F427900

General Info

Members Datasets Scaffolds Average Seq Length
378 221 378 206

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10000283|rootL2_1000028312
Length 200
Sequence MVQGEQQTRVGGMAEPGPAEQEEIRLLERIANGDKQAFDTFYRRYHPRLARFLERVTRRPGLVEELLNDTLLVVWDKAASFNRRSKVSTWVFAIAYRKALKALQRWDQPQPAEALEQHADQGPGPEQLLGKQQLHTALQEALDGLSAEHRAVVDLTYFHGLAYGEIAAIVDCPPDTVKTRMFYARRRLKVLLGGRLGDWL

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
156 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
177 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
209 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
210 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
211 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
212 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
213 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
217 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
218 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.11
Nodule 0
Rhizoplane 3.44
Rhizosphere 75.4
Stem 0
Stem Tuber 0
Unclassified 10.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003446 3300001979 Bacteria 6950
2 JGI24740J21852_10003825 3300001979 Bacteria 6543
3 JGI24737J22298_10000233 3300001990 Bacteria 18387
4 JGI24735J21928_10035742 3300002067 Bacteria 1459
5 rootH2_10049684 3300003320 Bacteria 3300
6 rootL2_10000283 3300003322 Bacteria 27202
7 rootL2_10010319 3300003322 Bacteria 7206
8 Ga0055525_1000037 3300003759 Bacteria 297990
9 Ga0055542_1000088 3300003762 Bacteria 123491
10 Ga0055529_1000034 3300003763 Bacteria 244657
11 Ga0070658_10000399 3300005327 Bacteria 37847
12 Ga0070658_10046807 3300005327 Unclassified 3500
13 Ga0070658_10291744 3300005327 Bacteria 1390
14 Ga0070676_10001428 3300005328 Bacteria 12066
15 Ga0070670_100342033 3300005331 Bacteria 1313
16 Ga0068869_100315436 3300005334 Bacteria 1266
17 Ga0068869_100716751 3300005334 Archaea 854
18 Ga0070682_100009627 3300005337 Bacteria 5471
19 Ga0068868_100133302 3300005338 Bacteria 2035
20 Ga0070660_100006471 3300005339 Bacteria 8120
21 Ga0070660_100011372 3300005339 Bacteria 6320
22 Ga0070660_100285447 3300005339 Bacteria 1351
23 Ga0070691_10000798 3300005341 Bacteria 12585
24 Ga0070661_100000720 3300005344 Bacteria 24214
25 Ga0070661_100013154 3300005344 Bacteria 5808
26 Ga0070692_10165651 3300005345 Bacteria 1270
27 Ga0070675_100023864 3300005354 Bacteria 4895
28 Ga0070671_100227532 3300005355 Bacteria 1582
29 Ga0070674_100000131 3300005356 Bacteria 34327
30 Ga0070673_100167076 3300005364 Bacteria 1875
31 Ga0070673_100512891 3300005364 Bacteria 1086
32 Ga0070673_100643068 3300005364 Bacteria 970
33 Ga0070659_100033708 3300005366 Bacteria 3980
34 Ga0070659_100070367 3300005366 Bacteria 2779
35 Ga0070659_100091534 3300005366 Bacteria 2438
36 Ga0070667_100000372 3300005367 Bacteria 48979
37 Ga0070667_100016771 3300005367 Bacteria 6061
38 Ga0070667_100070855 3300005367 Bacteria 2968
39 Ga0070667_100104188 3300005367 Bacteria 2454
40 Ga0070667_100247794 3300005367 Bacteria 1592
41 Ga0070663_100003687 3300005455 Bacteria 8884
42 Ga0070663_100006857 3300005455 Bacteria 6891
43 Ga0070678_100000005 3300005456 Bacteria 70019
44 Ga0070678_100207587 3300005456 Bacteria 1621
45 Ga0070662_100210265 3300005457 Bacteria 1548
46 Ga0070662_100243615 3300005457 Bacteria 1443
47 Ga0068867_100044961 3300005459 Bacteria 3236
48 Ga0068867_100110438 3300005459 Bacteria 2112
49 Ga0070679_100074756 3300005530 Bacteria 3378
50 Ga0070684_100038453 3300005535 Bacteria 4110
51 Ga0070684_100299218 3300005535 Unclassified 1476
52 Ga0068853_100002834 3300005539 Bacteria 13141
53 Ga0068853_100011441 3300005539 Bacteria 7210
54 Ga0068853_100045794 3300005539 Bacteria 3748
55 Ga0068853_100236663 3300005539 Archaea 1672
56 Ga0070672_100032671 3300005543 Bacteria 3931
57 Ga0070665_100159275 3300005548 Bacteria 2259
58 Ga0068855_100030879 3300005563 Bacteria 6405
59 Ga0068855_100080519 3300005563 Bacteria 3776
60 Ga0068855_100299911 3300005563 Unclassified 1780
61 Ga0068855_100424094 3300005563 Bacteria 1455
62 Ga0070664_100011056 3300005564 Bacteria 7319
63 Ga0070664_100026417 3300005564 Bacteria 4815
64 Ga0070664_100079593 3300005564 Bacteria 2821
65 Ga0070664_100507466 3300005564 Bacteria 1112
66 Ga0068857_100104595 3300005577 Bacteria 2542
67 Ga0068857_100227621 3300005577 Bacteria 1704
68 Ga0068854_100005694 3300005578 Bacteria 7874
69 Ga0068854_100024841 3300005578 Bacteria 4107
70 Ga0068856_100135342 3300005614 Plasmid 2469
71 Ga0068856_100151887 3300005614 Unclassified 2325
72 Ga0068852_100006390 3300005616 Bacteria 8512
73 Ga0068851_10002108 3300005834 Bacteria 8754
74 Ga0068851_10002308 3300005834 Bacteria 8395
75 Ga0068851_10059710 3300005834 Bacteria 1951
76 Ga0068863_100079763 3300005841 Bacteria 3100
77 Ga0075364_10000128 3300006051 Bacteria 31758
