F427747

General Info

Members Datasets Scaffolds Average Seq Length
377 239 754 137

Family's Representative Sequence

Representative Sequence 3300035119|Ga0373956_0002232|Ga0373956_0002232_1250_1741
Length 163
Sequence VTTGTGLPGGRASLSPKRGPTTGRGEHVSERTLVLVKPDGVARGLVGEVIGRIERKGLRLVALQLMTVPRDLAEQHYAEHAAKPFFGSLLEFICSAPVVAAVVEGERAIAAFRQLAGGTDPVASAAPGSIRGDYALETQFNLVHGSDSADSAAREIKLWFPEL

Samples

Sample ID Description Type Environment
1 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
96 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
97 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
98 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
99 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
123 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
126 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
132 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
133 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
134 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
138 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
196 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
197 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
198 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
203 2643221548 Streptomyces sp. Root55 Isolate Unclassified
204 2643221578 Streptomyces sp. Root63 Isolate Unclassified
205 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
206 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
207 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
208 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
209 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
210 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
211 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
212 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
213 2867475112 Streptomyces sp. TM32 Isolate Unclassified
214 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
215 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
216 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
217 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
218 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
219 2891562705 Microbispora tritici MT50 Isolate Unclassified
220 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
221 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
222 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
223 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
224 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
225 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
226 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
227 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
228 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
229 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
230 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
231 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
232 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
233 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
234 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
235 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
236 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
237 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
238 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
239 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.53
Metatranscriptomes 2.39
Isolates 10.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 3.45
Rhizosphere 84.62
Stem 0
Stem Tuber 0.27
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373956_0002232 3300035119 Bacteria 7978
2 Ga0058862_10013131 3300004803 Bacteria 4618
3 Ga0070658_10082906 3300005327 Bacteria 2635
4 Ga0070658_10184031 3300005327 Bacteria 1759
5 Ga0070658_10871715 3300005327 Bacteria 782
6 Ga0070683_100383719 3300005329 Bacteria 1339
7 Ga0070683_100826601 3300005329 Bacteria 888
8 Ga0070683_101386406 3300005329 Bacteria 676
