F427809

General Info

Members Datasets Scaffolds Average Seq Length
377 232 377 92

Family's Representative Sequence

Representative Sequence 3300046809|Ga0495600_0029267|Ga0495600_0029267_3051_3368
Length 105
Sequence MRRLARASGGAAMSMTHAVVLIEADRDALSTLGGELADIEGVAEAYSVTGQWDFVAIVRVPDHEQLADVVTDRIGTLSGVARTQTMVAFAAFSRHDLEALFSIGE

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
108 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
109 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
112 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
113 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
116 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
117 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
145 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
146 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
147 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
148 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
149 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
198 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
199 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
200 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
201 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
202 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
203 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
204 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
205 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
206 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
207 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
208 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
209 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
210 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
211 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
212 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
213 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
214 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
217 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 1.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.51
Rhizosphere 92.84
Stem 0
Stem Tuber 0
Unclassified 2.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10082391 3300003203 Bacteria 984
2 JGI25406J46586_10139465 3300003203 Bacteria 709
3 JGI25407J50210_10142791 3300003373 Bacteria 589
4 Ga0070683_100110448 3300005329 Bacteria 2594
5 Ga0070683_102278089 3300005329 Bacteria 520
6 Ga0070680_101221982 3300005336 Bacteria 650
7 Ga0070682_100672454 3300005337 Bacteria 827
8 Ga0068868_100300825 3300005338 Bacteria 1362
9 Ga0070689_102096349 3300005340 Bacteria 518
10 Ga0070661_100608879 3300005344 Bacteria 884
11 Ga0070668_100939624 3300005347 Bacteria 775
12 Ga0070688_100111276 3300005365 Bacteria 1822
13 Ga0070659_100214082 3300005366 Bacteria 1588
14 Ga0070709_10208623 3300005434 Bacteria 1388
15 Ga0070709_10561979 3300005434 Bacteria 874
16 Ga0070709_10681783 3300005434 Bacteria 798
17 Ga0070709_11084399 3300005434 Unclassified 640
18 Ga0070714_100067170 3300005435 Bacteria 3091
19 Ga0070714_100119558 3300005435 Bacteria 2342
20 Ga0070714_100249965 3300005435 Bacteria 1639
21 Ga0070714_101225473 3300005435 Bacteria 732
22 Ga0070714_101574810 3300005435 Bacteria 642
23 Ga0070713_100430788 3300005436 Unclassified 1236
24 Ga0070713_101582714 3300005436 Bacteria 636
25 Ga0070710_10083855 3300005437 Bacteria 1866
26 Ga0070710_10461355 3300005437 Bacteria 863
27 Ga0070710_10807288 3300005437 Bacteria 671
28 Ga0070701_10708889 3300005438 Bacteria 678
29 Ga0070711_100025967 3300005439 Bacteria 3836
30 Ga0070711_101326061 3300005439 Bacteria 625
31 Ga0070700_100211571 3300005441 Bacteria 1368
32 Ga0070708_100008029 3300005445 Bacteria 8456
33 Ga0070663_101348309 3300005455 Bacteria 630
34 Ga0070662_100648643 3300005457 Bacteria 890
35 Ga0070681_10443566 3300005458 Bacteria 1210
36 Ga0068867_100206927 3300005459 Bacteria 1574
37 Ga0068867_101903166 3300005459 Bacteria 561
38 Ga0070685_10813630 3300005466 Bacteria 690
39 Ga0070706_100007300 3300005467 Bacteria 10373
40 Ga0070707_100001888 3300005468 Bacteria 20066
41 Ga0070707_100665600 3300005468 Bacteria 1004
42 Ga0070698_100001377 3300005471 Bacteria 26968
43 Ga0070699_101547362 3300005518 Bacteria 608
44 Ga0068853_100995906 3300005539 Bacteria 807
45 Ga0070672_100771974 3300005543 Bacteria 844
46 Ga0070686_101928208 3300005544 Bacteria 504
47 Ga0070695_101251668 3300005545 Bacteria 612
48 Ga0070696_100867493 3300005546 Bacteria 747
49 Ga0070664_100023880 3300005564 Bacteria 5051
50 Ga0070664_100217766 3300005564 Bacteria 1708
51 Ga0068856_100196695 3300005614 Bacteria 2030
52 Ga0068856_101242968 3300005614 Bacteria 761
53 Ga0070702_100365455 3300005615 Bacteria 1021
54 Ga0068852_101194412 3300005616 Bacteria 782
55 Ga0068866_10282139 3300005718 Bacteria 1029
56 Ga0068851_10541100 3300005834 Bacteria 703
57 Ga0081455_10001214 3300005937 Bacteria 32286
58 Ga0081538_10000332 3300005981 Bacteria 53567
59 Ga0081538_10045625 3300005981 Bacteria 2714
60 Ga0081538_10072232 3300005981 Bacteria 1893
61 Ga0081540_1064799 3300005983 Bacteria 1722
62 Ga0081539_10003484 3300005985 Bacteria 19225
63 Ga0081539_10025144 3300005985 Bacteria 3844
64 Ga0081539_10044799 3300005985 Bacteria 2551
65 Ga0081539_10189204 3300005985 Unclassified 959
66 Ga0081539_10335590 3300005985 Bacteria 639
67 Ga0070717_10016827 3300006028 Bacteria 5676
68 Ga0070716_100049499 3300006173 Bacteria 2381
69 Ga0070716_100182206 3300006173 Unclassified 1380
70 Ga0070712_100117806 3300006175 Unclassified 1994
