F427747
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 377 | 239 | 754 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300035119|Ga0373956_0002232|Ga0373956_0002232_1250_1741 |
| Length | 163 |
| Sequence | VTTGTGLPGGRASLSPKRGPTTGRGEHVSERTLVLVKPDGVARGLVGEVIGRIERKGLRLVALQLMTVPRDLAEQHYAEHAAKPFFGSLLEFICSAPVVAAVVEGERAIAAFRQLAGGTDPVASAAPGSIRGDYALETQFNLVHGSDSADSAAREIKLWFPEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 38 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 39 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 64 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 65 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 66 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 95 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 96 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 97 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 98 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 99 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 100 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 101 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 103 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 104 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 105 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 106 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 107 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 108 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 109 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 110 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 111 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 113 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 114 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 119 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 120 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 121 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 122 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 123 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 124 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 125 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 126 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 132 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 133 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 134 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 135 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 136 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 137 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 138 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 139 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 140 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 141 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 142 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 143 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 144 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 145 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 146 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 147 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 148 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 149 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 150 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 151 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 152 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 153 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 154 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 155 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 156 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 169 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 170 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 171 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 174 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 175 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 176 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 177 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 178 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 196 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 197 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 198 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 199 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 202 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 203 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 204 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 205 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 206 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 207 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 208 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 209 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 210 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 211 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 212 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 213 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 214 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 215 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 216 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 217 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 218 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 219 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 220 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 221 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 222 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 223 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 224 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 225 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 226 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 227 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 228 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 229 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 230 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 231 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 232 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 233 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 234 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 235 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 236 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 237 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 238 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 239 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.53 |
| Metatranscriptomes | 2.39 |
| Isolates | 10.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.59 |
| Nodule | 0 |
| Rhizoplane | 3.45 |
| Rhizosphere | 84.62 |
| Stem | 0 |
| Stem Tuber | 0.27 |
| Unclassified | 1.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373956_0002232 | 3300035119 | Bacteria | 7978 |
| 2 | Ga0058862_10013131 | 3300004803 | Bacteria | 4618 |
| 3 | Ga0070658_10082906 | 3300005327 | Bacteria | 2635 |
| 4 | Ga0070658_10184031 | 3300005327 | Bacteria | 1759 |
| 5 | Ga0070658_10871715 | 3300005327 | Bacteria | 782 |
| 6 | Ga0070683_100383719 | 3300005329 | Bacteria | 1339 |
| 7 | Ga0070683_100826601 | 3300005329 | Bacteria | 888 |
| 8 | Ga0070683_101386406 | 3300005329 | Bacteria | 676 |
| 9 | Ga0070666_10306650 | 3300005335 | Bacteria | 1131 |
| 10 | Ga0070680_100016859 | 3300005336 | Bacteria | 5749 |
| 11 | Ga0070680_100057391 | 3300005336 | Bacteria | 3183 |
| 12 | Ga0070680_100490672 | 3300005336 | Bacteria | 1050 |
| 13 | Ga0070680_100507622 | 3300005336 | Bacteria | 1032 |
| 14 | Ga0070682_100278319 | 3300005337 | Bacteria | 1219 |
| 15 | Ga0068868_100036072 | 3300005338 | Bacteria | 3825 |
| 16 | Ga0070660_100044731 | 3300005339 | Bacteria | 3387 |
| 17 | Ga0070660_100503439 | 3300005339 | Bacteria | 1008 |
| 18 | Ga0070660_101773559 | 3300005339 | Bacteria | 526 |
| 19 | Ga0070661_101198536 | 3300005344 | Bacteria | 635 |
| 20 | Ga0070668_100633231 | 3300005347 | Bacteria | 938 |
| 21 | Ga0070674_100091300 | 3300005356 | Bacteria | 2199 |
| 22 | Ga0070674_100389835 | 3300005356 | Bacteria | 1135 |
| 23 | Ga0070673_101528229 | 3300005364 | Bacteria | 630 |
| 24 | Ga0070659_100005377 | 3300005366 | Bacteria | 9191 |
| 25 | Ga0070659_100008180 | 3300005366 | Bacteria | 7631 |
| 26 | Ga0070659_100435029 | 3300005366 | Bacteria | 1111 |
| 27 | Ga0070714_100740600 | 3300005435 | Bacteria | 950 |
| 28 | Ga0070714_101025919 | 3300005435 | Bacteria | 803 |
| 29 | Ga0070710_10019869 | 3300005437 | Bacteria | 3478 |
| 30 | Ga0070700_100123937 | 3300005441 | Bacteria | 1735 |
| 31 | Ga0070694_101047089 | 3300005444 | Bacteria | 679 |
| 32 | Ga0070708_100410992 | 3300005445 | Bacteria | 1276 |
| 33 | Ga0070663_100000334 | 3300005455 | Bacteria | 24513 |
| 34 | Ga0070681_10000028 | 3300005458 | Bacteria | 104446 |