9 Ga0070666_10306650 3300005335 Bacteria 1131
10 Ga0070680_100016859 3300005336 Bacteria 5749
11 Ga0070680_100057391 3300005336 Bacteria 3183
12 Ga0070680_100490672 3300005336 Bacteria 1050
13 Ga0070680_100507622 3300005336 Bacteria 1032
14 Ga0070682_100278319 3300005337 Bacteria 1219
15 Ga0068868_100036072 3300005338 Bacteria 3825
16 Ga0070660_100044731 3300005339 Bacteria 3387
17 Ga0070660_100503439 3300005339 Bacteria 1008
18 Ga0070660_101773559 3300005339 Bacteria 526
19 Ga0070661_101198536 3300005344 Bacteria 635
20 Ga0070668_100633231 3300005347 Bacteria 938
21 Ga0070674_100091300 3300005356 Bacteria 2199
22 Ga0070674_100389835 3300005356 Bacteria 1135
23 Ga0070673_101528229 3300005364 Bacteria 630
24 Ga0070659_100005377 3300005366 Bacteria 9191
25 Ga0070659_100008180 3300005366 Bacteria 7631
26 Ga0070659_100435029 3300005366 Bacteria 1111
27 Ga0070714_100740600 3300005435 Bacteria 950
28 Ga0070714_101025919 3300005435 Bacteria 803
29 Ga0070710_10019869 3300005437 Bacteria 3478
30 Ga0070700_100123937 3300005441 Bacteria 1735
31 Ga0070694_101047089 3300005444 Bacteria 679
32 Ga0070708_100410992 3300005445 Bacteria 1276
33 Ga0070663_100000334 3300005455 Bacteria 24513
34 Ga0070681_10000028 3300005458 Bacteria 104446
35 Ga0070681_10002546 3300005458 Bacteria 16730
36 Ga0070681_10007661 3300005458 Bacteria 10560
37 Ga0070681_10103660 3300005458 Bacteria 2788
38 Ga0070706_100008343 3300005467 Bacteria 9649
39 Ga0070679_100000092 3300005530 Bacteria 68394
40 Ga0070679_100098013 3300005530 Bacteria 2919
41 Ga0070679_100184007 3300005530 Bacteria 2061
42 Ga0070679_100226306 3300005530 Bacteria 1830
43 Ga0070679_100229239 3300005530 Bacteria 1817
44 Ga0070679_100519576 3300005530 Bacteria 1134
45 Ga0070684_100751043 3300005535 Bacteria 911
46 Ga0070684_100995706 3300005535 Bacteria 787
47 Ga0070684_101340265 3300005535 Bacteria 674
48 Ga0068853_102049660 3300005539 Bacteria 555
49 Ga0070686_100174376 3300005544 Bacteria 1523
50 Ga0070665_100289561 3300005548 Bacteria 1640
51 Ga0070665_100593532 3300005548 Bacteria 1120
52 Ga0070704_100203905 3300005549 Bacteria 1598
53 Ga0068855_100422594 3300005563 Bacteria 1458
54 Ga0068855_101262737 3300005563 Bacteria 766
55 Ga0068857_100248880 3300005577 Bacteria 1629
56 Ga0068856_100452575 3300005614 Bacteria 1305
57 Ga0068852_100159997 3300005616 Bacteria 2102
58 Ga0068861_100795181 3300005719 Bacteria 887
59 Ga0068863_101139845 3300005841 Bacteria 785
60 Ga0081455_10000024 3300005937 Bacteria 157764
61 Ga0081455_10057856 3300005937 Bacteria 3284
62 Ga0070716_100495929 3300006173 Bacteria 900
63 Ga0075370_10118193 3300006353 Bacteria 1542
64 Ga0075428_100700488 3300006844 Bacteria 1079
65 Ga0075436_100000003 3300006914 Bacteria 450287
66 Ga0075436_100000241 3300006914 Bacteria 34172
67 Ga0105240_11153801 3300009093 Bacteria 822
68 Ga0111539_10089052 3300009094 Bacteria 3626
69 Ga0111539_12885586 3300009094 Bacteria 556
70 Ga0105245_10439171 3300009098 Bacteria 1311
71 Ga0105245_11586155 3300009098 Bacteria 706
72 Ga0114129_10278468 3300009147 Bacteria 2236
73 Ga0114129_10377302 3300009147 Bacteria 1873
74 Ga0114129_10961239 3300009147 Bacteria 1078
75 Ga0114129_11491177 3300009147 Bacteria 831
76 Ga0105242_10324863 3300009176 Bacteria 1412
77 Ga0105242_10953366 3300009176 Bacteria 862
78 Ga0105238_10615767 3300009551 Bacteria 1094
79 Ga0105238_11351113 3300009551 Bacteria 739
80 Ga0105249_10280694 3300009553 Bacteria 1663
81 Ga0105239_12749193 3300010375 Bacteria 574
82 Ga0157373_10210140 3300013100 Bacteria 1372
83 Ga0157373_10681915 3300013100 Bacteria 752
84 Ga0157371_10355461 3300013102 Bacteria 1067
85 Ga0157370_10159392 3300013104 Bacteria 2100
86 Ga0157369_10007541 3300013105 Bacteria 12520
87 Ga0157369_10012714 3300013105 Bacteria 9547
88 Ga0157369_10118515 3300013105 Bacteria 2810
89 Ga0157369_10827685 3300013105 Bacteria 951
90 Ga0157369_10897202 3300013105 Bacteria 909
91 Ga0157369_11407972 3300013105 Bacteria 710