71 Ga0070712_100138516 3300006175 Bacteria 1854
72 Ga0070712_100333174 3300006175 Unclassified 1237
73 Ga0070712_101159479 3300006175 Bacteria 672
74 Ga0070712_101673256 3300006175 Bacteria 557
75 Ga0070712_101744722 3300006175 Bacteria 545
76 Ga0075428_100178471 3300006844 Bacteria 2299
77 Ga0075428_100828992 3300006844 Bacteria 983
78 Ga0075428_102386474 3300006844 Unclassified 543
79 Ga0075430_100147019 3300006846 Bacteria 1963
80 Ga0075430_100179370 3300006846 Bacteria 1762
81 Ga0075431_100070382 3300006847 Bacteria 3610
82 Ga0075435_100738595 3300007076 Bacteria 856
83 Ga0105240_10004346 3300009093 Bacteria 21634
84 Ga0111539_10936981 3300009094 Bacteria 1007
85 Ga0111539_12763430 3300009094 Bacteria 569
86 Ga0105245_10855386 3300009098 Bacteria 950
87 Ga0105245_11150901 3300009098 Bacteria 823
88 Ga0105245_12026643 3300009098 Bacteria 629
89 Ga0114129_10392494 3300009147 Bacteria 1830
90 Ga0114129_13313038 3300009147 Bacteria 520
91 Ga0105243_10091934 3300009148 Bacteria 2500
92 Ga0105243_11109511 3300009148 Bacteria 800
93 Ga0105242_10678815 3300009176 Bacteria 1005
94 Ga0105237_10013622 3300009545 Bacteria 8516
95 Ga0105238_11325327 3300009551 Bacteria 746
96 Ga0105239_10467186 3300010375 Bacteria 1432
97 Ga0105239_10714886 3300010375 Bacteria 1146
98 Ga0105246_11940128 3300011119 Bacteria 566
99 Ga0157370_12084741 3300013104 Unclassified 508
100 Ga0157369_12127762 3300013105 Bacteria 569
101 Ga0163162_10437733 3300013306 Bacteria 1440
102 Ga0157372_10395861 3300013307 Bacteria 1610
103 Ga0157375_12708528 3300013308 Unclassified 593
104 Ga0157377_10295718 3300014745 Bacteria 1067
105 Ga0157377_10490290 3300014745 Bacteria 857
106 Ga0157376_12499850 3300014969 Bacteria 556
107 Ga0206349_1235485 3300020075 Bacteria 3093
108 Ga0206354_10038934 3300020081 Unclassified 987
109 Ga0206354_10721846 3300020081 Bacteria 764
110 Ga0206353_10401775 3300020082 Bacteria 625
111 Ga0206353_11834438 3300020082 Bacteria 819
112 Ga0213876_10491868 3300021384 Bacteria 653
113 Ga0207656_10338691 3300025321 Bacteria 749
114 Ga0207682_10071858 3300025893 Bacteria 1467
115 Ga0207692_10356247 3300025898 Bacteria 903
116 Ga0207692_10997999 3300025898 Bacteria 553
117 Ga0207688_10037894 3300025901 Bacteria 2675
118 Ga0207688_10685148 3300025901 Bacteria 648
119 Ga0207685_10495891 3300025905 Bacteria 642
120 Ga0207699_10047405 3300025906 Bacteria 2520
121 Ga0207699_10816944 3300025906 Bacteria 686
122 Ga0207695_10064774 3300025913 Bacteria 3761
123 Ga0207671_10008955 3300025914 Bacteria 8422
124 Ga0207693_10073804 3300025915 Bacteria 2671
125 Ga0207693_10100780 3300025915 Bacteria 2265
126 Ga0207693_10209937 3300025915 Bacteria 1530
127 Ga0207693_10286037 3300025915 Unclassified 1292
128 Ga0207693_11135164 3300025915 Bacteria 592
129 Ga0207663_10018720 3300025916 Bacteria 3888
130 Ga0207663_10235739 3300025916 Bacteria 1339
131 Ga0207663_10375008 3300025916 Bacteria 1083
132 Ga0207660_10835270 3300025917 Bacteria 752
133 Ga0207649_10711820 3300025920 Bacteria 779
134 Ga0207646_10029958 3300025922 Bacteria 4940
135 Ga0207646_10538963 3300025922 Unclassified 1050
136 Ga0207694_11445440 3300025924 Bacteria 581
137 Ga0207659_11176984 3300025926 Bacteria 659
138 Ga0207659_11255872 3300025926 Bacteria 636
139 Ga0207687_10105671 3300025927 Bacteria 2080
140 Ga0207700_10764172 3300025928 Bacteria 864
141 Ga0207664_10102728 3300025929 Bacteria 2364
142 Ga0207664_10119357 3300025929 Bacteria 2205
143 Ga0207664_10194480 3300025929 Bacteria 1748
144 Ga0207664_11029051 3300025929 Bacteria 738
145 Ga0207664_11085385 3300025929 Bacteria 716
146 Ga0207664_11296371 3300025929 Bacteria 648
147 Ga0207664_11814903 3300025929 Bacteria 532
148 Ga0207664_11998289 3300025929 Unclassified 503
149 Ga0207690_10181324 3300025932 Bacteria 1586
150 Ga0207686_10657389 3300025934 Bacteria 830
151 Ga0207704_11255750 3300025938 Bacteria 632
152 Ga0207665_10079567 3300025939 Bacteria 2253
153 Ga0207665_10216201 3300025939 Unclassified 1402
154 Ga0207691_10232914 3300025940 Bacteria 1594
155 Ga0207689_10292673 3300025942 Bacteria 1349
156 Ga0207661_11917426 3300025944 Bacteria 538
157 Ga0207679_10014920 3300025945 Bacteria 5119
158 Ga0207640_10099239 3300025981 Bacteria 2038
159 Ga0207658_10251269 3300025986 Bacteria 1503
160 Ga0207677_11795988 3300026023 Bacteria 569
161 Ga0207639_10581969 3300026041 Bacteria 1031
162 Ga0207639_10661709 3300026041 Bacteria 967
163 Ga0207702_10576188 3300026078 Bacteria 1103
164 Ga0207648_10074369 3300026089 Bacteria 2961
165 Ga0207648_10268174 3300026089 Bacteria 1525
166 Ga0207675_102142186 3300026118 Bacteria 575
167 Ga0207698_10186564 3300026142 Bacteria 1843
168 Ga0207698_10539167 3300026142 Bacteria 1142
169 Ga0265337_1001321 3300028556 Bacteria 12353
170 Ga0265326_10004689 3300028558 Bacteria 4358
171 Ga0265319_1000581 3300028563 Bacteria 24540
172 Ga0265334_10087197 3300028573 Bacteria 1143
173 Ga0265318_10000976 3300028577 Bacteria 18349
174 Ga0265323_10106025 3300028653 Bacteria 925
175 Ga0265322_10022699 3300028654 Bacteria 1795
176 Ga0265336_10000001 3300028666 Bacteria 916179
177 Ga0265338_10000004 3300028800 Bacteria 644793
178 Ga0265338_10015764 3300028800 Bacteria 8277
179 Ga0316176_1184707 3300030732 Bacteria 547
180 Ga0314311_1020881 3300030733 Bacteria 661
181 Ga0265328_10235318 3300031239 Bacteria 699
182 Ga0265340_10000002 3300031247 Bacteria 711693
183 Ga0265339_10109109 3300031249 Unclassified 1433
184 Ga0265327_10004464 3300031251 Bacteria 12371
185 Ga0265327_10009205 3300031251 Bacteria 7164