78 Ga0075362_10126013 3300006177 Bacteria 1215
79 Ga0075367_10011394 3300006178 Bacteria 4702
80 Ga0075369_10185963 3300006186 Bacteria 957
81 Ga0075369_10224770 3300006186 Bacteria 869
82 Ga0075366_10035174 3300006195 Bacteria 2954
83 Ga0097621_100112361 3300006237 Bacteria 2303
84 Ga0097621_100174500 3300006237 Archaea 1855
85 Ga0097621_100290243 3300006237 Bacteria 1442
86 Ga0097621_101211913 3300006237 Bacteria 711
87 Ga0075370_10004502 3300006353 Bacteria 6781
88 Ga0075370_10006451 3300006353 Bacteria 5901
89 Ga0075370_10041342 3300006353 Bacteria 2603
90 Ga0068871_100086750 3300006358 Bacteria 2601
91 Ga0068871_100605129 3300006358 Archaea 997
92 Ga0105240_10012577 3300009093 Bacteria 11675
93 Ga0105240_10042418 3300009093 Bacteria 5798
94 Ga0105240_10383385 3300009093 Bacteria 1587
95 Ga0105240_10568892 3300009093 Bacteria 1252
96 Ga0111539_11122297 3300009094 Bacteria 914
97 Ga0105245_10107866 3300009098 Bacteria 2586
98 Ga0105243_10000030 3300009148 Bacteria 190342
99 Ga0105242_10474722 3300009176 Bacteria 1184
100 Ga0105248_10005265 3300009177 Bacteria 14232
101 Ga0105237_10140127 3300009545 Bacteria 2412
102 Ga0105238_10101012 3300009551 Bacteria 2867
103 Ga0105238_10303619 3300009551 Bacteria 1580
104 Ga0105239_10000075 3300010375 Bacteria 140531
105 Ga0105239_10131099 3300010375 Bacteria 2788
106 Ga0105239_10238222 3300010375 Bacteria 2042
107 Ga0105239_10742979 3300010375 Unclassified 1123
108 Ga0105246_10005301 3300011119 Bacteria 7848
109 Ga0105246_10074720 3300011119 Bacteria 2397
110 Ga0105246_10153747 3300011119 Bacteria 1745
111 Ga0157373_10010032 3300013100 Bacteria 6979
112 Ga0157373_10052787 3300013100 Bacteria 2891
113 Ga0157373_10253833 3300013100 Bacteria 1244
114 Ga0157371_10000043 3300013102 Bacteria 197887
115 Ga0157371_10069643 3300013102 Bacteria 2491
116 Ga0157369_10091724 3300013105 Bacteria 3242
117 Ga0157369_11016672 3300013105 Bacteria 848
118 Ga0157374_10001339 3300013296 Bacteria 20962
119 Ga0157374_10073305 3300013296 Unclassified 3232
120 Ga0157372_10029437 3300013307 Bacteria 5996
121 Ga0157372_10094739 3300013307 Bacteria 3400
122 Ga0157372_10281811 3300013307 Bacteria 1932
123 Ga0157379_10195553 3300014968 Bacteria 1828
124 Ga0157376_10159754 3300014969 Bacteria 2042
125 Ga0163161_10203254 3300017792 Bacteria 1527
126 Ga0213876_10034956 3300021384 Bacteria 2651
127 Ga0209563_100053 3300025230 Bacteria 332370
128 Ga0209026_1032492 3300025250 Bacteria 771
129 Ga0209148_1000093 3300025254 Bacteria 245339
130 Ga0209233_1024423 3300025261 Bacteria 1512
131 Ga0209455_1000045 3300025272 Bacteria 383329
132 Ga0209758_1000001 3300025297 Bacteria 1981790
133 Ga0207656_10005490 3300025321 Bacteria 4485
134 Ga0207656_10010851 3300025321 Bacteria 3426
135 Ga0207656_10038251 3300025321 Bacteria 2023
136 Ga0207647_10000595 3300025904 Bacteria 28150
137 Ga0207647_10055310 3300025904 Bacteria 2439
138 Ga0207645_10005226 3300025907 Bacteria 9465
139 Ga0207645_10019176 3300025907 Bacteria 4489
140 Ga0207705_10000308 3300025909 Bacteria 45168
141 Ga0207705_10004492 3300025909 Bacteria 10547
142 Ga0207705_10276470 3300025909 Bacteria 1285
143 Ga0207705_10332740 3300025909 Bacteria 1168
144 Ga0207654_10001465 3300025911 Bacteria 12492
145 Ga0207695_10009039 3300025913 Bacteria 12386
146 Ga0207695_10010516 3300025913 Bacteria 11317
147 Ga0207695_10027520 3300025913 Bacteria 6330
148 Ga0207671_10027358 3300025914 Bacteria 4264
149 Ga0207663_10170621 3300025916 Bacteria 1545
150 Ga0207660_10215136 3300025917 Bacteria 1506
151 Ga0207657_10000583 3300025919 Bacteria 38816
152 Ga0207657_10002634 3300025919 Bacteria 19373
153 Ga0207657_10009532 3300025919 Bacteria 9747
154 Ga0207649_10000508 3300025920 Bacteria 27425
155 Ga0207649_10010660 3300025920 Bacteria 5054
156 Ga0207652_10377484 3300025921 Bacteria 1279
157 Ga0207694_10007504 3300025924 Bacteria 8267
158 Ga0207694_10210988 3300025924 Bacteria 1582
159 Ga0207694_10484922 3300025924 Bacteria 1034
160 Ga0207650_10073310 3300025925 Bacteria 2578
161 Ga0207644_10022824 3300025931 Bacteria 4278
162 Ga0207644_10317849 3300025931 Bacteria 1258
163 Ga0207690_10008730 3300025932 Bacteria 6015
164 Ga0207690_10097988 3300025932 Bacteria 2087
165 Ga0207690_10592001 3300025932 Bacteria 905
166 Ga0207709_10000137 3300025935 Bacteria 106203
167 Ga0207669_10000031 3300025937 Bacteria 85825
168 Ga0207669_10021860 3300025937 Bacteria 3386
169 Ga0207704_10064713 3300025938 Bacteria 2286
170 Ga0207691_10013300 3300025940 Bacteria 7885
171 Ga0207711_10039423 3300025941 Bacteria 4018
172 Ga0207689_10029519 3300025942 Bacteria 4578
173 Ga0207689_10394222 3300025942 Bacteria 1154
174 Ga0207661_10181370 3300025944 Bacteria 1839
175 Ga0207679_10028285 3300025945 Bacteria 3887
176 Ga0207679_10077190 3300025945 Bacteria 2533
177 Ga0207679_10173674 3300025945 Bacteria 1776