92 Ga0157374_10459044 3300013296 Bacteria 1276
93 Ga0157374_12557866 3300013296 Bacteria 538
94 Ga0157378_11022466 3300013297 Bacteria 861
95 Ga0157378_11349842 3300013297 Bacteria 755
96 Ga0157372_10488194 3300013307 Bacteria 1436
97 Ga0157372_12934386 3300013307 Bacteria 546
98 Ga0157375_10656016 3300013308 Bacteria 1205
99 Ga0157375_11076635 3300013308 Unclassified 940
100 Ga0163163_10943175 3300014325 Bacteria 926
101 Ga0157377_10515096 3300014745 Bacteria 839
102 Ga0157379_12071405 3300014968 Bacteria 563
103 Ga0182005_1173454 3300015265 Bacteria 637
104 Ga0206356_10633645 3300020070 Bacteria 1581
105 Ga0206354_11327704 3300020081 Bacteria 1048
106 Ga0206353_10535170 3300020082 Bacteria 10131
107 Ga0213873_10034826 3300021358 Bacteria 1271
108 Ga0213876_10000698 3300021384 Bacteria 23633
109 Ga0213875_10000692 3300021388 Bacteria 26091
110 Ga0224712_10005017 3300022467 Bacteria 3639
111 Ga0224712_10173908 3300022467 Bacteria 967
112 Ga0207426_1020717 3300025302 Bacteria 2282
113 Ga0207692_10001122 3300025898 Bacteria 9853
114 Ga0207680_10263896 3300025903 Bacteria 1193
115 Ga0207647_10219009 3300025904 Bacteria 1097
116 Ga0207647_10221136 3300025904 Bacteria 1091
117 Ga0207705_10005529 3300025909 Bacteria 9447
118 Ga0207705_10143767 3300025909 Bacteria 1783
119 Ga0207705_10608499 3300025909 Bacteria 850
120 Ga0207707_10000584 3300025912 Bacteria 37030
121 Ga0207707_10004431 3300025912 Bacteria 12375
122 Ga0207707_10008490 3300025912 Bacteria 8906
123 Ga0207707_10011374 3300025912 Bacteria 7748
124 Ga0207707_10298193 3300025912 Bacteria 1394
125 Ga0207660_10001153 3300025917 Bacteria 17641
126 Ga0207660_10037760 3300025917 Bacteria 3368
127 Ga0207660_10445378 3300025917 Bacteria 1047
128 Ga0207660_10457600 3300025917 Bacteria 1032
129 Ga0207660_10478025 3300025917 Bacteria 1009
130 Ga0207657_10041752 3300025919 Bacteria 4053
131 Ga0207657_10079750 3300025919 Bacteria 2753
132 Ga0207657_10170053 3300025919 Bacteria 1766
133 Ga0207657_10699728 3300025919 Bacteria 787
134 Ga0207657_10893130 3300025919 Unclassified 685
135 Ga0207652_10000092 3300025921 Bacteria 98391
136 Ga0207652_10027506 3300025921 Bacteria 4738
137 Ga0207652_10235927 3300025921 Bacteria 1649
138 Ga0207652_10268191 3300025921 Bacteria 1540
139 Ga0207652_10422503 3300025921 Bacteria 1202
140 Ga0207694_10332220 3300025924 Bacteria 1256
141 Ga0207687_10392885 3300025927 Bacteria 1139
142 Ga0207664_10910989 3300025929 Bacteria 789
143 Ga0207690_10001321 3300025932 Bacteria 15605
144 Ga0207690_10008506 3300025932 Bacteria 6088
145 Ga0207686_11257926 3300025934 Bacteria 607
146 Ga0207669_10186308 3300025937 Bacteria 1493
147 Ga0207669_10189961 3300025937 Bacteria 1481
148 Ga0207661_10165601 3300025944 Bacteria 1921
149 Ga0207667_10729179 3300025949 Bacteria 992
150 Ga0207667_10792665 3300025949 Bacteria 945
151 Ga0207668_10009186 3300025972 Bacteria 5913
152 Ga0207677_10009292 3300026023 Bacteria 5526
153 Ga0207677_10320277 3300026023 Bacteria 1288
154 Ga0207678_10000042 3300026067 Bacteria 94951
155 Ga0207708_10084260 3300026075 Bacteria 2444
156 Ga0207708_10388498 3300026075 Bacteria 1152
157 Ga0207641_10129300 3300026088 Bacteria 2266
158 Ga0207674_10139334 3300026116 Bacteria 2386
159 Ga0207698_10170639 3300026142 Bacteria 1915
160 Ga0268266_10278198 3300028379 Bacteria 1555
161 Ga0268266_10677775 3300028379 Bacteria 993
162 Ga0268265_11209743 3300028380 Bacteria 753
163 Ga0265334_10082617 3300028573 Bacteria 1181
164 Ga0307515_10049087 3300028794 Bacteria 6363
165 Ga0307511_10090508 3300030521 Bacteria 2078
166 Ga0307512_10192089 3300030522 Bacteria 1124
167 Ga0314311_1132469 3300030733 Bacteria 3704
168 Ga0316180_1002470 3300030736 Bacteria 1230
169 Ga0265762_1011554 3300030760 Bacteria 1578
170 Ga0265770_1028003 3300030878 Bacteria 929
171 Ga0265332_10101544 3300031238 Bacteria 1213
172 Ga0265320_10058608 3300031240 Bacteria 1843
173 Ga0265325_10075110 3300031241 Bacteria 1688