186 Ga0265327_10029925 3300031251 Bacteria 3088
187 Ga0265316_10247205 3300031344 Bacteria 1311
188 Ga0307408_100443993 3300031548 Bacteria 1124
189 Ga0307408_101006638 3300031548 Bacteria 768
190 Ga0307408_101660576 3300031548 Bacteria 608
191 Ga0265342_10089166 3300031712 Bacteria 1770
192 Ga0265342_10410796 3300031712 Bacteria 698
193 Ga0307405_10200127 3300031731 Bacteria 1450
194 Ga0307405_10408402 3300031731 Bacteria 1065
195 Ga0307405_10818019 3300031731 Bacteria 782
196 Ga0307405_11594589 3300031731 Bacteria 576
197 Ga0307413_10106296 3300031824 Bacteria 1868
198 Ga0307413_10496292 3300031824 Bacteria 979
199 Ga0307413_11073109 3300031824 Bacteria 694
200 Ga0307413_11836744 3300031824 Bacteria 543
201 Ga0307413_11904317 3300031824 Bacteria 534
202 Ga0307410_10131802 3300031852 Bacteria 1837
203 Ga0307410_10274609 3300031852 Bacteria 1320
204 Ga0307410_10658150 3300031852 Bacteria 879
205 Ga0307410_11245253 3300031852 Bacteria 649
206 Ga0307406_11028046 3300031901 Bacteria 708
207 Ga0307406_11104480 3300031901 Bacteria 685
208 Ga0307407_10108324 3300031903 Bacteria 1739
209 Ga0307407_10294543 3300031903 Bacteria 1129
210 Ga0307407_10648367 3300031903 Unclassified 791
211 Ga0307412_10781100 3300031911 Bacteria 827
212 Ga0307412_11004707 3300031911 Bacteria 737
213 Ga0307409_100099685 3300031995 Bacteria 2406
214 Ga0307409_100815622 3300031995 Bacteria 942
215 Ga0307409_101123659 3300031995 Bacteria 807
216 Ga0307409_101541771 3300031995 Bacteria 692
217 Ga0307409_101702270 3300031995 Bacteria 659
218 Ga0307409_101901240 3300031995 Unclassified 625
219 Ga0307416_100036777 3300032002 Bacteria 3759
220 Ga0307416_100076241 3300032002 Bacteria 2810
221 Ga0307416_100197802 3300032002 Bacteria 1903
222 Ga0307416_100215879 3300032002 Bacteria 1835
223 Ga0307416_100295299 3300032002 Bacteria 1607
224 Ga0307416_100526488 3300032002 Bacteria 1251
225 Ga0307416_100708762 3300032002 Bacteria 1096
226 Ga0307416_101982188 3300032002 Bacteria 685
227 Ga0307416_103171093 3300032002 Bacteria 550
228 Ga0307414_10250055 3300032004 Bacteria 1473
229 Ga0307414_10854379 3300032004 Bacteria 832
230 Ga0307414_10976244 3300032004 Bacteria 779
231 Ga0307414_11182524 3300032004 Bacteria 708
232 Ga0307411_10274309 3300032005 Bacteria 1339
233 Ga0307411_10314454 3300032005 Bacteria 1262
234 Ga0307415_100050081 3300032126 Bacteria 2828
235 Ga0307415_100461832 3300032126 Bacteria 1100
236 Ga0307415_101031280 3300032126 Bacteria 766
237 Ga0307415_101126927 3300032126 Bacteria 736
238 Ga0307415_101167063 3300032126 Bacteria 724
239 Ga0307415_101560163 3300032126 Bacteria 633
240 Ga0373947_0839160 3300035725 Bacteria 627
241 Ga0373937_0180388 3300036401 Unclassified 1983
242 Ga0373937_1898137 3300036401 Unclassified 542
243 Ga0436364_1068218 3300037853 Bacteria 910
244 Ga0436364_1144136 3300037853 Bacteria 610
245 Ga0395901_0799912 3300038443 Bacteria 932
246 Ga0395901_1184068 3300038443 Bacteria 731
247 Ga0436365_0110090 3300039437 Bacteria 2433
248 Ga0436365_0768982 3300039437 Bacteria 1354
249 Ga0436363_0282143 3300039450 Unclassified 788
250 Ga0436363_1559163 3300039450 Bacteria 510
251 Ga0451807_0809165 3300041486 Bacteria 677
252 Ga0451845_0910241 3300041501 Bacteria 584
253 Ga0451853_1819362 3300041512 Bacteria 567
254 Ga0439448_0081619 3300042005 Bacteria 1086
255 Ga0439448_0166081 3300042005 Bacteria 769
256 Ga0439450_050287 3300042008 Bacteria 988
257 Ga0439463_061086 3300042016 Bacteria 963
258 Ga0450905_063123 3300042142 Bacteria 622
259 Ga0439458_0157079 3300042157 Bacteria 611
260 Ga0439444_0197518 3300042437 Bacteria 506
261 Ga0439464_0104654 3300042439 Bacteria 862
262 Ga0466972_0498504 3300044658 Bacteria 573
263 Ga0466965_0204327 3300044683 Bacteria 1049
264 Ga0466966_0927336 3300044684 Bacteria 525
265 Ga0466963_0071241 3300044694 Bacteria 2339
266 Ga0466963_0100528 3300044694 Bacteria 1979
267 Ga0466963_0226954 3300044694 Unclassified 1308
268 Ga0466963_0962297 3300044694 Bacteria 601
269 Ga0466957_0028723 3300044842 Bacteria 3313
270 Ga0466959_0638274 3300045049 Bacteria 715
271 Ga0466958_0162868 3300045836 Bacteria 1410
272 Ga0466958_0933019 3300045836 Bacteria 566
273 Ga0466958_1021216 3300045836 Bacteria 540
274 Ga0466958_1059216 3300045836 Bacteria 529
275 Ga0466967_0066531 3300045976 Bacteria 3211
276 Ga0466967_0144199 3300045976 Bacteria 2220
277 Ga0466967_0480383 3300045976 Bacteria 1217
278 Ga0466967_0729810 3300045976 Bacteria 982
279 Ga0466967_1175278 3300045976 Bacteria 764
280 Ga0466967_2526859 3300045976 Bacteria 508
281 Ga0495592_0598041 3300046454 Bacteria 673
282 Ga0495590_0035969 3300046457 Bacteria 1728
283 Ga0495629_0853845 3300046459 Bacteria 599
284 Ga0495653_0000374 3300046463 Bacteria 36082
285 Ga0495653_0146237 3300046463 Bacteria 1656
286 Ga0495664_0000007 3300046477 Bacteria 386710
287 Ga0495584_0552190 3300046491 Bacteria 587
288 Ga0495596_0094448 3300046500 Bacteria 1161
289 Ga0495608_0239179 3300046511 Bacteria 1135
290 Ga0495608_0874200 3300046511 Bacteria 527
291 Ga0495616_0100313 3300046513 Bacteria 1359
292 Ga0495616_0282642 3300046513 Bacteria 705
293 Ga0495618_0000151 3300046514 Bacteria 49582
294 Ga0495630_0000414 3300046517 Bacteria 32942
295 Ga0495632_0372875 3300046519 Bacteria 626
296 Ga0495637_0194062 3300046520 Bacteria 748
297 Ga0495652_0078948 3300046529 Bacteria 2723
298 Ga0495665_0205027 3300046531 Bacteria 1022
299 Ga0495598_0449186 3300046537 Bacteria 510
300 Ga0495597_0151381 3300046542 Bacteria 952
301 Ga0495597_0201420 3300046542 Bacteria 797
302 Ga0495645_0001966 3300046543 Bacteria 13967