178 Ga0207667_10000069 3300025949 Bacteria 180683
179 Ga0207667_10008985 3300025949 Bacteria 11822
180 Ga0207667_10170789 3300025949 Unclassified 2235
181 Ga0207667_10319097 3300025949 Archaea 1587
182 Ga0207667_10515173 3300025949 Bacteria 1212
183 Ga0207651_10055453 3300025960 Bacteria 2722
184 Ga0207651_10160069 3300025960 Bacteria 1764
185 Ga0207640_10004050 3300025981 Bacteria 7917
186 Ga0207640_10005408 3300025981 Bacteria 6963
187 Ga0207640_10242156 3300025981 Unclassified 1394
188 Ga0207640_10790292 3300025981 Bacteria 821
189 Ga0207658_10002833 3300025986 Bacteria 12427
190 Ga0207658_10056979 3300025986 Bacteria 2902
191 Ga0207658_10117120 3300025986 Bacteria 2117
192 Ga0207658_10273739 3300025986 Unclassified 1444
193 Ga0207658_10350805 3300025986 Bacteria 1285
194 Ga0207639_10000527 3300026041 Bacteria 26396
195 Ga0207639_10058674 3300026041 Bacteria 2961
196 Ga0207639_10093416 3300026041 Bacteria 2412
197 Ga0207639_10797462 3300026041 Archaea 880
198 Ga0207678_10008046 3300026067 Bacteria 9296
199 Ga0207678_10023533 3300026067 Bacteria 5387
200 Ga0207702_10003017 3300026078 Bacteria 15646
201 Ga0207702_10042754 3300026078 Unclassified 3802
202 Ga0207702_10890374 3300026078 Unclassified 882
203 Ga0207641_10270703 3300026088 Bacteria 1594
204 Ga0207641_10309488 3300026088 Bacteria 1495
205 Ga0207648_10004061 3300026089 Bacteria 15185
206 Ga0207648_10053223 3300026089 Bacteria 3538
207 Ga0207676_10252748 3300026095 Bacteria 1587
208 Ga0207674_10002608 3300026116 Bacteria 22622
209 Ga0207674_10017494 3300026116 Bacteria 7821
210 Ga0207674_10099326 3300026116 Bacteria 2893
211 Ga0207683_10000115 3300026121 Bacteria 65630
212 Ga0207698_10010758 3300026142 Bacteria 5904
213 Ga0207698_10014407 3300026142 Bacteria 5255
214 Ga0207698_10020110 3300026142 Bacteria 4589
215 Ga0207698_11430891 3300026142 Bacteria 706
216 Ga0209813_10080761 3300027866 Bacteria 1075
217 Ga0268266_10136335 3300028379 Bacteria 2199
218 Ga0307517_10000150 3300028786 Bacteria 110446
219 Ga0307517_10018546 3300028786 Bacteria 8993
220 Ga0307517_10115961 3300028786 Bacteria 2007
221 Ga0307515_10052388 3300028794 Bacteria 6053
222 Ga0307515_10106513 3300028794 Bacteria 3325
223 Ga0307515_10317519 3300028794 Bacteria 1227
224 Ga0307512_10184201 3300030522 Unclassified 1166
225 Ga0307513_10040629 3300031456 Bacteria 5142
226 Ga0307513_10147002 3300031456 Bacteria 2273
227 Ga0307509_10000092 3300031507 Bacteria 124019
228 Ga0307509_10016636 3300031507 Bacteria 8501
229 Ga0307509_10216420 3300031507 Bacteria 1734
230 Ga0307509_10361353 3300031507 Bacteria 1171
231 Ga0307509_10378275 3300031507 Bacteria 1130
232 Ga0307508_10001639 3300031616 Bacteria 24934
233 Ga0307410_10531913 3300031852 Bacteria 972
234 Ga0307414_10151556 3300032004 Bacteria 1830
235 Ga0307510_10001753 3300033180 Bacteria 24194
236 Ga0307510_10009729 3300033180 Bacteria 11441
237 Ga0307510_10312264 3300033180 Bacteria 1031
238 Ga0373932_0053250 3300035112 Bacteria 1207
239 Ga0373931_0076932 3300035691 Bacteria 1834
240 Ga0373925_0028614 3300037068 Bacteria 4083
241 Ga0395899_0028688 3300037312 Bacteria 4189
242 Ga0395899_0088938 3300037312 Bacteria 2240
243 Ga0395900_0130018 3300037418 Bacteria 2581
244 Ga0395900_0226649 3300037418 Bacteria 1881
245 Ga0395900_0358816 3300037418 Bacteria 1429
246 Ga0395898_0014102 3300037466 Bacteria 8213
247 Ga0395898_0039693 3300037466 Bacteria 4657
248 Ga0395898_0379989 3300037466 Bacteria 1347
249 Ga0395905_0000091 3300037471 Bacteria 151747
250 Ga0395905_0469531 3300037471 Bacteria 1157
251 Ga0395905_1113738 3300037471 Bacteria 693
252 Ga0395901_0046740 3300038443 Bacteria 4496
253 Ga0395901_0071463 3300038443 Bacteria 3617
254 Ga0395901_0363035 3300038443 Bacteria 1493
255 Ga0395901_0726548 3300038443 Bacteria 988
256 Ga0436365_0172558 3300039437 Bacteria 2513
257 Ga0451807_1028123 3300041486 Bacteria 857
258 Ga0451853_0891116 3300041512 Bacteria 802
259 Ga0466969_0012462 3300044656 Bacteria 4483
260 Ga0466966_0279368 3300044684 Bacteria 1004
261 Ga0466961_0042812 3300044693 Unclassified 2901
262 Ga0466963_0009657 3300044694 Bacteria 5816
263 Ga0466963_0084929 3300044694 Bacteria 2148
264 Ga0466963_0201385 3300044694 Bacteria 1392
265 Ga0466971_0162489 3300044719 Bacteria 1046
266 Ga0466970_0296437 3300044765 Bacteria 911
267 Ga0466957_0015244 3300044842 Bacteria 4489
268 Ga0466959_0023472 3300045049 Bacteria 4564
269 Ga0466959_0157796 3300045049 Bacteria 1596
270 Ga0466959_0493933 3300045049 Bacteria 827
271 Ga0466958_0007108 3300045836 Bacteria 6130
272 Ga0466958_0078635 3300045836 Bacteria 2027
273 Ga0466967_0028237 3300045976 Bacteria 4681
274 Ga0466967_0122564 3300045976 Bacteria 2404
275 Ga0495592_0003099 3300046454 Bacteria 11871
276 Ga0495629_0075561 3300046459 Bacteria 2353
277 Ga0495638_0096651 3300046460 Bacteria 1773
278 Ga0495650_0000083 3300046471 Bacteria 237725