| 35 | Ga0070681_10002546 | 3300005458 | Bacteria | 16730 |
| 36 | Ga0070681_10007661 | 3300005458 | Bacteria | 10560 |
| 37 | Ga0070681_10103660 | 3300005458 | Bacteria | 2788 |
| 38 | Ga0070706_100008343 | 3300005467 | Bacteria | 9649 |
| 39 | Ga0070679_100000092 | 3300005530 | Bacteria | 68394 |
| 40 | Ga0070679_100098013 | 3300005530 | Bacteria | 2919 |
| 41 | Ga0070679_100184007 | 3300005530 | Bacteria | 2061 |
| 42 | Ga0070679_100226306 | 3300005530 | Bacteria | 1830 |
| 43 | Ga0070679_100229239 | 3300005530 | Bacteria | 1817 |
| 44 | Ga0070679_100519576 | 3300005530 | Bacteria | 1134 |
| 45 | Ga0070684_100751043 | 3300005535 | Bacteria | 911 |
| 46 | Ga0070684_100995706 | 3300005535 | Bacteria | 787 |
| 47 | Ga0070684_101340265 | 3300005535 | Bacteria | 674 |
| 48 | Ga0068853_102049660 | 3300005539 | Bacteria | 555 |
| 49 | Ga0070686_100174376 | 3300005544 | Bacteria | 1523 |
| 50 | Ga0070665_100289561 | 3300005548 | Bacteria | 1640 |
| 51 | Ga0070665_100593532 | 3300005548 | Bacteria | 1120 |
| 52 | Ga0070704_100203905 | 3300005549 | Bacteria | 1598 |
| 53 | Ga0068855_100422594 | 3300005563 | Bacteria | 1458 |
| 54 | Ga0068855_101262737 | 3300005563 | Bacteria | 766 |
| 55 | Ga0068857_100248880 | 3300005577 | Bacteria | 1629 |
| 56 | Ga0068856_100452575 | 3300005614 | Bacteria | 1305 |
| 57 | Ga0068852_100159997 | 3300005616 | Bacteria | 2102 |
| 58 | Ga0068861_100795181 | 3300005719 | Bacteria | 887 |
| 59 | Ga0068863_101139845 | 3300005841 | Bacteria | 785 |
| 60 | Ga0081455_10000024 | 3300005937 | Bacteria | 157764 |
| 61 | Ga0081455_10057856 | 3300005937 | Bacteria | 3284 |
| 62 | Ga0070716_100495929 | 3300006173 | Bacteria | 900 |
| 63 | Ga0075370_10118193 | 3300006353 | Bacteria | 1542 |
| 64 | Ga0075428_100700488 | 3300006844 | Bacteria | 1079 |
| 65 | Ga0075436_100000003 | 3300006914 | Bacteria | 450287 |
| 66 | Ga0075436_100000241 | 3300006914 | Bacteria | 34172 |
| 67 | Ga0105240_11153801 | 3300009093 | Bacteria | 822 |
| 68 | Ga0111539_10089052 | 3300009094 | Bacteria | 3626 |
| 69 | Ga0111539_12885586 | 3300009094 | Bacteria | 556 |
| 70 | Ga0105245_10439171 | 3300009098 | Bacteria | 1311 |
| 71 | Ga0105245_11586155 | 3300009098 | Bacteria | 706 |
| 72 | Ga0114129_10278468 | 3300009147 | Bacteria | 2236 |
| 73 | Ga0114129_10377302 | 3300009147 | Bacteria | 1873 |
| 74 | Ga0114129_10961239 | 3300009147 | Bacteria | 1078 |
| 75 | Ga0114129_11491177 | 3300009147 | Bacteria | 831 |
| 76 | Ga0105242_10324863 | 3300009176 | Bacteria | 1412 |
| 77 | Ga0105242_10953366 | 3300009176 | Bacteria | 862 |
| 78 | Ga0105238_10615767 | 3300009551 | Bacteria | 1094 |
| 79 | Ga0105238_11351113 | 3300009551 | Bacteria | 739 |
| 80 | Ga0105249_10280694 | 3300009553 | Bacteria | 1663 |
| 81 | Ga0105239_12749193 | 3300010375 | Bacteria | 574 |
| 82 | Ga0157373_10210140 | 3300013100 | Bacteria | 1372 |
| 83 | Ga0157373_10681915 | 3300013100 | Bacteria | 752 |
| 84 | Ga0157371_10355461 | 3300013102 | Bacteria | 1067 |
| 85 | Ga0157370_10159392 | 3300013104 | Bacteria | 2100 |
| 86 | Ga0157369_10007541 | 3300013105 | Bacteria | 12520 |
| 87 | Ga0157369_10012714 | 3300013105 | Bacteria | 9547 |
| 88 | Ga0157369_10118515 | 3300013105 | Bacteria | 2810 |
| 89 | Ga0157369_10827685 | 3300013105 | Bacteria | 951 |
| 90 | Ga0157369_10897202 | 3300013105 | Bacteria | 909 |
| 91 | Ga0157369_11407972 | 3300013105 | Bacteria | 710 |
| 92 | Ga0157374_10459044 | 3300013296 | Bacteria | 1276 |
| 93 | Ga0157374_12557866 | 3300013296 | Bacteria | 538 |
| 94 | Ga0157378_11022466 | 3300013297 | Bacteria | 861 |
| 95 | Ga0157378_11349842 | 3300013297 | Bacteria | 755 |
| 96 | Ga0157372_10488194 | 3300013307 | Bacteria | 1436 |
| 97 | Ga0157372_12934386 | 3300013307 | Bacteria | 546 |
| 98 | Ga0157375_10656016 | 3300013308 | Bacteria | 1205 |
| 99 | Ga0157375_11076635 | 3300013308 | Unclassified | 940 |
| 100 | Ga0163163_10943175 | 3300014325 | Bacteria | 926 |
| 101 | Ga0157377_10515096 | 3300014745 | Bacteria | 839 |
| 102 | Ga0157379_12071405 | 3300014968 | Bacteria | 563 |
| 103 | Ga0182005_1173454 | 3300015265 | Bacteria | 637 |
| 104 | Ga0206356_10633645 | 3300020070 | Bacteria | 1581 |
| 105 | Ga0206354_11327704 | 3300020081 | Bacteria | 1048 |
| 106 | Ga0206353_10535170 | 3300020082 | Bacteria | 10131 |
| 107 | Ga0213873_10034826 | 3300021358 | Bacteria | 1271 |
| 108 | Ga0213876_10000698 | 3300021384 | Bacteria | 23633 |
| 109 | Ga0213875_10000692 | 3300021388 | Bacteria | 26091 |