303 Ga0495657_0000008 3300046675 Bacteria 221090
304 Ga0495599_0311479 3300046678 Unclassified 949
305 Ga0495646_0243042 3300046680 Bacteria 967
306 Ga0495646_0690388 3300046680 Bacteria 514
307 Ga0495670_0109524 3300046691 Bacteria 1428
308 Ga0495600_0029267 3300046809 Bacteria 3566
309 Ga0495604_0000047 3300047317 Bacteria 109717
310 Ga0495676_0466174 3300047321 Bacteria 832
311 Ga0495684_0002636 3300047471 Bacteria 14253
312 Ga0495684_0100218 3300047471 Bacteria 2190
313 Ga0496100_0004800 3300048903 Bacteria 7219
314 Ga0496100_0342390 3300048903 Bacteria 1128
315 Ga0496101_0797350 3300048904 Bacteria 745
316 Ga0496101_1191822 3300048904 Bacteria 597
317 Ga0496102_0000002 3300048905 Bacteria 814588
318 Ga0496102_0144140 3300048905 Bacteria 2235
319 Ga0496103_0000046 3300048906 Bacteria 161981
320 Ga0496103_0175389 3300048906 Bacteria 1377
321 Ga0496104_0000001 3300048907 Bacteria 711867
322 Ga0496109_0197554 3300048912 Bacteria 1891
323 Ga0496110_0000502 3300048913 Bacteria 26572
324 Ga0496111_0001359 3300048914 Bacteria 13843
325 Ga0496113_0166621 3300048916 Bacteria 1744
326 Ga0496114_0994518 3300048917 Bacteria 722
327 Ga0496115_0000034 3300048918 Bacteria 135380
328 Ga0496115_0000329 3300048918 Bacteria 40480
329 Ga0496123_0511071 3300048926 Bacteria 523
330 Ga0501290_099911 3300049513 Bacteria 515
331 Ga0501291_065053 3300049514 Bacteria 695
332 Ga0501291_078164 3300049514 Bacteria 654
333 Ga0501295_175248 3300049518 Bacteria 537
334 Ga0501298_119085 3300049521 Bacteria 620
335 Ga0501299_043574 3300049522 Bacteria 907
336 Ga0501299_065390 3300049522 Bacteria 779
337 Ga0501299_078916 3300049522 Bacteria 728
338 Ga0501302_022694 3300049525 Bacteria 553
339 Ga0501201_056492 3300049651 Bacteria 500
340 Ga0501202_017315 3300049652 Bacteria 1407
341 Ga0501208_061088 3300049655 Bacteria 738
342 Ga0501209_198252 3300049656 Bacteria 617
343 Ga0501216_093529 3300049660 Bacteria 653
344 Ga0501227_213129 3300049665 Bacteria 549
345 Ga0501230_125589 3300049667 Bacteria 571
346 Ga0501233_009079 3300049668 Bacteria 1934
347 Ga0501233_166006 3300049668 Bacteria 624
348 Ga0501243_030010 3300049675 Bacteria 925
349 Ga0501248_027335 3300049678 Bacteria 631
350 Ga0501249_224799 3300049679 Bacteria 501
351 Ga0501221_077332 3300049704 Bacteria 795
352 Ga0501225_0090945 3300049705 Bacteria 884
353 Ga0501283_060666 3300049779 Bacteria 683
354 Ga0501212_010654 3300049851 Bacteria 1314
355 nmdc:mga05p37_598232_c1 3300050507 Bacteria 1245
356 nmdc:mga05p37_944068_c1 3300050507 Bacteria 924
357 nmdc:mga0qj67_500132_c1 3300050509 Bacteria 977
358 nmdc:mga0qj67_814842_c1 3300050509 Bacteria 738
359 nmdc:mga06r32_125336_c1 3300050510 Bacteria 2536
360 nmdc:mga06r32_1825033_c1 3300050510 Bacteria 543
361 nmdc:mga08y16_1729635_c1 3300050511 Bacteria 580
362 nmdc:mga08y16_495303_c1 3300050511 Bacteria 1242
363 nmdc:mga0n895_197057_c1 3300050512 Bacteria 2045
364 Ga0495601_0000276 3300053077 Bacteria 27580
365 Ga0495601_0046778 3300053077 Bacteria 2723
366 Ga0495612_0000023 3300053078 Bacteria 118413
367 Ga0495619_0186033 3300053085 Bacteria 1437
368 Ga0495619_0368548 3300053085 Bacteria 993
369 Ga0495619_0618230 3300053085 Unclassified 740
370 Ga0590071_022249 3300059421 Bacteria 1497
371 Ga0590071_028072 3300059421 Bacteria 1336
372 Ga0590074_017938 3300059423 Bacteria 1210
373 Ga0590075_010557 3300059424 Bacteria 2225
374 Ga0590077_031868 3300059426 Bacteria 1153
375 Ga0587094_009356 3300059513 Unclassified 1249
376 Ga0501082_1740641 3300060353 Bacteria 544
377 Ga0466962_0636400 3300061719 Bacteria 545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005981 Ga0081538_10000332 Ga0081538_100003322 87
2 3300005329 Ga0070683_100110448 Ga0070683_1001104484 91
3 3300005336 Ga0070680_101221982 Ga0070680_1012219822 91
4 3300005337 Ga0070682_100672454 Ga0070682_1006724542 91
5 3300005338 Ga0068868_100300825 Ga0068868_1003008253 91
6 3300005340 Ga0070689_102096349 Ga0070689_1020963491 91
7 3300005344 Ga0070661_100608879 Ga0070661_1006088792 91
8 3300005347 Ga0070668_100939624 Ga0070668_1009396242 91
9 3300005365 Ga0070688_100111276 Ga0070688_1001112762 91
10 3300005366 Ga0070659_100214082 Ga0070659_1002140821 91
11 3300005434 Ga0070709_10208623 Ga0070709_102086233 91
12 3300005434 Ga0070709_10561979 Ga0070709_105619791 91
13 3300005434 Ga0070709_10681783 Ga0070709_106817832 91
14 3300005434 Ga0070709_11084399 Ga0070709_110843991 91
15 3300005435 Ga0070714_100119558 Ga0070714_1001195582 91
16 3300005435 Ga0070714_100249965 Ga0070714_1002499651 91
17 3300005435 Ga0070714_101225473 Ga0070714_1012254732 91
18 3300005435 Ga0070714_101574810 Ga0070714_1015748102 91
19 3300005436 Ga0070713_100430788 Ga0070713_1004307882 91
20 3300005436 Ga0070713_101582714 Ga0070713_1015827142 91
21 3300005437 Ga0070710_10083855 Ga0070710_100838552 91
22 3300005437 Ga0070710_10461355 Ga0070710_104613552 91
23 3300005437 Ga0070710_10807288 Ga0070710_108072882 91
24 3300005438 Ga0070701_10708889 Ga0070701_107088892 91
25 3300005439 Ga0070711_100025967 Ga0070711_1000259672 91
26 3300005439 Ga0070711_101326061 Ga0070711_1013260611 91
27 3300005441 Ga0070700_100211571 Ga0070700_1002115712 91
28 3300005455 Ga0070663_101348309 Ga0070663_1013483091 91
29 3300005458 Ga0070681_10443566 Ga0070681_104435661 91
30 3300005459 Ga0068867_100206927 Ga0068867_1002069272 91
31 3300005468 Ga0070707_100665600 Ga0070707_1006656002 91
32 3300005518 Ga0070699_101547362 Ga0070699_1015473622 91
33 3300005539 Ga0068853_100995906 Ga0068853_1009959062 91
34 3300005543 Ga0070672_100771974 Ga0070672_1007719742 91