174 Ga0265325_10100499 3300031241 Unclassified 1416
175 Ga0265340_10014804 3300031247 Bacteria 4065
176 Ga0265339_10117213 3300031249 Bacteria 1372
177 Ga0265316_10023253 3300031344 Bacteria 5210
178 Ga0307509_10163854 3300031507 Bacteria 2116
179 Ga0265313_10075205 3300031595 Bacteria 1546
180 Ga0307508_10773911 3300031616 Bacteria 575
181 Ga0265342_10050515 3300031712 Bacteria 2484
182 Ga0307405_10154105 3300031731 Bacteria 1620
183 Ga0307413_10278534 3300031824 Bacteria 1257
184 Ga0307518_10000212 3300031838 Bacteria 44023
185 Ga0307410_10127471 3300031852 Bacteria 1865
186 Ga0307410_10255896 3300031852 Bacteria 1363
187 Ga0307406_10398297 3300031901 Bacteria 1090
188 Ga0307407_10090764 3300031903 Bacteria 1872
189 Ga0307409_100137481 3300031995 Bacteria 2099
190 Ga0307409_100169279 3300031995 Bacteria 1921
191 Ga0307416_100234795 3300032002 Bacteria 1771
192 Ga0307414_10041200 3300032004 Bacteria 3126
193 Ga0307411_10039467 3300032005 Bacteria 2987
194 Ga0307411_10296844 3300032005 Bacteria 1294
195 Ga0307415_100061463 3300032126 Bacteria 2601
196 Ga0307415_100979277 3300032126 Unclassified 785
197 Ga0316583_10167572 3300032133 Bacteria 764
198 Ga0307507_10006399 3300033179 Bacteria 18120
199 Ga0307507_10058085 3300033179 Bacteria 3635
200 Ga0307507_10230673 3300033179 Bacteria 1228
201 Ga0373945_0216135 3300035116 Bacteria 800
202 Ga0373960_0050291 3300035121 Bacteria 1235
203 Ga0373942_0118692 3300035207 Bacteria 825
204 Ga0316584_0345378 3300036712 Unclassified 1069
205 Ga0316584_0477181 3300036712 Unclassified 879
206 Ga0373925_0473038 3300037068 Bacteria 1027
207 Ga0436364_0979235 3300037853 Bacteria 801
208 Ga0395901_0539811 3300038443 Bacteria 1183
209 Ga0400484_20038 3300038725 Bacteria 3801
210 Ga0400488_01023 3300038741 Bacteria 5517
211 Ga0400483_077109 3300039062 Bacteria 17445
212 Ga0400483_270925 3300039062 Bacteria 3796
213 Ga0400489_38384 3300039093 Bacteria 14811
214 Ga0436365_0879580 3300039437 Bacteria 36654
215 Ga0436363_0545708 3300039450 Bacteria 2564
216 Ga0436363_1379863 3300039450 Bacteria 654
217 Ga0436362_0773038 3300039453 Bacteria 1843
218 Ga0436362_1050387 3300039453 Bacteria 3065
219 Ga0451795_1079187 3300041456 Bacteria 629
220 Ga0466969_0394241 3300044656 Bacteria 628
221 Ga0466972_0024305 3300044658 Bacteria 3006
222 Ga0466972_0264937 3300044658 Bacteria 803
223 Ga0466965_0017584 3300044683 Bacteria 3419
224 Ga0466965_0070598 3300044683 Bacteria 1756
225 Ga0466965_0117725 3300044683 Bacteria 1370
226 Ga0466965_0188087 3300044683 Bacteria 1091
227 Ga0466965_0411390 3300044683 Bacteria 748
228 Ga0466966_0001986 3300044684 Bacteria 13252
229 Ga0466966_0046988 3300044684 Bacteria 2754
230 Ga0466966_0254936 3300044684 Bacteria 1057
231 Ga0466961_0003175 3300044693 Bacteria 10232
232 Ga0466961_0043105 3300044693 Bacteria 2891
233 Ga0466961_0060377 3300044693 Bacteria 2411
234 Ga0466961_0099634 3300044693 Bacteria 1831
235 Ga0466961_0269213 3300044693 Bacteria 1044
236 Ga0466961_0619037 3300044693 Bacteria 650
237 Ga0466963_0002631 3300044694 Bacteria 10087
238 Ga0466963_0224464 3300044694 Bacteria 1316
239 Ga0466963_0457729 3300044694 Bacteria 900
240 Ga0466963_0689079 3300044694 Bacteria 721
241 Ga0466964_0068611 3300044706 Bacteria 1493
242 Ga0453684_1414661 3300044712 Bacteria 721
243 Ga0466971_0010980 3300044719 Bacteria 3962
244 Ga0466971_0172763 3300044719 Bacteria 1014
245 Ga0466971_0370113 3300044719 Bacteria 696
246 Ga0466971_0422459 3300044719 Bacteria 652
247 Ga0466968_0385413 3300044735 Bacteria 685
248 Ga0466968_0668714 3300044735 Bacteria 528
249 Ga0466970_0153024 3300044765 Bacteria 1274
250 Ga0466970_0363674 3300044765 Bacteria 822
251 Ga0466970_0487834 3300044765 Bacteria 709
252 Ga0466970_0764565 3300044765 Bacteria 565
253 Ga0466957_0079185 3300044842 Bacteria 2044
254 Ga0466957_0095170 3300044842 Bacteria 1870
255 Ga0466957_0178497 3300044842 Bacteria 1386
256 Ga0466957_0354321 3300044842 Bacteria 996