279 Ga0495639_0332837 3300046475 Unclassified 760
280 Ga0495584_0024569 3300046491 Bacteria 3056
281 Ga0495585_0010250 3300046492 Bacteria 5591
282 Ga0495583_0000451 3300046506 Bacteria 61544
283 Ga0495583_0018110 3300046506 Bacteria 3718
284 Ga0495583_0019010 3300046506 Bacteria 3597
285 Ga0495606_0037506 3300046507 Bacteria 3291
286 Ga0495616_0082948 3300046513 Bacteria 1530
287 Ga0495631_0012517 3300046518 Bacteria 4140
288 Ga0495631_0047521 3300046518 Bacteria 1884
289 Ga0495632_0124849 3300046519 Bacteria 1200
290 Ga0495637_0011921 3300046520 Bacteria 4166
291 Ga0495643_0006956 3300046522 Bacteria 7356
292 Ga0495648_0003521 3300046524 Bacteria 13724
293 Ga0495663_0000185 3300046525 Bacteria 24855
294 Ga0495666_0035552 3300046526 Unclassified 2429
295 Ga0495642_0063107 3300046528 Bacteria 1539
296 Ga0495622_0010684 3300046557 Bacteria 4235
297 Ga0495633_0003174 3300046558 Bacteria 11109
298 Ga0495633_0042116 3300046558 Bacteria 2170
299 Ga0495633_0070620 3300046558 Bacteria 1630
300 Ga0495611_0005557 3300046648 Bacteria 5380
301 Ga0495611_0033273 3300046648 Bacteria 2274
302 Ga0495611_0161775 3300046648 Bacteria 1046
303 Ga0495625_0001137 3300046660 Bacteria 34397
304 Ga0495625_0012140 3300046660 Bacteria 6989
305 Ga0495625_0015282 3300046660 Bacteria 6085
306 Ga0495625_0062107 3300046660 Bacteria 2641
307 Ga0495625_0071826 3300046660 Bacteria 2428
308 Ga0495661_0061803 3300046665 Bacteria 2222
309 Ga0495647_0016788 3300046681 Bacteria 2583
310 Ga0495658_0011721 3300046683 Bacteria 4418
311 Ga0495658_0097362 3300046683 Bacteria 1751
312 Ga0495669_0000469 3300046684 Bacteria 18786
313 Ga0495669_0050502 3300046684 Bacteria 1865
314 Ga0495649_0037799 3300046694 Bacteria 2649
315 Ga0495600_0024671 3300046809 Bacteria 3871
316 Ga0495636_0323724 3300047318 Unclassified 724
317 Ga0495683_0016146 3300047323 Bacteria 3877
318 Ga0495687_000188 3300047443 Bacteria 90084
319 Ga0495687_001488 3300047443 Bacteria 21400
320 Ga0495677_0005000 3300047445 Bacteria 5057
321 Ga0495677_0023435 3300047445 Unclassified 2241
322 Ga0495673_0066086 3300047469 Bacteria 1534
323 Ga0495681_0003776 3300047470 Bacteria 10500
324 Ga0495681_0127288 3300047470 Bacteria 1087
325 Ga0495686_0001255 3300047472 Bacteria 28821
326 Ga0495615_0028073 3300048090 Bacteria 1326
327 Ga0496102_0000320 3300048905 Bacteria 60114
328 Ga0496103_0000244 3300048906 Bacteria 53008
329 Ga0496104_0010180 3300048907 Bacteria 8394
330 Ga0496105_0000287 3300048908 Bacteria 33222
331 Ga0496107_0035864 3300048910 Bacteria 3557
332 Ga0496109_0206533 3300048912 Bacteria 1847
333 Ga0496111_0022647 3300048914 Bacteria 4400
334 Ga0496111_0272047 3300048914 Bacteria 1257
335 Ga0496113_0008412 3300048916 Bacteria 6725
336 Ga0496113_0604174 3300048916 Bacteria 878
337 Ga0496114_0239118 3300048917 Bacteria 1596
338 Ga0496115_0000061 3300048918 Bacteria 101438
339 Ga0496116_0015101 3300048919 Bacteria 6122
340 Ga0496117_0000281 3300048920 Bacteria 94664
341 Ga0496118_0001634 3300048921 Bacteria 33049
342 Ga0496119_0008547 3300048922 Bacteria 8980
343 Ga0496121_0000247 3300048924 Bacteria 114839
344 Ga0496121_0001929 3300048924 Bacteria 33138
345 Ga0496121_0008204 3300048924 Bacteria 12385
346 Ga0496121_0023705 3300048924 Bacteria 5899
347 Ga0496122_0016912 3300048925 Bacteria 6855
348 Ga0496123_0011498 3300048926 Bacteria 7668
349 Ga0496124_0000266 3300048927 Bacteria 101288
350 Ga0496125_0001502 3300048928 Bacteria 33409
351 Ga0496126_0000819 3300048929 Bacteria 55474
352 Ga0495682_0118562 3300049460 Bacteria 948
353 Ga0501044_0589017 3300049823 Bacteria 1006
354 nmdc:mga03683_162205_c1 3300050489 Bacteria 1013
355 nmdc:mga03n38_9874_c1 3300050490 Bacteria 3489
356 nmdc:mga00v17_1741_c1 3300050491 Bacteria 11314
357 nmdc:mga0k408_26050_c1 3300050493 Bacteria 3314
358 nmdc:mga0k408_91702_c1 3300050493 Bacteria 1349
359 nmdc:mga04h51_95739_c1 3300050495 Bacteria 1075
360 nmdc:mga07m45_190_c1 3300050496 Bacteria 24417
361 nmdc:mga07m45_201888_c1 3300050496 Bacteria 1157
362 nmdc:mga0sz30_230105_c1 3300050516 Bacteria 825
363 Ga0500643_000078 3300053087 Bacteria 104681
364 Ga0500651_0109018 3300053093 Unclassified 1691
365 Ga0500556_0126150 3300053104 Bacteria 1001
366 Ga0500595_001230 3300053119 Bacteria 14122
367 Ga0500595_034816 3300053119 Bacteria 1663
368 Ga0500642_0018282 3300053130 Bacteria 2707
369 Ga0500642_0352350 3300053130 Bacteria 653
370 Ga0500559_0057632 3300053136 Bacteria 1726
371 Ga0500559_0185913 3300053136 Bacteria 979
372 Ga0500616_0111758 3300053153 Bacteria 1318
373 Ga0500619_087198 3300053154 Bacteria 1052
374 Ga0500622_0008777 3300053156 Bacteria 5627
375 Ga0500636_0007495 3300053177 Bacteria 6312
376 Ga0500645_000249 3300053730 Bacteria 40272
377 Ga0500596_002105 3300053735 Bacteria 3965
378 Ga0466962_0056990 3300061719 Bacteria 1865

