 3300050496 nmdc:mga07m45_42707_c1 nmdc:mga07m45_42707_c1_973_1326 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

28

74

0.98

PF12840

HTH_20

Helix-turn-helix domain

26

74

0.98

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

28

73

0.96

PF12802

MarR_2

MarR family

28

79

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9327 18 74
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9247 6 85
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.919 5 93
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.9123 6 93
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9121 6 85
ID Description Score Start End Superfamily
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.951 18 73 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9376 6 83 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9327 18 74 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9321 6 81 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9297 18 74 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1B8WHW7-F1-model_v4 deleted 0.9748 9 85
AF-A0A2W5VFY7-F1-model_v4 HTH arsR-type domain-containing protein 0.9736 6 86 GO:0003700
AF-A0A4Q7WQW8-F1-model_v4 DNA-binding transcriptional ArsR family regulator 0.9729 7 85 GO:0003677
GO:0003700
AF-A0A316RQ87-F1-model_v4 ArsR family transcriptional regulator 0.9707 7 88 GO:0003700
AF-A0A838NER6-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9694 5 74 GO:0003700

Feature Viewer

pLDDT pTM Quality
88.11 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map