257 Ga0466960_0005864 3300044901 Bacteria 4896
258 Ga0466960_0055322 3300044901 Bacteria 1929
259 Ga0466960_0772134 3300044901 Bacteria 580
260 Ga0466959_0005290 3300045049 Bacteria 8822
261 Ga0466959_0256624 3300045049 Bacteria 1204
262 Ga0466959_0349502 3300045049 Bacteria 1008
263 Ga0466959_0829173 3300045049 Bacteria 618
264 Ga0451576_0508825 3300045051 Bacteria 1265
265 Ga0466958_0000094 3300045836 Bacteria 27609
266 Ga0466958_0001151 3300045836 Bacteria 12266
267 Ga0466967_0032019 3300045976 Bacteria 4436
268 Ga0466967_0285345 3300045976 Bacteria 1585
269 Ga0466967_0296576 3300045976 Bacteria 1554
270 Ga0466967_0302543 3300045976 Bacteria 1539
271 Ga0466967_0543276 3300045976 Bacteria 1143
272 Ga0466967_0591803 3300045976 Bacteria 1094
273 Ga0466967_0625683 3300045976 Bacteria 1063
274 Ga0466967_0788574 3300045976 Bacteria 943
275 Ga0466967_1302576 3300045976 Bacteria 724
276 Ga0466967_1352474 3300045976 Bacteria 709
277 Ga0466967_1895847 3300045976 Bacteria 593
278 Ga0495592_0233608 3300046454 Bacteria 1223
279 Ga0495641_0079476 3300046461 Bacteria 1469
280 Ga0495651_0703797 3300046462 Bacteria 629
281 Ga0495639_0419594 3300046475 Bacteria 677
282 Ga0495662_0342977 3300046476 Bacteria 734
283 Ga0495608_0368014 3300046511 Bacteria 883
284 Ga0495630_0180230 3300046517 Bacteria 1611
285 Ga0495652_0208447 3300046529 Bacteria 1478
286 Ga0495586_0046876 3300046535 Bacteria 2331
287 Ga0495587_0377159 3300046536 Bacteria 789
288 Ga0495613_0071561 3300046689 Bacteria 2527
289 Ga0495581_0035527 3300047315 Bacteria 2884
290 Ga0496102_0069949 3300048905 Bacteria 3222
291 Ga0496104_0106950 3300048907 Bacteria 2681
292 Ga0496104_0570785 3300048907 Bacteria 1042
293 Ga0496105_0342103 3300048908 Bacteria 1196
294 Ga0496108_0422083 3300048911 Bacteria 1165
295 Ga0496109_0362012 3300048912 Bacteria 1370
296 Ga0496110_0338473 3300048913 Bacteria 1371
297 Ga0496111_0108691 3300048914 Bacteria 2042
298 Ga0496112_0013351 3300048915 Bacteria 7582
299 Ga0496114_0437633 3300048917 Bacteria 1158
300 Ga0496115_0046510 3300048918 Bacteria 3469
301 Ga0501032_0944159 3300049569 Bacteria 542
302 Ga0501033_0488519 3300049570 Bacteria 853
303 Ga0501034_0271952 3300049571 Bacteria 1635
304 Ga0501043_0831678 3300049579 Bacteria 666
305 Ga0501047_0393434 3300049581 Bacteria 1219
306 Ga0501069_0057832 3300049585 Bacteria 2162
307 Ga0501069_0738379 3300049585 Bacteria 595
308 Ga0501070_0000203 3300049586 Bacteria 55882
309 Ga0501070_0002280 3300049586 Bacteria 16871
310 Ga0501070_0040645 3300049586 Bacteria 3877
311 Ga0501070_0140561 3300049586 Bacteria 1993
312 Ga0501070_0158251 3300049586 Bacteria 1868
313 Ga0501070_0548043 3300049586 Bacteria 926
314 Ga0501071_0409384 3300049587 Bacteria 1036
315 Ga0501073_0090248 3300049589 Bacteria 2130
316 Ga0501074_0014034 3300049590 Bacteria 5823
317 Ga0501074_0219062 3300049590 Bacteria 1355
318 Ga0501074_0768723 3300049590 Bacteria 679
319 Ga0501077_0670766 3300049593 Bacteria 666
320 Ga0501079_0000589 3300049741 Bacteria 24044
321 Ga0501080_0000164 3300049742 Bacteria 47786
322 Ga0501080_0088208 3300049742 Bacteria 2882
323 Ga0501080_0389121 3300049742 Bacteria 1255
324 Ga0501044_0071014 3300049823 Bacteria 3541
325 Ga0501044_0158690 3300049823 Bacteria 2240
326 nmdc:mga05p37_306976_c1 3300050507 Bacteria 1882
327 nmdc:mga05p37_335865_c1 3300050507 Bacteria 1783
328 nmdc:mga05p37_869110_c1 3300050507 Bacteria 977
329 nmdc:mga06r32_1649153_c1 3300050510 Bacteria 579
330 nmdc:mga08x19_103_c1 3300050514 Bacteria 75178
331 nmdc:mga08x19_1_c1 3300050514 Bacteria 2010344
332 Ga0500644_0044714 3300053088 Bacteria 1488
333 Ga0500572_045154 3300053111 Bacteria 1294
334 Ga0500559_0012820 3300053136 Bacteria 3557
335 Ga0500590_250649 3300053148 Bacteria 704
336 Ga0501084_0261605 3300054114 Bacteria 1461
337 Ga0587079_189485 3300059647 Bacteria 555
338 Ga0466962_0019980 3300061719 Bacteria 3219
339 Ga0466962_0075269 3300061719 Bacteria 1613