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050493 nmdc:mga0k408_91702_c1 nmdc:mga0k408_91702_c1_101_757 178
2 3300013105 Ga0157369_11016672 Ga0157369_110166721 188
3 3300025261 Ga0209233_1024423 Ga0209233_10244232 189
4 3300003320 rootH2_10049684 rootH2_100496844 192
5 3300003322 rootL2_10010319 rootL2_100103197 192
6 3300037471 Ga0395905_0000091 Ga0395905_0000091_68366_68956 192
7 3300041512 Ga0451853_0891116 Ga0451853_0891116_132_734 192
8 3300045049 Ga0466959_0157796 Ga0466959_0157796_406_996 192
9 3300003322 rootL2_10000283 rootL2_1000028312 193
10 3300005328 Ga0070676_10001428 Ga0070676_100014285 193
11 3300005331 Ga0070670_100342033 Ga0070670_1003420332 193
12 3300005334 Ga0068869_100315436 Ga0068869_1003154361 193
13 3300005334 Ga0068869_100716751 Ga0068869_1007167512 193
14 3300005338 Ga0068868_100133302 Ga0068868_1001333022 193
15 3300005354 Ga0070675_100023864 Ga0070675_1000238642 193
16 3300005364 Ga0070673_100512891 Ga0070673_1005128912 193
17 3300005367 Ga0070667_100000372 Ga0070667_10000037240 193
18 3300005367 Ga0070667_100070855 Ga0070667_1000708552 193
19 3300005367 Ga0070667_100104188 Ga0070667_1001041883 193
20 3300005456 Ga0070678_100207587 Ga0070678_1002075872 193
21 3300005459 Ga0068867_100110438 Ga0068867_1001104382 193
22 3300005539 Ga0068853_100236663 Ga0068853_1002366631 193
23 3300005543 Ga0070672_100032671 Ga0070672_1000326712 193
24 3300005548 Ga0070665_100159275 Ga0070665_1001592752 193
25 3300005563 Ga0068855_100030879 Ga0068855_1000308794 193
26 3300005564 Ga0070664_100507466 Ga0070664_1005074662 193
27 3300005577 Ga0068857_100104595 Ga0068857_1001045953 193
28 3300005841 Ga0068863_100079763 Ga0068863_1000797632 193
29 3300006177 Ga0075362_10126013 Ga0075362_101260132 193
30 3300006237 Ga0097621_100174500 Ga0097621_1001745002 193
31 3300006237 Ga0097621_100290243 Ga0097621_1002902432 193
32 3300006237 Ga0097621_101211913 Ga0097621_1012119132 193
33 3300006353 Ga0075370_10041342 Ga0075370_100413422 193
34 3300006358 Ga0068871_100605129 Ga0068871_1006051291 193
35 3300009094 Ga0111539_11122297 Ga0111539_111222971 193
36 3300009177 Ga0105248_10005265 Ga0105248_100052654 193
37 3300011119 Ga0105246_10005301 Ga0105246_100053015 193
38 3300013100 Ga0157373_10010032 Ga0157373_100100325 193
39 3300014968 Ga0157379_10195553 Ga0157379_101955532 193
40 3300025907 Ga0207645_10005226 Ga0207645_100052264 193
41 3300025925 Ga0207650_10073310 Ga0207650_100733103 193
42 3300025931 Ga0207644_10022824 Ga0207644_100228245 193
43 3300025931 Ga0207644_10317849 Ga0207644_103178492 193
44 3300025938 Ga0207704_10064713 Ga0207704_100647133 193
45 3300025940 Ga0207691_10013300 Ga0207691_100133002 193
46 3300025941 Ga0207711_10039423 Ga0207711_100394232 193
47 3300025942 Ga0207689_10029519 Ga0207689_100295192 193
48 3300025945 Ga0207679_10173674 Ga0207679_101736742 193
49 3300025949 Ga0207667_10319097 Ga0207667_103190971 193
50 3300025960 Ga0207651_10055453 Ga0207651_100554532 193
51 3300025986 Ga0207658_10002833 Ga0207658_100028332 193
52 3300025986 Ga0207658_10117120 Ga0207658_101171203 193
53 3300025986 Ga0207658_10350805 Ga0207658_103508052 193
54 3300026041 Ga0207639_10797462 Ga0207639_107974622 193
55 3300026088 Ga0207641_10270703 Ga0207641_102707032 193
56 3300026088 Ga0207641_10309488 Ga0207641_103094883 193
57 3300026089 Ga0207648_10004061 Ga0207648_1000406120 193
58 3300026116 Ga0207674_10017494 Ga0207674_100174942 193
59 3300028379 Ga0268266_10136335 Ga0268266_101363352 193
60 3300028786 Ga0307517_10000150 Ga0307517_1000015017 193
61 3300028786 Ga0307517_10115961 Ga0307517_101159612 193
62 3300028794 Ga0307515_10052388 Ga0307515_100523882 193
63 3300028794 Ga0307515_10106513 Ga0307515_101065134 193
64 3300028794 Ga0307515_10317519 Ga0307515_103175192 193
65 3300030522 Ga0307512_10184201 Ga0307512_101842012 193
66 3300031456 Ga0307513_10040629 Ga0307513_100406294 193
67 3300031507 Ga0307509_10000092 Ga0307509_1000009299 193
68 3300031507 Ga0307509_10016636 Ga0307509_100166363 193
69 3300031507 Ga0307509_10361353 Ga0307509_103613532 193
70 3300031507 Ga0307509_10378275 Ga0307509_103782751 193
71 3300031616 Ga0307508_10001639 Ga0307508_1000163924 193
72 3300031852 Ga0307410_10531913 Ga0307410_105319131 193
73 3300032004 Ga0307414_10151556 Ga0307414_101515562 193
74 3300033180 Ga0307510_10001753 Ga0307510_1000175314 193
75 3300033180 Ga0307510_10009729 Ga0307510_1000972910 193
76 3300035112 Ga0373932_0053250 Ga0373932_0053250_106_708 193
77 3300035691 Ga0373931_0076932 Ga0373931_0076932_959_1561 193
78 3300037068 Ga0373925_0028614 Ga0373925_0028614_415_1017 193
79 3300046454 Ga0495592_0003099 Ga0495592_0003099_8615_9217 193
80 3300046460 Ga0495638_0096651 Ga0495638_0096651_929_1531 193
81 3300046519 Ga0495632_0124849 Ga0495632_0124849_256_858 193
82 3300046558 Ga0495633_0070620 Ga0495633_0070620_171_773 193
83 3300046681 Ga0495647_0016788 Ga0495647_0016788_1521_2123 193
84 3300046683 Ga0495658_0011721 Ga0495658_0011721_3407_4009 193
85 3300046683 Ga0495658_0097362 Ga0495658_0097362_451_1053 193
86 3300047469 Ga0495673_0066086 Ga0495673_0066086_803_1405 193
87 3300048914 Ga0496111_0272047 Ga0496111_0272047_199_816 193
88 3300048916 Ga0496113_0008412 Ga0496113_0008412_2559_3176 193
89 3300048924 Ga0496121_0023705 Ga0496121_0023705_255_839 193
90 3300049460 Ga0495682_0118562 Ga0495682_0118562_195_797 193
91 3300053093 Ga0500651_0109018 Ga0500651_0109018_34_636 193
92 3300053136 Ga0500559_0057632 Ga0500559_0057632_575_1183 193
93 3300053136 Ga0500559_0185913 Ga0500559_0185913_239_841 193
94 3300053153 Ga0500616_0111758 Ga0500616_0111758_631_1224 193
95 3300053156 Ga0500622_0008777 Ga0500622_0008777_4785_5387 193
96 3300009098 Ga0105245_10107866 Ga0105245_101078662 195
97 3300011119 Ga0105246_10153747 Ga0105246_101537472 195
98 3300050489 nmdc:mga03683_162205_c1 nmdc:mga03683_162205_c1_304_912 195