35 3300005544 Ga0070686_101928208 Ga0070686_1019282081 91
36 3300005545 Ga0070695_101251668 Ga0070695_1012516681 91
37 3300005546 Ga0070696_100867493 Ga0070696_1008674932 91
38 3300005564 Ga0070664_100023880 Ga0070664_1000238803 91
39 3300005564 Ga0070664_100217766 Ga0070664_1002177663 91
40 3300005614 Ga0068856_100196695 Ga0068856_1001966953 91
41 3300005614 Ga0068856_101242968 Ga0068856_1012429683 91
42 3300005718 Ga0068866_10282139 Ga0068866_102821392 91
43 3300005834 Ga0068851_10541100 Ga0068851_105411001 91
44 3300005937 Ga0081455_10001214 Ga0081455_1000121426 91
45 3300005983 Ga0081540_1064799 Ga0081540_10647992 91
46 3300005985 Ga0081539_10335590 Ga0081539_103355902 91
47 3300006173 Ga0070716_100049499 Ga0070716_1000494993 91
48 3300006173 Ga0070716_100182206 Ga0070716_1001822062 91
49 3300006175 Ga0070712_100117806 Ga0070712_1001178062 91
50 3300006175 Ga0070712_100138516 Ga0070712_1001385162 91
51 3300006175 Ga0070712_100333174 Ga0070712_1003331742 91
52 3300006175 Ga0070712_101159479 Ga0070712_1011594792 91
53 3300006175 Ga0070712_101673256 Ga0070712_1016732562 91
54 3300006175 Ga0070712_101744722 Ga0070712_1017447222 91
55 3300006844 Ga0075428_100178471 Ga0075428_1001784712 91
56 3300006844 Ga0075428_100828992 Ga0075428_1008289921 91
57 3300006846 Ga0075430_100147019 Ga0075430_1001470192 91
58 3300006846 Ga0075430_100179370 Ga0075430_1001793702 91
59 3300006847 Ga0075431_100070382 Ga0075431_1000703822 91
60 3300007076 Ga0075435_100738595 Ga0075435_1007385952 91
61 3300009093 Ga0105240_10004346 Ga0105240_1000434623 91
62 3300009094 Ga0111539_10936981 Ga0111539_109369812 91
63 3300009094 Ga0111539_12763430 Ga0111539_127634302 91
64 3300009098 Ga0105245_10855386 Ga0105245_108553862 91
65 3300009098 Ga0105245_11150901 Ga0105245_111509011 91
66 3300009098 Ga0105245_12026643 Ga0105245_120266431 91
67 3300009147 Ga0114129_10392494 Ga0114129_103924942 91
68 3300009147 Ga0114129_13313038 Ga0114129_133130382 91
69 3300009148 Ga0105243_10091934 Ga0105243_100919344 91
70 3300009176 Ga0105242_10678815 Ga0105242_106788152 91
71 3300009545 Ga0105237_10013622 Ga0105237_100136223 91
72 3300010375 Ga0105239_10467186 Ga0105239_104671863 91
73 3300010375 Ga0105239_10714886 Ga0105239_107148862 91
74 3300013104 Ga0157370_12084741 Ga0157370_120847411 91
75 3300013105 Ga0157369_12127762 Ga0157369_121277622 91
76 3300013306 Ga0163162_10437733 Ga0163162_104377332 91
77 3300013307 Ga0157372_10395861 Ga0157372_103958612 91
78 3300013308 Ga0157375_12708528 Ga0157375_127085281 91
79 3300014745 Ga0157377_10295718 Ga0157377_102957182 91
80 3300014969 Ga0157376_12499850 Ga0157376_124998502 91
81 3300020075 Ga0206349_1235485 Ga0206349_12354852 91
82 3300020081 Ga0206354_10038934 Ga0206354_100389342 91
83 3300020081 Ga0206354_10721846 Ga0206354_107218462 91
84 3300020082 Ga0206353_10401775 Ga0206353_104017752 91
85 3300020082 Ga0206353_11834438 Ga0206353_118344382 91
86 3300021384 Ga0213876_10491868 Ga0213876_104918682 91
87 3300025893 Ga0207682_10071858 Ga0207682_100718583 91
88 3300025898 Ga0207692_10356247 Ga0207692_103562472 91
89 3300025898 Ga0207692_10997999 Ga0207692_109979992 91
90 3300025901 Ga0207688_10037894 Ga0207688_100378942 91
91 3300025905 Ga0207685_10495891 Ga0207685_104958912 91
92 3300025906 Ga0207699_10047405 Ga0207699_100474052 91
93 3300025906 Ga0207699_10816944 Ga0207699_108169442 91
94 3300025913 Ga0207695_10064774 Ga0207695_100647743 91
95 3300025914 Ga0207671_10008955 Ga0207671_1000895511 91
96 3300025915 Ga0207693_10073804 Ga0207693_100738043 91
97 3300025915 Ga0207693_10100780 Ga0207693_101007802 91
98 3300025915 Ga0207693_10209937 Ga0207693_102099372 91
99 3300025915 Ga0207693_10286037 Ga0207693_102860372 91
100 3300025915 Ga0207693_11135164 Ga0207693_111351642 91
101 3300025916 Ga0207663_10018720 Ga0207663_100187206 91
102 3300025916 Ga0207663_10235739 Ga0207663_102357392 91
103 3300025916 Ga0207663_10375008 Ga0207663_103750082 91
104 3300025917 Ga0207660_10835270 Ga0207660_108352702 91
105 3300025920 Ga0207649_10711820 Ga0207649_107118203 91
106 3300025922 Ga0207646_10538963 Ga0207646_105389632 91
107 3300025926 Ga0207659_11176984 Ga0207659_111769842 91
108 3300025927 Ga0207687_10105671 Ga0207687_101056714 91
109 3300025928 Ga0207700_10764172 Ga0207700_107641722 91
110 3300025929 Ga0207664_10119357 Ga0207664_101193573 91
111 3300025929 Ga0207664_10194480 Ga0207664_101944802 91
112 3300025929 Ga0207664_11029051 Ga0207664_110290511 91
113 3300025929 Ga0207664_11085385 Ga0207664_110853852 91
114 3300025929 Ga0207664_11296371 Ga0207664_112963711 91
115 3300025929 Ga0207664_11814903 Ga0207664_118149031 91
116 3300025929 Ga0207664_11998289 Ga0207664_119982891 91
117 3300025932 Ga0207690_10181324 Ga0207690_101813244 91
118 3300025934 Ga0207686_10657389 Ga0207686_106573892 91
119 3300025938 Ga0207704_11255750 Ga0207704_112557502 91
120 3300025939 Ga0207665_10079567 Ga0207665_100795672 91
121 3300025939 Ga0207665_10216201 Ga0207665_102162012 91
122 3300025940 Ga0207691_10232914 Ga0207691_102329144 91
123 3300025942 Ga0207689_10292673 Ga0207689_102926733 91
124 3300025944 Ga0207661_11917426 Ga0207661_119174261 91
125 3300025945 Ga0207679_10014920 Ga0207679_100149203 91
126 3300025981 Ga0207640_10099239 Ga0207640_100992394 91
127 3300025986 Ga0207658_10251269 Ga0207658_102512693 91
128 3300026041 Ga0207639_10661709 Ga0207639_106617092 91
129 3300026078 Ga0207702_10576188 Ga0207702_105761881 91
130 3300026089 Ga0207648_10074369 Ga0207648_100743696 91
131 3300026118 Ga0207675_102142186 Ga0207675_1021421861 91