340 2586063212 2585427649 Bacteria 9053857
341 2643759763 2643221548 Bacteria 8053412
342 2643897888 2643221578 Bacteria 9213798
343 2644409033 2643221673 Bacteria 9196637
344 2644462818 2643221682 Bacteria 6743283
345 2753070527 2751185734 Bacteria 8863695
346 2793976143 2791355406 Bacteria 11364898
347 2795784633 2795385470 Bacteria 8317180
348 2809587639 2808606522 Bacteria 9488490
349 2819693667 2818991463 Bacteria 7948711
350 2856743203 2856741275 Bacteria 8096094
351 2867479673 2867475112 Bacteria 6909112
352 2870729641 2870721527 Bacteria 9689237
353 2873317999 2873314349 Bacteria 8512634
354 2875393799 2875391855 Bacteria 7600475
355 2891396141 2891395885 Bacteria 9251614
356 2891558573 2891554331 Bacteria 8812224
357 2891568682 2891562705 Bacteria 8039471
358 2899362918 2899359706 Bacteria 10940472
359 2899371508 2899370129 Bacteria 6781179
360 2915771223 2915768154 Bacteria 8424322
361 2917737228 2917736166 Bacteria 9690793
362 2920114304 2920107658 Bacteria 10042636
363 2935392280 2935390628 Bacteria 7043367
364 2946050854 2946045630 Bacteria 8527308
365 2966603279 2966598605 Bacteria 7676064
366 2997456554 2997451912 Bacteria 8492419
367 3006488642 3006486233 Bacteria 8157040
368 8003318394 8003314358 Bacteria 10575343
369 8025480690 8025478263 Bacteria 8209203
370 8047711485 8047710418 Bacteria 11023148
371 8047898944 8047893842 Bacteria 11723082
372 8048359975 8048356638 Bacteria 11044339
373 8048375902 8048369669 Bacteria 11666822
374 8048382305 8048379754 Bacteria 11877923
375 8055067251 8055066027 Bacteria 9479577
376 8056452413 8056447290 Bacteria 7680491
377 8056673168 8056667051 Bacteria 6953971
378 Ga0373956_0002232
379 Ga0058862_10013131
380 Ga0070658_10082906
381 Ga0070658_10184031
382 Ga0070658_10871715
383 Ga0070683_100383719
384 Ga0070683_100826601
385 Ga0070683_101386406
386 Ga0070666_10306650
387 Ga0070680_100016859
388 Ga0070680_100057391
389 Ga0070680_100490672
390 Ga0070680_100507622
391 Ga0070682_100278319
392 Ga0068868_100036072
393 Ga0070660_100044731
394 Ga0070660_100503439
395 Ga0070660_101773559
396 Ga0070661_101198536
397 Ga0070668_100633231
398 Ga0070674_100091300
399 Ga0070674_100389835
400 Ga0070673_101528229
401 Ga0070659_100005377
402 Ga0070659_100008180
403 Ga0070659_100435029
404 Ga0070714_100740600
405 Ga0070714_101025919
406 Ga0070710_10019869
407 Ga0070700_100123937
408 Ga0070694_101047089
409 Ga0070708_100410992
410 Ga0070663_100000334
411 Ga0070681_10000028
412 Ga0070681_10002546
413 Ga0070681_10007661
414 Ga0070681_10103660
415 Ga0070706_100008343
416 Ga0070679_100000092
417 Ga0070679_100098013
418 Ga0070679_100184007
419 Ga0070679_100226306
420 Ga0070679_100229239
421 Ga0070679_100519576
422 Ga0070684_100751043
423 Ga0070684_100995706
424 Ga0070684_101340265
425 Ga0068853_102049660
426 Ga0070686_100174376
427 Ga0070665_100289561
428 Ga0070665_100593532
429 Ga0070704_100203905
430 Ga0068855_100422594
431 Ga0068855_101262737
432 Ga0068857_100248880
433 Ga0068856_100452575
434 Ga0068852_100159997
435 Ga0068861_100795181
436 Ga0068863_101139845
437 Ga0081455_10000024
438 Ga0081455_10057856
439 Ga0070716_100495929
440 Ga0075370_10118193
441 Ga0075428_100700488
442 Ga0075436_100000003
443 Ga0075436_100000241
444 Ga0105240_11153801
445 Ga0111539_10089052
446 Ga0111539_12885586
447 Ga0105245_10439171
448 Ga0105245_11586155
449 Ga0114129_10278468
450 Ga0114129_10377302
451 Ga0114129_10961239
452 Ga0114129_11491177
453 Ga0105242_10324863
454 Ga0105242_10953366
455 Ga0105238_10615767
456 Ga0105238_11351113
457 Ga0105249_10280694
458 Ga0105239_12749193
459 Ga0157373_10210140
460 Ga0157373_10681915
461 Ga0157371_10355461
462 Ga0157370_10159392
463 Ga0157369_10007541
464 Ga0157369_10012714
465 Ga0157369_10118515
466 Ga0157369_10827685
467 Ga0157369_10897202
468 Ga0157369_11407972
469 Ga0157374_10459044
470 Ga0157374_12557866
471 Ga0157378_11022466
472 Ga0157378_11349842
473 Ga0157372_10488194
474 Ga0157372_12934386
475 Ga0157375_10656016