99 3300026078 Ga0207702_10890374 Ga0207702_108903741 196
100 3300053104 Ga0500556_0126150 Ga0500556_0126150_356_961 196
101 3300053130 Ga0500642_0352350 Ga0500642_0352350_27_632 196
102 3300005578 Ga0068854_100005694 Ga0068854_1000056943 197
103 3300025981 Ga0207640_10004050 Ga0207640_100040503 197
104 3300026142 Ga0207698_11430891 Ga0207698_114308911 197
105 3300005327 Ga0070658_10046807 Ga0070658_100468074 198
106 3300005339 Ga0070660_100006471 Ga0070660_1000064719 198
107 3300005339 Ga0070660_100285447 Ga0070660_1002854472 198
108 3300005344 Ga0070661_100013154 Ga0070661_1000131547 198
109 3300005364 Ga0070673_100643068 Ga0070673_1006430682 198
110 3300005366 Ga0070659_100033708 Ga0070659_1000337083 198
111 3300005366 Ga0070659_100091534 Ga0070659_1000915342 198
112 3300005367 Ga0070667_100247794 Ga0070667_1002477942 198
113 3300005455 Ga0070663_100003687 Ga0070663_1000036879 198
114 3300005535 Ga0070684_100299218 Ga0070684_1002992182 198
115 3300005539 Ga0068853_100011441 Ga0068853_1000114413 198
116 3300005564 Ga0070664_100011056 Ga0070664_1000110566 198
117 3300005614 Ga0068856_100135342 Ga0068856_1001353424 198
118 3300005614 Ga0068856_100151887 Ga0068856_1001518872 198
119 3300005616 Ga0068852_100006390 Ga0068852_1000063904 198
120 3300005834 Ga0068851_10002108 Ga0068851_100021083 198
121 3300009093 Ga0105240_10568892 Ga0105240_105688921 198
122 3300009551 Ga0105238_10303619 Ga0105238_103036192 198
123 3300010375 Ga0105239_10238222 Ga0105239_102382222 198
124 3300010375 Ga0105239_10742979 Ga0105239_107429792 198
125 3300013100 Ga0157373_10253833 Ga0157373_102538331 198
126 3300013102 Ga0157371_10069643 Ga0157371_100696433 198
127 3300013296 Ga0157374_10001339 Ga0157374_1000133912 198
128 3300013307 Ga0157372_10094739 Ga0157372_100947393 198
129 3300013307 Ga0157372_10281811 Ga0157372_102818113 198
130 3300021384 Ga0213876_10034956 Ga0213876_100349561 198
131 3300025321 Ga0207656_10005490 Ga0207656_100054903 198
132 3300025909 Ga0207705_10004492 Ga0207705_100044924 198
133 3300025916 Ga0207663_10170621 Ga0207663_101706212 198
134 3300025919 Ga0207657_10009532 Ga0207657_100095323 198
135 3300025920 Ga0207649_10010660 Ga0207649_100106606 198
136 3300025924 Ga0207694_10210988 Ga0207694_102109882 198
137 3300025932 Ga0207690_10097988 Ga0207690_100979882 198
138 3300025945 Ga0207679_10028285 Ga0207679_100282853 198
139 3300025949 Ga0207667_10170789 Ga0207667_101707892 198
140 3300025981 Ga0207640_10242156 Ga0207640_102421562 198
141 3300025986 Ga0207658_10273739 Ga0207658_102737392 198
142 3300026041 Ga0207639_10093416 Ga0207639_100934163 198
143 3300026067 Ga0207678_10008046 Ga0207678_100080462 198
144 3300026078 Ga0207702_10042754 Ga0207702_100427543 198
145 3300026095 Ga0207676_10252748 Ga0207676_102527482 198
146 3300026142 Ga0207698_10020110 Ga0207698_100201103 198
147 3300037312 Ga0395899_0028688 Ga0395899_0028688_3038_3637 198
148 3300037312 Ga0395899_0088938 Ga0395899_0088938_182_781 198
149 3300037418 Ga0395900_0130018 Ga0395900_0130018_1147_1746 198
150 3300037418 Ga0395900_0226649 Ga0395900_0226649_832_1431 198
151 3300037466 Ga0395898_0014102 Ga0395898_0014102_6996_7595 198
152 3300037466 Ga0395898_0039693 Ga0395898_0039693_1530_2129 198
153 3300037466 Ga0395898_0379989 Ga0395898_0379989_734_1333 198
154 3300038443 Ga0395901_0046740 Ga0395901_0046740_1347_1946 198
155 3300038443 Ga0395901_0071463 Ga0395901_0071463_46_645 198
156 3300038443 Ga0395901_0363035 Ga0395901_0363035_850_1449 198
157 3300044693 Ga0466961_0042812 Ga0466961_0042812_1874_2473 198
158 3300044694 Ga0466963_0084929 Ga0466963_0084929_340_939 198
159 3300044765 Ga0466970_0296437 Ga0466970_0296437_37_636 198
160 3300045049 Ga0466959_0023472 Ga0466959_0023472_3125_3724 198
161 3300045049 Ga0466959_0493933 Ga0466959_0493933_17_616 198
162 3300045836 Ga0466958_0007108 Ga0466958_0007108_2144_2743 198
163 3300047472 Ga0495686_0001255 Ga0495686_0001255_22438_23037 198
164 3300049823 Ga0501044_0589017 Ga0501044_0589017_298_912 198
165 3300053087 Ga0500643_000078 Ga0500643_000078_63742_64341 198
166 3300061719 Ga0466962_0056990 Ga0466962_0056990_545_1144 198
167 3300001979 JGI24740J21852_10003446 JGI24740J21852_100034469 199
168 3300001979 JGI24740J21852_10003825 JGI24740J21852_100038253 199
169 3300001990 JGI24737J22298_10000233 JGI24737J22298_1000023315 199
170 3300002067 JGI24735J21928_10035742 JGI24735J21928_100357421 199
171 3300003759 Ga0055525_1000037 Ga0055525_1000037259 199
172 3300003762 Ga0055542_1000088 Ga0055542_100008847 199
173 3300003763 Ga0055529_1000034 Ga0055529_100003447 199
174 3300005327 Ga0070658_10000399 Ga0070658_100003999 199
175 3300005327 Ga0070658_10291744 Ga0070658_102917441 199
176 3300005337 Ga0070682_100009627 Ga0070682_1000096272 199
177 3300005339 Ga0070660_100011372 Ga0070660_1000113724 199
178 3300005341 Ga0070691_10000798 Ga0070691_100007982 199
179 3300005344 Ga0070661_100000720 Ga0070661_10000072019 199
180 3300005345 Ga0070692_10165651 Ga0070692_101656512 199
181 3300005355 Ga0070671_100227532 Ga0070671_1002275322 199
182 3300005356 Ga0070674_100000131 Ga0070674_10000013118 199
183 3300005364 Ga0070673_100167076 Ga0070673_1001670762 199
184 3300005366 Ga0070659_100070367 Ga0070659_1000703673 199
185 3300005367 Ga0070667_100016771 Ga0070667_1000167712 199
186 3300005455 Ga0070663_100006857 Ga0070663_1000068574 199
187 3300005456 Ga0070678_100000005 Ga0070678_1000000053 199
188 3300005457 Ga0070662_100210265 Ga0070662_1002102652 199
189 3300005457 Ga0070662_100243615 Ga0070662_1002436152 199
190 3300005459 Ga0068867_100044961 Ga0068867_1000449613 199
191 3300005530 Ga0070679_100074756 Ga0070679_1000747563 199
192 3300005535 Ga0070684_100038453 Ga0070684_1000384532 199
193 3300005539 Ga0068853_100002834 Ga0068853_10000283413 199
194 3300005539 Ga0068853_100045794 Ga0068853_1000457943 199
195 3300005563 Ga0068855_100080519 Ga0068855_1000805193 199