132 3300026142 Ga0207698_10539167 Ga0207698_105391672 91
133 3300028556 Ga0265337_1001321 Ga0265337_100132114 91
134 3300028558 Ga0265326_10004689 Ga0265326_100046892 91
135 3300028563 Ga0265319_1000581 Ga0265319_100058127 91
136 3300028573 Ga0265334_10087197 Ga0265334_100871972 91
137 3300028577 Ga0265318_10000976 Ga0265318_1000097623 91
138 3300028653 Ga0265323_10106025 Ga0265323_101060252 91
139 3300028654 Ga0265322_10022699 Ga0265322_100226992 91
140 3300028666 Ga0265336_10000001 Ga0265336_10000001455 91
141 3300028800 Ga0265338_10000004 Ga0265338_10000004427 91
142 3300028800 Ga0265338_10015764 Ga0265338_100157645 91
143 3300031239 Ga0265328_10235318 Ga0265328_102353182 91
144 3300031247 Ga0265340_10000002 Ga0265340_10000002427 91
145 3300031249 Ga0265339_10109109 Ga0265339_101091093 91
146 3300031251 Ga0265327_10004464 Ga0265327_100044647 91
147 3300031251 Ga0265327_10009205 Ga0265327_100092057 91
148 3300031251 Ga0265327_10029925 Ga0265327_100299253 91
149 3300031344 Ga0265316_10247205 Ga0265316_102472052 91
150 3300031712 Ga0265342_10089166 Ga0265342_100891662 91
151 3300031712 Ga0265342_10410796 Ga0265342_104107962 91
152 3300031731 Ga0307405_11594589 Ga0307405_115945891 91
153 3300031824 Ga0307413_10496292 Ga0307413_104962922 91
154 3300031824 Ga0307413_11073109 Ga0307413_110731092 91
155 3300031824 Ga0307413_11836744 Ga0307413_118367442 91
156 3300031852 Ga0307410_10274609 Ga0307410_102746092 91
157 3300031901 Ga0307406_11104480 Ga0307406_111044802 91
158 3300031995 Ga0307409_100815622 Ga0307409_1008156222 91
159 3300031995 Ga0307409_101541771 Ga0307409_1015417712 91
160 3300032002 Ga0307416_100708762 Ga0307416_1007087623 91
161 3300032002 Ga0307416_103171093 Ga0307416_1031710932 91
162 3300032004 Ga0307414_10976244 Ga0307414_109762443 91
163 3300032004 Ga0307414_11182524 Ga0307414_111825242 91
164 3300032126 Ga0307415_101167063 Ga0307415_1011670632 91
165 3300032126 Ga0307415_101560163 Ga0307415_1015601632 91
166 3300035725 Ga0373947_0839160 Ga0373947_0839160_76_357 91
167 3300036401 Ga0373937_0180388 Ga0373937_0180388_925_1206 91
168 3300036401 Ga0373937_1898137 Ga0373937_1898137_29_304 91
169 3300037853 Ga0436364_1068218 Ga0436364_1068218_515_790 91
170 3300037853 Ga0436364_1144136 Ga0436364_1144136_266_541 91
171 3300038443 Ga0395901_0799912 Ga0395901_0799912_538_813 91
172 3300038443 Ga0395901_1184068 Ga0395901_1184068_228_503 91
173 3300039437 Ga0436365_0110090 Ga0436365_0110090_273_548 91
174 3300039437 Ga0436365_0768982 Ga0436365_0768982_53_328 91
175 3300039450 Ga0436363_0282143 Ga0436363_0282143_224_499 91
176 3300039450 Ga0436363_1559163 Ga0436363_1559163_95_370 91
177 3300041486 Ga0451807_0809165 Ga0451807_0809165_374_661 91
178 3300041501 Ga0451845_0910241 Ga0451845_0910241_145_420 91
179 3300041512 Ga0451853_1819362 Ga0451853_1819362_139_414 91
180 3300042005 Ga0439448_0081619 Ga0439448_0081619_206_481 91
181 3300042005 Ga0439448_0166081 Ga0439448_0166081_195_470 91
182 3300042008 Ga0439450_050287 Ga0439450_050287_169_444 91
183 3300042016 Ga0439463_061086 Ga0439463_061086_250_525 91
184 3300042142 Ga0450905_063123 Ga0450905_063123_111_386 91
185 3300042157 Ga0439458_0157079 Ga0439458_0157079_18_293 91
186 3300042437 Ga0439444_0197518 Ga0439444_0197518_90_365 91
187 3300042439 Ga0439464_0104654 Ga0439464_0104654_92_367 91
188 3300044658 Ga0466972_0498504 Ga0466972_0498504_235_510 91
189 3300044683 Ga0466965_0204327 Ga0466965_0204327_691_966 91
190 3300044684 Ga0466966_0927336 Ga0466966_0927336_127_402 91
191 3300044694 Ga0466963_0071241 Ga0466963_0071241_1559_1834 91
192 3300044694 Ga0466963_0100528 Ga0466963_0100528_26_301 91
193 3300044694 Ga0466963_0226954 Ga0466963_0226954_68_343 91
194 3300044694 Ga0466963_0962297 Ga0466963_0962297_85_360 91
195 3300044842 Ga0466957_0028723 Ga0466957_0028723_1372_1647 91
196 3300045049 Ga0466959_0638274 Ga0466959_0638274_376_651 91
197 3300045836 Ga0466958_0162868 Ga0466958_0162868_107_382 91
198 3300045836 Ga0466958_0933019 Ga0466958_0933019_34_309 91
199 3300045836 Ga0466958_1021216 Ga0466958_1021216_37_318 91
200 3300045836 Ga0466958_1059216 Ga0466958_1059216_174_455 91
201 3300045976 Ga0466967_0066531 Ga0466967_0066531_2555_2830 91
202 3300045976 Ga0466967_0144199 Ga0466967_0144199_248_523 91
203 3300045976 Ga0466967_0480383 Ga0466967_0480383_408_683 91
204 3300045976 Ga0466967_0729810 Ga0466967_0729810_97_372 91
205 3300045976 Ga0466967_1175278 Ga0466967_1175278_15_296 91
206 3300045976 Ga0466967_2526859 Ga0466967_2526859_222_497 91
207 3300046454 Ga0495592_0598041 Ga0495592_0598041_36_311 91
208 3300046457 Ga0495590_0035969 Ga0495590_0035969_1353_1628 91
209 3300046459 Ga0495629_0853845 Ga0495629_0853845_272_553 91
210 3300046463 Ga0495653_0000374 Ga0495653_0000374_27741_28022 91
211 3300046463 Ga0495653_0146237 Ga0495653_0146237_220_501 91
212 3300046477 Ga0495664_0000007 Ga0495664_0000007_29115_29396 91
213 3300046491 Ga0495584_0552190 Ga0495584_0552190_226_501 91
214 3300046500 Ga0495596_0094448 Ga0495596_0094448_346_621 91
215 3300046511 Ga0495608_0239179 Ga0495608_0239179_656_937 91
216 3300046511 Ga0495608_0874200 Ga0495608_0874200_212_493 91
217 3300046513 Ga0495616_0100313 Ga0495616_0100313_217_492 91
218 3300046513 Ga0495616_0282642 Ga0495616_0282642_398_673 91
219 3300046514 Ga0495618_0000151 Ga0495618_0000151_27964_28245 91
220 3300046517 Ga0495630_0000414 Ga0495630_0000414_1344_1625 91
221 3300046519 Ga0495632_0372875 Ga0495632_0372875_221_496 91
222 3300046520 Ga0495637_0194062 Ga0495637_0194062_16_291 91