476 Ga0157375_11076635
477 Ga0163163_10943175
478 Ga0157377_10515096
479 Ga0157379_12071405
480 Ga0182005_1173454
481 Ga0206356_10633645
482 Ga0206354_11327704
483 Ga0206353_10535170
484 Ga0213873_10034826
485 Ga0213876_10000698
486 Ga0213875_10000692
487 Ga0224712_10005017
488 Ga0224712_10173908
489 Ga0207426_1020717
490 Ga0207692_10001122
491 Ga0207680_10263896
492 Ga0207647_10219009
493 Ga0207647_10221136
494 Ga0207705_10005529
495 Ga0207705_10143767
496 Ga0207705_10608499
497 Ga0207707_10000584
498 Ga0207707_10004431
499 Ga0207707_10008490
500 Ga0207707_10011374
501 Ga0207707_10298193
502 Ga0207660_10001153
503 Ga0207660_10037760
504 Ga0207660_10445378
505 Ga0207660_10457600
506 Ga0207660_10478025
507 Ga0207657_10041752
508 Ga0207657_10079750
509 Ga0207657_10170053
510 Ga0207657_10699728
511 Ga0207657_10893130
512 Ga0207652_10000092
513 Ga0207652_10027506
514 Ga0207652_10235927
515 Ga0207652_10268191
516 Ga0207652_10422503
517 Ga0207694_10332220
518 Ga0207687_10392885
519 Ga0207664_10910989
520 Ga0207690_10001321
521 Ga0207690_10008506
522 Ga0207686_11257926
523 Ga0207669_10186308
524 Ga0207669_10189961
525 Ga0207661_10165601
526 Ga0207667_10729179
527 Ga0207667_10792665
528 Ga0207668_10009186
529 Ga0207677_10009292
530 Ga0207677_10320277
531 Ga0207678_10000042
532 Ga0207708_10084260
533 Ga0207708_10388498
534 Ga0207641_10129300
535 Ga0207674_10139334
536 Ga0207698_10170639
537 Ga0268266_10278198
538 Ga0268266_10677775
539 Ga0268265_11209743
540 Ga0265334_10082617
541 Ga0307515_10049087
542 Ga0307511_10090508
543 Ga0307512_10192089
544 Ga0314311_1132469
545 Ga0316180_1002470
546 Ga0265762_1011554
547 Ga0265770_1028003
548 Ga0265332_10101544
549 Ga0265320_10058608
550 Ga0265325_10075110
551 Ga0265325_10100499
552 Ga0265340_10014804
553 Ga0265339_10117213
554 Ga0265316_10023253
555 Ga0307509_10163854
556 Ga0265313_10075205
557 Ga0307508_10773911
558 Ga0265342_10050515
559 Ga0307405_10154105
560 Ga0307413_10278534
561 Ga0307518_10000212
562 Ga0307410_10127471
563 Ga0307410_10255896
564 Ga0307406_10398297
565 Ga0307407_10090764
566 Ga0307409_100137481
567 Ga0307409_100169279
568 Ga0307416_100234795
569 Ga0307414_10041200
570 Ga0307411_10039467
571 Ga0307411_10296844
572 Ga0307415_100061463
573 Ga0307415_100979277
574 Ga0316583_10167572
575 Ga0307507_10006399
576 Ga0307507_10058085
577 Ga0307507_10230673
578 Ga0373945_0216135
579 Ga0373960_0050291
580 Ga0373942_0118692
581 Ga0316584_0345378
582 Ga0316584_0477181
583 Ga0373925_0473038
584 Ga0436364_0979235
585 Ga0395901_0539811
586 Ga0400484_20038
587 Ga0400488_01023
588 Ga0400483_077109
589 Ga0400483_270925
590 Ga0400489_38384
591 Ga0436365_0879580
592 Ga0436363_0545708
593 Ga0436363_1379863
594 Ga0436362_0773038
595 Ga0436362_1050387
596 Ga0451795_1079187
597 Ga0466969_0394241
598 Ga0466972_0024305
599 Ga0466972_0264937
600 Ga0466965_0017584
601 Ga0466965_0070598
602 Ga0466965_0117725
603 Ga0466965_0188087
604 Ga0466965_0411390
605 Ga0466966_0001986
606 Ga0466966_0046988
607 Ga0466966_0254936
608 Ga0466961_0003175
609 Ga0466961_0043105
610 Ga0466961_0060377
611 Ga0466961_0099634
612 Ga0466961_0269213
613 Ga0466961_0619037
614 Ga0466963_0002631
615 Ga0466963_0224464
616 Ga0466963_0457729
617 Ga0466963_0689079
618 Ga0466964_0068611
619 Ga0453684_1414661
620 Ga0466971_0010980
621 Ga0466971_0172763
622 Ga0466971_0370113
623 Ga0466971_0422459
624 Ga0466968_0385413
625 Ga0466968_0668714
626 Ga0466970_0153024
627 Ga0466970_0363674
628 Ga0466970_0487834
629 Ga0466970_0764565
630 Ga0466957_0079185
631 Ga0466957_0095170
632 Ga0466957_0178497
633 Ga0466957_0354321
634 Ga0466960_0005864
635 Ga0466960_0055322
636 Ga0466960_0772134
637 Ga0466959_0005290
638 Ga0466959_0256624
639 Ga0466959_0349502
640 Ga0466959_0829173
641 Ga0451576_0508825
642 Ga0466958_0000094
643 Ga0466958_0001151
644 Ga0466967_0032019
645 Ga0466967_0285345
646 Ga0466967_0296576
647 Ga0466967_0302543
648 Ga0466967_0543276
649 Ga0466967_0591803
650 Ga0466967_0625683