196 3300005563 Ga0068855_100299911 Ga0068855_1002999112 199
197 3300005563 Ga0068855_100424094 Ga0068855_1004240942 199
198 3300005564 Ga0070664_100026417 Ga0070664_1000264173 199
199 3300005564 Ga0070664_100079593 Ga0070664_1000795932 199
200 3300005577 Ga0068857_100227621 Ga0068857_1002276212 199
201 3300005578 Ga0068854_100024841 Ga0068854_1000248414 199
202 3300005834 Ga0068851_10002308 Ga0068851_100023083 199
203 3300005834 Ga0068851_10059710 Ga0068851_100597102 199
204 3300006051 Ga0075364_10000128 Ga0075364_1000012818 199
205 3300006178 Ga0075367_10011394 Ga0075367_100113945 199
206 3300006186 Ga0075369_10185963 Ga0075369_101859631 199
207 3300006186 Ga0075369_10224770 Ga0075369_102247702 199
208 3300006195 Ga0075366_10035174 Ga0075366_100351744 199
209 3300006237 Ga0097621_100112361 Ga0097621_1001123612 199
210 3300006353 Ga0075370_10004502 Ga0075370_100045023 199
211 3300006353 Ga0075370_10006451 Ga0075370_100064512 199
212 3300006358 Ga0068871_100086750 Ga0068871_1000867502 199
213 3300009093 Ga0105240_10012577 Ga0105240_100125773 199
214 3300009093 Ga0105240_10042418 Ga0105240_100424183 199
215 3300009093 Ga0105240_10383385 Ga0105240_103833853 199
216 3300009148 Ga0105243_10000030 Ga0105243_1000003065 199
217 3300009176 Ga0105242_10474722 Ga0105242_104747222 199
218 3300009545 Ga0105237_10140127 Ga0105237_101401273 199
219 3300009551 Ga0105238_10101012 Ga0105238_101010122 199
220 3300010375 Ga0105239_10000075 Ga0105239_1000007529 199
221 3300010375 Ga0105239_10131099 Ga0105239_101310993 199
222 3300011119 Ga0105246_10074720 Ga0105246_100747202 199
223 3300013100 Ga0157373_10052787 Ga0157373_100527873 199
224 3300013102 Ga0157371_10000043 Ga0157371_1000004366 199
225 3300013105 Ga0157369_10091724 Ga0157369_100917243 199
226 3300013296 Ga0157374_10073305 Ga0157374_100733053 199
227 3300013307 Ga0157372_10029437 Ga0157372_100294372 199
228 3300014969 Ga0157376_10159754 Ga0157376_101597542 199
229 3300017792 Ga0163161_10203254 Ga0163161_102032542 199
230 3300025230 Ga0209563_100053 Ga0209563_100053209 199
231 3300025250 Ga0209026_1032492 Ga0209026_10324922 199
232 3300025254 Ga0209148_1000093 Ga0209148_100009349 199
233 3300025272 Ga0209455_1000045 Ga0209455_1000045190 199
234 3300025297 Ga0209758_1000001 Ga0209758_1000001145 199
235 3300025321 Ga0207656_10010851 Ga0207656_100108512 199
236 3300025321 Ga0207656_10038251 Ga0207656_100382513 199
237 3300025904 Ga0207647_10000595 Ga0207647_1000059523 199
238 3300025904 Ga0207647_10055310 Ga0207647_100553102 199
239 3300025907 Ga0207645_10019176 Ga0207645_100191763 199
240 3300025909 Ga0207705_10000308 Ga0207705_1000030835 199
241 3300025909 Ga0207705_10276470 Ga0207705_102764702 199
242 3300025909 Ga0207705_10332740 Ga0207705_103327402 199
243 3300025911 Ga0207654_10001465 Ga0207654_100014654 199
244 3300025913 Ga0207695_10009039 Ga0207695_100090397 199
245 3300025913 Ga0207695_10010516 Ga0207695_100105166 199
246 3300025913 Ga0207695_10027520 Ga0207695_100275207 199
247 3300025914 Ga0207671_10027358 Ga0207671_100273583 199
248 3300025917 Ga0207660_10215136 Ga0207660_102151362 199
249 3300025919 Ga0207657_10000583 Ga0207657_100005834 199
250 3300025919 Ga0207657_10002634 Ga0207657_100026342 199
251 3300025920 Ga0207649_10000508 Ga0207649_100005088 199
252 3300025921 Ga0207652_10377484 Ga0207652_103774842 199
253 3300025924 Ga0207694_10007504 Ga0207694_100075045 199
254 3300025924 Ga0207694_10484922 Ga0207694_104849222 199
255 3300025932 Ga0207690_10008730 Ga0207690_100087303 199
256 3300025932 Ga0207690_10592001 Ga0207690_105920012 199
257 3300025935 Ga0207709_10000137 Ga0207709_1000013765 199
258 3300025937 Ga0207669_10000031 Ga0207669_1000003160 199
259 3300025937 Ga0207669_10021860 Ga0207669_100218604 199
260 3300025942 Ga0207689_10394222 Ga0207689_103942222 199
261 3300025944 Ga0207661_10181370 Ga0207661_101813702 199
262 3300025945 Ga0207679_10077190 Ga0207679_100771902 199
263 3300025949 Ga0207667_10000069 Ga0207667_10000069100 199
264 3300025949 Ga0207667_10008985 Ga0207667_100089852 199
265 3300025949 Ga0207667_10515173 Ga0207667_105151732 199
266 3300025960 Ga0207651_10160069 Ga0207651_101600692 199
267 3300025981 Ga0207640_10005408 Ga0207640_100054083 199
268 3300025981 Ga0207640_10790292 Ga0207640_107902921 199
269 3300025986 Ga0207658_10056979 Ga0207658_100569793 199
270 3300026041 Ga0207639_10000527 Ga0207639_1000052724 199
271 3300026041 Ga0207639_10058674 Ga0207639_100586742 199
272 3300026067 Ga0207678_10023533 Ga0207678_100235334 199
273 3300026078 Ga0207702_10003017 Ga0207702_1000301710 199
274 3300026089 Ga0207648_10053223 Ga0207648_100532232 199
275 3300026116 Ga0207674_10002608 Ga0207674_1000260822 199
276 3300026116 Ga0207674_10099326 Ga0207674_100993263 199
277 3300026121 Ga0207683_10000115 Ga0207683_100001157 199
278 3300026142 Ga0207698_10010758 Ga0207698_100107587 199
279 3300026142 Ga0207698_10014407 Ga0207698_100144072 199
280 3300027866 Ga0209813_10080761 Ga0209813_100807612 199
281 3300028786 Ga0307517_10018546 Ga0307517_100185467 199
282 3300031456 Ga0307513_10147002 Ga0307513_101470022 199
283 3300031507 Ga0307509_10216420 Ga0307509_102164202 199
284 3300033180 Ga0307510_10312264 Ga0307510_103122642 199
285 3300037418 Ga0395900_0358816 Ga0395900_0358816_105_728 199
286 3300037471 Ga0395905_0469531 Ga0395905_0469531_251_850 199
287 3300037471 Ga0395905_1113738 Ga0395905_1113738_35_658 199
288 3300038443 Ga0395901_0726548 Ga0395901_0726548_225_824 199
289 3300039437 Ga0436365_0172558 Ga0436365_0172558_1390_1989 199
290 3300041486 Ga0451807_1028123 Ga0451807_1028123_141_797 199
291 3300044656 Ga0466969_0012462 Ga0466969_0012462_2638_3237 199
292 3300044684 Ga0466966_0279368 Ga0466966_0279368_201_800 199
293 3300044694 Ga0466963_0009657 Ga0466963_0009657_984_1592 199
294 3300044694 Ga0466963_0201385 Ga0466963_0201385_778_1377 199