223 3300046529 Ga0495652_0078948 Ga0495652_0078948_969_1250 91
224 3300046531 Ga0495665_0205027 Ga0495665_0205027_696_971 91
225 3300046537 Ga0495598_0449186 Ga0495598_0449186_48_323 91
226 3300046542 Ga0495597_0151381 Ga0495597_0151381_145_420 91
227 3300046543 Ga0495645_0001966 Ga0495645_0001966_5082_5363 91
228 3300046675 Ga0495657_0000008 Ga0495657_0000008_116345_116626 91
229 3300046678 Ga0495599_0311479 Ga0495599_0311479_522_803 91
230 3300046680 Ga0495646_0243042 Ga0495646_0243042_166_441 91
231 3300046680 Ga0495646_0690388 Ga0495646_0690388_208_489 91
232 3300046691 Ga0495670_0109524 Ga0495670_0109524_1061_1336 91
233 3300046809 Ga0495600_0029267 Ga0495600_0029267_3051_3368 91
234 3300047317 Ga0495604_0000047 Ga0495604_0000047_47791_48066 91
235 3300047321 Ga0495676_0466174 Ga0495676_0466174_10_291 91
236 3300047471 Ga0495684_0002636 Ga0495684_0002636_8718_8993 91
237 3300047471 Ga0495684_0100218 Ga0495684_0100218_1372_1653 91
238 3300048903 Ga0496100_0004800 Ga0496100_0004800_687_968 91
239 3300048903 Ga0496100_0342390 Ga0496100_0342390_298_579 91
240 3300048904 Ga0496101_0797350 Ga0496101_0797350_300_575 91
241 3300048904 Ga0496101_1191822 Ga0496101_1191822_288_569 91
242 3300048905 Ga0496102_0000002 Ga0496102_0000002_757316_757591 91
243 3300048905 Ga0496102_0144140 Ga0496102_0144140_1943_2224 91
244 3300048906 Ga0496103_0000046 Ga0496103_0000046_55653_55928 91
245 3300048906 Ga0496103_0175389 Ga0496103_0175389_148_429 91
246 3300048907 Ga0496104_0000001 Ga0496104_0000001_239975_240250 91
247 3300048913 Ga0496110_0000502 Ga0496110_0000502_19503_19778 91
248 3300048914 Ga0496111_0001359 Ga0496111_0001359_4746_5021 91
249 3300048916 Ga0496113_0166621 Ga0496113_0166621_635_910 91
250 3300048917 Ga0496114_0994518 Ga0496114_0994518_108_389 91
251 3300048918 Ga0496115_0000034 Ga0496115_0000034_63332_63613 91
252 3300048918 Ga0496115_0000329 Ga0496115_0000329_35446_35727 91
253 3300048926 Ga0496123_0511071 Ga0496123_0511071_66_347 91
254 3300050507 nmdc:mga05p37_598232_c1 nmdc:mga05p37_598232_c1_572_847 91
255 3300050507 nmdc:mga05p37_944068_c1 nmdc:mga05p37_944068_c1_167_442 91
256 3300050509 nmdc:mga0qj67_500132_c1 nmdc:mga0qj67_500132_c1_114_389 91
257 3300050509 nmdc:mga0qj67_814842_c1 nmdc:mga0qj67_814842_c1_54_329 91
258 3300050510 nmdc:mga06r32_125336_c1 nmdc:mga06r32_125336_c1_1821_2096 91
259 3300050510 nmdc:mga06r32_1825033_c1 nmdc:mga06r32_1825033_c1_70_345 91
260 3300050511 nmdc:mga08y16_1729635_c1 nmdc:mga08y16_1729635_c1_118_393 91
261 3300050511 nmdc:mga08y16_495303_c1 nmdc:mga08y16_495303_c1_259_534 91
262 3300050512 nmdc:mga0n895_197057_c1 nmdc:mga0n895_197057_c1_888_1169 91
263 3300053077 Ga0495601_0000276 Ga0495601_0000276_11674_11955 91
264 3300053077 Ga0495601_0046778 Ga0495601_0046778_82_357 91
265 3300053078 Ga0495612_0000023 Ga0495612_0000023_100026_100307 91
266 3300053085 Ga0495619_0186033 Ga0495619_0186033_460_735 91
267 3300053085 Ga0495619_0368548 Ga0495619_0368548_483_764 91
268 3300053085 Ga0495619_0618230 Ga0495619_0618230_406_687 91
269 3300059513 Ga0587094_009356 Ga0587094_009356_853_1134 91
270 3300060353 Ga0501082_1740641 Ga0501082_1740641_187_462 91
271 3300061719 Ga0466962_0636400 Ga0466962_0636400_104_379 91
272 3300005985 Ga0081539_10025144 Ga0081539_100251445 92
273 3300005985 Ga0081539_10189204 Ga0081539_101892042 92
274 3300006844 Ga0075428_102386474 Ga0075428_1023864742 92
275 3300025321 Ga0207656_10338691 Ga0207656_103386912 92
276 3300030732 Ga0316176_1184707 Ga0316176_11847071 92
277 3300030733 Ga0314311_1020881 Ga0314311_10208811 92
278 3300031731 Ga0307405_10408402 Ga0307405_104084021 92
279 3300031852 Ga0307410_10658150 Ga0307410_106581502 92
280 3300031903 Ga0307407_10108324 Ga0307407_101083242 92
281 3300031911 Ga0307412_11004707 Ga0307412_110047072 92
282 3300031995 Ga0307409_101901240 Ga0307409_1019012402 92
283 3300032002 Ga0307416_100036777 Ga0307416_1000367771 92
284 3300032002 Ga0307416_100526488 Ga0307416_1005264882 92
285 3300032002 Ga0307416_101982188 Ga0307416_1019821882 92
286 3300032005 Ga0307411_10314454 Ga0307411_103144542 92
287 3300032126 Ga0307415_100461832 Ga0307415_1004618321 92
288 3300049521 Ga0501298_119085 Ga0501298_119085_303_581 92
289 3300049656 Ga0501209_198252 Ga0501209_198252_148_426 92
290 3300049668 Ga0501233_009079 Ga0501233_009079_1531_1809 92
291 3300059421 Ga0590071_028072 Ga0590071_028072_281_559 92
292 3300059423 Ga0590074_017938 Ga0590074_017938_890_1168 92
293 3300059424 Ga0590075_010557 Ga0590075_010557_329_607 92
294 3300059426 Ga0590077_031868 Ga0590077_031868_662_940 92
295 3300003203 JGI25406J46586_10082391 JGI25406J46586_100823912 93
296 3300003203 JGI25406J46586_10139465 JGI25406J46586_101394652 93
297 3300003373 JGI25407J50210_10142791 JGI25407J50210_101427911 93
298 3300005329 Ga0070683_102278089 Ga0070683_1022780892 93
299 3300005435 Ga0070714_100067170 Ga0070714_1000671703 93
300 3300005445 Ga0070708_100008029 Ga0070708_1000080299 93
301 3300005457 Ga0070662_100648643 Ga0070662_1006486432 93
302 3300005459 Ga0068867_101903166 Ga0068867_1019031661 93
303 3300005466 Ga0070685_10813630 Ga0070685_108136302 93
304 3300005467 Ga0070706_100007300 Ga0070706_1000073007 93
305 3300005468 Ga0070707_100001888 Ga0070707_1000018886 93
306 3300005471 Ga0070698_100001377 Ga0070698_1000013771 93
307 3300005615 Ga0070702_100365455 Ga0070702_1003654552 93
308 3300005616 Ga0068852_101194412 Ga0068852_1011944122 93
309 3300005981 Ga0081538_10045625 Ga0081538_100456253 93
310 3300005981 Ga0081538_10072232 Ga0081538_100722322 93