651 Ga0466967_0788574
652 Ga0466967_1302576
653 Ga0466967_1352474
654 Ga0466967_1895847
655 Ga0495592_0233608
656 Ga0495641_0079476
657 Ga0495651_0703797
658 Ga0495639_0419594
659 Ga0495662_0342977
660 Ga0495608_0368014
661 Ga0495630_0180230
662 Ga0495652_0208447
663 Ga0495586_0046876
664 Ga0495587_0377159
665 Ga0495613_0071561
666 Ga0495581_0035527
667 Ga0496102_0069949
668 Ga0496104_0106950
669 Ga0496104_0570785
670 Ga0496105_0342103
671 Ga0496108_0422083
672 Ga0496109_0362012
673 Ga0496110_0338473
674 Ga0496111_0108691
675 Ga0496112_0013351
676 Ga0496114_0437633
677 Ga0496115_0046510
678 Ga0501032_0944159
679 Ga0501033_0488519
680 Ga0501034_0271952
681 Ga0501043_0831678
682 Ga0501047_0393434
683 Ga0501069_0057832
684 Ga0501069_0738379
685 Ga0501070_0000203
686 Ga0501070_0002280
687 Ga0501070_0040645
688 Ga0501070_0140561
689 Ga0501070_0158251
690 Ga0501070_0548043
691 Ga0501071_0409384
692 Ga0501073_0090248
693 Ga0501074_0014034
694 Ga0501074_0219062
695 Ga0501074_0768723
696 Ga0501077_0670766
697 Ga0501079_0000589
698 Ga0501080_0000164
699 Ga0501080_0088208
700 Ga0501080_0389121
701 Ga0501044_0071014
702 Ga0501044_0158690
703 nmdc:mga05p37_306976_c1
704 nmdc:mga05p37_335865_c1
705 nmdc:mga05p37_869110_c1
706 nmdc:mga06r32_1649153_c1
707 nmdc:mga08x19_103_c1
708 nmdc:mga08x19_1_c1
709 Ga0500644_0044714
710 Ga0500572_045154
711 Ga0500559_0012820
712 Ga0500590_250649
713 Ga0501084_0261605
714 Ga0587079_189485
715 Ga0466962_0019980
716 Ga0466962_0075269
717 2586063212
718 2643759763
719 2643897888
720 2644409033
721 2644462818
722 2753070527
723 2793976143
724 2795784633
725 2809587639
726 2819693667
727 2856743203
728 2867479673
729 2870729641
730 2873317999
731 2875393799
732 2891396141
733 2891558573
734 2891568682
735 2899362918
736 2899371508
737 2915771223
738 2917737228
739 2920114304
740 2935392280
741 2946050854
742 2966603279
743 2997456554
744 3006488642
745 8003318394
746 8025480690
747 8047711485
748 8047898944
749 8048359975
750 8048375902
751 8048382305
752 8055067251
753 8056452413
754 8056673168

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

30

163

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vvu-assembly1.cif.gz_A crystal structure of reconstructed bacterial ancestral ndk, bac1 0.9905 1 139
5v6d-assembly3.cif.gz_F crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate 0.9893 2 139
3r9l-assembly1.cif.gz_A crystal structure of nucleoside diphosphate kinase from giardia lamblia featuring a disordered dinucleotide binding site 0.9893 2 136
4anc-assembly1.cif.gz_A crystal form i of the d93n mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis 0.9888 1 131
4ane-assembly1.cif.gz_E r80n mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis 0.988 1 131
ID Description Score Start End Superfamily
af_A0A0G2L2L7_25_106_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9879 2 77 3.30.70.141
1k44A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9876 1 133 3.30.70.141
af_A0A1D6EH51_54_191_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9872 19 147 3.30.70.141
af_C6T4F9_81_235_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9868 1 148 3.30.70.141
3vgvN00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9797 2 139 3.30.70.141
ID Description Score Start End GO Terms
AF-A0A7V9KEH2-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.998 1 131 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A7V9LV15-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9974 2 131 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A7X7YN19-F1-model_v4 Nucleoside diphosphate kinase (EC 2.7.4.6) 0.9964 1 131 GO:0004550
GO:0005524
GO:0006183
GO:0006228
GO:0006241
AF-K9CZ98-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9964 1 131 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A401I5H2-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9959 1 131 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872

Map