295 3300044719 Ga0466971_0162489 Ga0466971_0162489_211_834 199
296 3300044842 Ga0466957_0015244 Ga0466957_0015244_3804_4427 199
297 3300045836 Ga0466958_0078635 Ga0466958_0078635_1269_1868 199
298 3300045976 Ga0466967_0028237 Ga0466967_0028237_3641_4264 199
299 3300045976 Ga0466967_0122564 Ga0466967_0122564_304_903 199
300 3300046459 Ga0495629_0075561 Ga0495629_0075561_1026_1628 199
301 3300046471 Ga0495650_0000083 Ga0495650_0000083_27907_28509 199
302 3300046475 Ga0495639_0332837 Ga0495639_0332837_126_728 199
303 3300046491 Ga0495584_0024569 Ga0495584_0024569_543_1145 199
304 3300046492 Ga0495585_0010250 Ga0495585_0010250_2541_3200 199
305 3300046506 Ga0495583_0000451 Ga0495583_0000451_7732_8334 199
306 3300046506 Ga0495583_0018110 Ga0495583_0018110_2643_3299 199
307 3300046506 Ga0495583_0019010 Ga0495583_0019010_2113_2772 199
308 3300046507 Ga0495606_0037506 Ga0495606_0037506_1938_2540 199
309 3300046513 Ga0495616_0082948 Ga0495616_0082948_815_1417 199
310 3300046518 Ga0495631_0012517 Ga0495631_0012517_3354_4010 199
311 3300046518 Ga0495631_0047521 Ga0495631_0047521_484_1143 199
312 3300046520 Ga0495637_0011921 Ga0495637_0011921_3269_3928 199
313 3300046522 Ga0495643_0006956 Ga0495643_0006956_994_1596 199
314 3300046524 Ga0495648_0003521 Ga0495648_0003521_688_1344 199
315 3300046525 Ga0495663_0000185 Ga0495663_0000185_23552_24208 199
316 3300046526 Ga0495666_0035552 Ga0495666_0035552_1312_1941 199
317 3300046528 Ga0495642_0063107 Ga0495642_0063107_799_1401 199
318 3300046557 Ga0495622_0010684 Ga0495622_0010684_1280_1882 199
319 3300046558 Ga0495633_0003174 Ga0495633_0003174_5755_6411 199
320 3300046558 Ga0495633_0042116 Ga0495633_0042116_1299_1901 199
321 3300046648 Ga0495611_0005557 Ga0495611_0005557_1127_1786 199
322 3300046648 Ga0495611_0033273 Ga0495611_0033273_942_1598 199
323 3300046648 Ga0495611_0161775 Ga0495611_0161775_39_695 199
324 3300046660 Ga0495625_0001137 Ga0495625_0001137_14560_15219 199
325 3300046660 Ga0495625_0012140 Ga0495625_0012140_276_935 199
326 3300046660 Ga0495625_0015282 Ga0495625_0015282_820_1476 199
327 3300046660 Ga0495625_0062107 Ga0495625_0062107_160_816 199
328 3300046660 Ga0495625_0071826 Ga0495625_0071826_669_1271 199
329 3300046665 Ga0495661_0061803 Ga0495661_0061803_1584_2186 199
330 3300046684 Ga0495669_0000469 Ga0495669_0000469_4497_5225 199
331 3300046684 Ga0495669_0050502 Ga0495669_0050502_1021_1620 199
332 3300046694 Ga0495649_0037799 Ga0495649_0037799_1403_2059 199
333 3300046809 Ga0495600_0024671 Ga0495600_0024671_1343_1945 199
334 3300047318 Ga0495636_0323724 Ga0495636_0323724_40_696 199
335 3300047323 Ga0495683_0016146 Ga0495683_0016146_2492_3148 199
336 3300047443 Ga0495687_000188 Ga0495687_000188_63464_64192 199
337 3300047443 Ga0495687_001488 Ga0495687_001488_20682_21296 199
338 3300047445 Ga0495677_0005000 Ga0495677_0005000_4060_4662 199
339 3300047445 Ga0495677_0023435 Ga0495677_0023435_1505_2104 199
340 3300047470 Ga0495681_0003776 Ga0495681_0003776_9321_9977 199
341 3300047470 Ga0495681_0127288 Ga0495681_0127288_252_908 199
342 3300048090 Ga0495615_0028073 Ga0495615_0028073_451_1107 199
343 3300048905 Ga0496102_0000320 Ga0496102_0000320_27986_28642 199
344 3300048906 Ga0496103_0000244 Ga0496103_0000244_47749_48405 199
345 3300048907 Ga0496104_0010180 Ga0496104_0010180_6733_7389 199
346 3300048908 Ga0496105_0000287 Ga0496105_0000287_4587_5243 199
347 3300048910 Ga0496107_0035864 Ga0496107_0035864_1436_2092 199
348 3300048912 Ga0496109_0206533 Ga0496109_0206533_1057_1713 199
349 3300048914 Ga0496111_0022647 Ga0496111_0022647_2439_3095 199
350 3300048916 Ga0496113_0604174 Ga0496113_0604174_188_844 199
351 3300048917 Ga0496114_0239118 Ga0496114_0239118_478_1134 199
352 3300048918 Ga0496115_0000061 Ga0496115_0000061_34414_35070 199
353 3300048919 Ga0496116_0015101 Ga0496116_0015101_2326_2982 199
354 3300048920 Ga0496117_0000281 Ga0496117_0000281_66153_66809 199
355 3300048921 Ga0496118_0001634 Ga0496118_0001634_27816_28472 199
356 3300048922 Ga0496119_0008547 Ga0496119_0008547_4535_5191 199
357 3300048924 Ga0496121_0000247 Ga0496121_0000247_107821_108423 199
358 3300048924 Ga0496121_0001929 Ga0496121_0001929_27935_28591 199
359 3300048924 Ga0496121_0008204 Ga0496121_0008204_8154_8756 199
360 3300048925 Ga0496122_0016912 Ga0496122_0016912_2572_3228 199
361 3300048926 Ga0496123_0011498 Ga0496123_0011498_1106_1762 199
362 3300048927 Ga0496124_0000266 Ga0496124_0000266_34404_35060 199
363 3300048928 Ga0496125_0001502 Ga0496125_0001502_12634_13290 199
364 3300048929 Ga0496126_0000819 Ga0496126_0000819_34414_35070 199
365 3300050490 nmdc:mga03n38_9874_c1 nmdc:mga03n38_9874_c1_2243_2857 199
366 3300050491 nmdc:mga00v17_1741_c1 nmdc:mga00v17_1741_c1_10347_10961 199
367 3300050493 nmdc:mga0k408_26050_c1 nmdc:mga0k408_26050_c1_1954_2568 199
368 3300050495 nmdc:mga04h51_95739_c1 nmdc:mga04h51_95739_c1_312_926 199
369 3300050496 nmdc:mga07m45_190_c1 nmdc:mga07m45_190_c1_8146_8760 199
370 3300050496 nmdc:mga07m45_201888_c1 nmdc:mga07m45_201888_c1_403_1017 199
371 3300050516 nmdc:mga0sz30_230105_c1 nmdc:mga0sz30_230105_c1_80_694 199
372 3300053119 Ga0500595_001230 Ga0500595_001230_8171_8773 199
373 3300053119 Ga0500595_034816 Ga0500595_034816_60_662 199
374 3300053130 Ga0500642_0018282 Ga0500642_0018282_674_1291 199
375 3300053154 Ga0500619_087198 Ga0500619_087198_203_805 199
376 3300053177 Ga0500636_0007495 Ga0500636_0007495_556_1158 199
377 3300053730 Ga0500645_000249 Ga0500645_000249_13536_14195 199
378 3300053735 Ga0500596_002105 Ga0500596_002105_394_996 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

141

190

0.99

PF08281

Sigma70_r4_2

Sigma-70, region 4

135

188

0.97

PF04542

Sigma70_r2

Sigma-70 region 2

41

108

0.96

PF07638

Sigma70_ECF

ECF sigma factor

20

193

0.72

Feature Viewer

pLDDT pTM Quality
85.06 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map