311 3300005985 Ga0081539_10003484 Ga0081539_100034843 93
312 3300005985 Ga0081539_10044799 Ga0081539_100447993 93
313 3300006028 Ga0070717_10016827 Ga0070717_100168272 93
314 3300009148 Ga0105243_11109511 Ga0105243_111095112 93
315 3300009551 Ga0105238_11325327 Ga0105238_113253272 93
316 3300011119 Ga0105246_11940128 Ga0105246_119401281 93
317 3300014745 Ga0157377_10490290 Ga0157377_104902902 93
318 3300025901 Ga0207688_10685148 Ga0207688_106851481 93
319 3300025922 Ga0207646_10029958 Ga0207646_100299585 93
320 3300025924 Ga0207694_11445440 Ga0207694_114454401 93
321 3300025926 Ga0207659_11255872 Ga0207659_112558722 93
322 3300025929 Ga0207664_10102728 Ga0207664_101027282 93
323 3300026023 Ga0207677_11795988 Ga0207677_117959882 93
324 3300026041 Ga0207639_10581969 Ga0207639_105819691 93
325 3300026089 Ga0207648_10268174 Ga0207648_102681742 93
326 3300026142 Ga0207698_10186564 Ga0207698_101865642 93
327 3300031548 Ga0307408_100443993 Ga0307408_1004439932 93
328 3300031548 Ga0307408_101006638 Ga0307408_1010066381 93
329 3300031548 Ga0307408_101660576 Ga0307408_1016605761 93
330 3300031731 Ga0307405_10200127 Ga0307405_102001272 93
331 3300031731 Ga0307405_10818019 Ga0307405_108180192 93
332 3300031824 Ga0307413_10106296 Ga0307413_101062962 93
333 3300031824 Ga0307413_11904317 Ga0307413_119043172 93
334 3300031852 Ga0307410_10131802 Ga0307410_101318022 93
335 3300031852 Ga0307410_11245253 Ga0307410_112452532 93
336 3300031901 Ga0307406_11028046 Ga0307406_110280461 93
337 3300031903 Ga0307407_10294543 Ga0307407_102945432 93
338 3300031903 Ga0307407_10648367 Ga0307407_106483672 93
339 3300031911 Ga0307412_10781100 Ga0307412_107811002 93
340 3300031995 Ga0307409_100099685 Ga0307409_1000996853 93
341 3300031995 Ga0307409_101123659 Ga0307409_1011236592 93
342 3300031995 Ga0307409_101702270 Ga0307409_1017022702 93
343 3300032002 Ga0307416_100076241 Ga0307416_1000762413 93
344 3300032002 Ga0307416_100197802 Ga0307416_1001978022 93
345 3300032002 Ga0307416_100215879 Ga0307416_1002158792 93
346 3300032002 Ga0307416_100295299 Ga0307416_1002952992 93
347 3300032004 Ga0307414_10250055 Ga0307414_102500552 93
348 3300032004 Ga0307414_10854379 Ga0307414_108543792 93
349 3300032005 Ga0307411_10274309 Ga0307411_102743092 93
350 3300032126 Ga0307415_100050081 Ga0307415_1000500812 93
351 3300032126 Ga0307415_101031280 Ga0307415_1010312801 93
352 3300032126 Ga0307415_101126927 Ga0307415_1011269272 93
353 3300046542 Ga0495597_0201420 Ga0495597_0201420_179_466 93
354 3300048912 Ga0496109_0197554 Ga0496109_0197554_1436_1726 93
355 3300049513 Ga0501290_099911 Ga0501290_099911_71_352 93
356 3300049514 Ga0501291_065053 Ga0501291_065053_220_501 93
357 3300049514 Ga0501291_078164 Ga0501291_078164_357_638 93
358 3300049518 Ga0501295_175248 Ga0501295_175248_86_367 93
359 3300049522 Ga0501299_043574 Ga0501299_043574_339_620 93
360 3300049522 Ga0501299_065390 Ga0501299_065390_72_353 93
361 3300049522 Ga0501299_078916 Ga0501299_078916_407_688 93
362 3300049525 Ga0501302_022694 Ga0501302_022694_83_364 93
363 3300049651 Ga0501201_056492 Ga0501201_056492_52_333 93
364 3300049652 Ga0501202_017315 Ga0501202_017315_982_1263 93
365 3300049655 Ga0501208_061088 Ga0501208_061088_36_317 93
366 3300049660 Ga0501216_093529 Ga0501216_093529_263_544 93
367 3300049665 Ga0501227_213129 Ga0501227_213129_231_512 93
368 3300049667 Ga0501230_125589 Ga0501230_125589_83_364 93
369 3300049668 Ga0501233_166006 Ga0501233_166006_199_480 93
370 3300049675 Ga0501243_030010 Ga0501243_030010_311_592 93
371 3300049678 Ga0501248_027335 Ga0501248_027335_155_436 93
372 3300049679 Ga0501249_224799 Ga0501249_224799_129_410 93
373 3300049704 Ga0501221_077332 Ga0501221_077332_286_567 93
374 3300049705 Ga0501225_0090945 Ga0501225_0090945_516_797 93
375 3300049779 Ga0501283_060666 Ga0501283_060666_167_448 93
376 3300049851 Ga0501212_010654 Ga0501212_010654_826_1107 93
377 3300059421 Ga0590071_022249 Ga0590071_022249_216_497 93

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01037

AsnC_trans_reg

Lrp/AsnC ligand binding domain

20

91

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e1a-assembly1.cif.gz_B crystal structure of ffrp-dm1 0.9268 1 75
2e1a-assembly1.cif.gz_B crystal structure of ffrp-dm1 0.9155 1 75
2djw-assembly1.cif.gz_F crystal structure of ttha0845 from thermus thermophilus hb8 0.9011 1 80
2zbc-assembly1.cif.gz_C-2 crystal structure of sts042, a stand-alone ram module protein, from hyperthermophilic archaeon sulfolobus tokodaii strain7. 0.8989 3 79
2djw-assembly1.cif.gz_F crystal structure of ttha0845 from thermus thermophilus hb8 0.8905 1 80
ID Description Score Start End Superfamily
2djwE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9524 1 75 3.30.70.920
2djwE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9403 1 75 3.30.70.920
2z4pD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9333 1 72 3.30.70.920
2zbcB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9179 3 73 3.30.70.920
2cg4B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9059 2 75 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A1Q7PR05-F1-model_v4 Transcription regulator AsnC/Lrp ligand binding domain-containing protein 0.9705 2 71
AF-A0A7C3G3J6-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.9703 1 71
AF-A0A2E8V9Y8-F1-model_v4 AsnC family transcriptional regulator 0.9676 1 71
AF-A0A370LSD5-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.9669 2 72
AF-A0A2D6LDK9-F1-model_v4 deleted 0.9664 2 71

Feature Viewer

pLDDT pTM Quality
91.59 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map