| 110 | Ga0224712_10005017 | 3300022467 | Bacteria | 3639 |
| 111 | Ga0224712_10173908 | 3300022467 | Bacteria | 967 |
| 112 | Ga0207426_1020717 | 3300025302 | Bacteria | 2282 |
| 113 | Ga0207692_10001122 | 3300025898 | Bacteria | 9853 |
| 114 | Ga0207680_10263896 | 3300025903 | Bacteria | 1193 |
| 115 | Ga0207647_10219009 | 3300025904 | Bacteria | 1097 |
| 116 | Ga0207647_10221136 | 3300025904 | Bacteria | 1091 |
| 117 | Ga0207705_10005529 | 3300025909 | Bacteria | 9447 |
| 118 | Ga0207705_10143767 | 3300025909 | Bacteria | 1783 |
| 119 | Ga0207705_10608499 | 3300025909 | Bacteria | 850 |
| 120 | Ga0207707_10000584 | 3300025912 | Bacteria | 37030 |
| 121 | Ga0207707_10004431 | 3300025912 | Bacteria | 12375 |
| 122 | Ga0207707_10008490 | 3300025912 | Bacteria | 8906 |
| 123 | Ga0207707_10011374 | 3300025912 | Bacteria | 7748 |
| 124 | Ga0207707_10298193 | 3300025912 | Bacteria | 1394 |
| 125 | Ga0207660_10001153 | 3300025917 | Bacteria | 17641 |
| 126 | Ga0207660_10037760 | 3300025917 | Bacteria | 3368 |
| 127 | Ga0207660_10445378 | 3300025917 | Bacteria | 1047 |
| 128 | Ga0207660_10457600 | 3300025917 | Bacteria | 1032 |
| 129 | Ga0207660_10478025 | 3300025917 | Bacteria | 1009 |
| 130 | Ga0207657_10041752 | 3300025919 | Bacteria | 4053 |
| 131 | Ga0207657_10079750 | 3300025919 | Bacteria | 2753 |
| 132 | Ga0207657_10170053 | 3300025919 | Bacteria | 1766 |
| 133 | Ga0207657_10699728 | 3300025919 | Bacteria | 787 |
| 134 | Ga0207657_10893130 | 3300025919 | Unclassified | 685 |
| 135 | Ga0207652_10000092 | 3300025921 | Bacteria | 98391 |
| 136 | Ga0207652_10027506 | 3300025921 | Bacteria | 4738 |
| 137 | Ga0207652_10235927 | 3300025921 | Bacteria | 1649 |
| 138 | Ga0207652_10268191 | 3300025921 | Bacteria | 1540 |
| 139 | Ga0207652_10422503 | 3300025921 | Bacteria | 1202 |
| 140 | Ga0207694_10332220 | 3300025924 | Bacteria | 1256 |
| 141 | Ga0207687_10392885 | 3300025927 | Bacteria | 1139 |
| 142 | Ga0207664_10910989 | 3300025929 | Bacteria | 789 |
| 143 | Ga0207690_10001321 | 3300025932 | Bacteria | 15605 |
| 144 | Ga0207690_10008506 | 3300025932 | Bacteria | 6088 |
| 145 | Ga0207686_11257926 | 3300025934 | Bacteria | 607 |
| 146 | Ga0207669_10186308 | 3300025937 | Bacteria | 1493 |
| 147 | Ga0207669_10189961 | 3300025937 | Bacteria | 1481 |
| 148 | Ga0207661_10165601 | 3300025944 | Bacteria | 1921 |
| 149 | Ga0207667_10729179 | 3300025949 | Bacteria | 992 |
| 150 | Ga0207667_10792665 | 3300025949 | Bacteria | 945 |
| 151 | Ga0207668_10009186 | 3300025972 | Bacteria | 5913 |
| 152 | Ga0207677_10009292 | 3300026023 | Bacteria | 5526 |
| 153 | Ga0207677_10320277 | 3300026023 | Bacteria | 1288 |
| 154 | Ga0207678_10000042 | 3300026067 | Bacteria | 94951 |
| 155 | Ga0207708_10084260 | 3300026075 | Bacteria | 2444 |
| 156 | Ga0207708_10388498 | 3300026075 | Bacteria | 1152 |
| 157 | Ga0207641_10129300 | 3300026088 | Bacteria | 2266 |
| 158 | Ga0207674_10139334 | 3300026116 | Bacteria | 2386 |
| 159 | Ga0207698_10170639 | 3300026142 | Bacteria | 1915 |
| 160 | Ga0268266_10278198 | 3300028379 | Bacteria | 1555 |
| 161 | Ga0268266_10677775 | 3300028379 | Bacteria | 993 |
| 162 | Ga0268265_11209743 | 3300028380 | Bacteria | 753 |
| 163 | Ga0265334_10082617 | 3300028573 | Bacteria | 1181 |
| 164 | Ga0307515_10049087 | 3300028794 | Bacteria | 6363 |
| 165 | Ga0307511_10090508 | 3300030521 | Bacteria | 2078 |
| 166 | Ga0307512_10192089 | 3300030522 | Bacteria | 1124 |
| 167 | Ga0314311_1132469 | 3300030733 | Bacteria | 3704 |
| 168 | Ga0316180_1002470 | 3300030736 | Bacteria | 1230 |
| 169 | Ga0265762_1011554 | 3300030760 | Bacteria | 1578 |
| 170 | Ga0265770_1028003 | 3300030878 | Bacteria | 929 |
| 171 | Ga0265332_10101544 | 3300031238 | Bacteria | 1213 |
| 172 | Ga0265320_10058608 | 3300031240 | Bacteria | 1843 |
| 173 | Ga0265325_10075110 | 3300031241 | Bacteria | 1688 |
| 174 | Ga0265325_10100499 | 3300031241 | Unclassified | 1416 |
| 175 | Ga0265340_10014804 | 3300031247 | Bacteria | 4065 |
| 176 | Ga0265339_10117213 | 3300031249 | Bacteria | 1372 |
| 177 | Ga0265316_10023253 | 3300031344 | Bacteria | 5210 |
| 178 | Ga0307509_10163854 | 3300031507 | Bacteria | 2116 |
| 179 | Ga0265313_10075205 | 3300031595 | Bacteria | 1546 |
| 180 | Ga0307508_10773911 | 3300031616 | Bacteria | 575 |
| 181 | Ga0265342_10050515 | 3300031712 | Bacteria | 2484 |
| 182 | Ga0307405_10154105 | 3300031731 | Bacteria | 1620 |
| 183 | Ga0307413_10278534 | 3300031824 | Bacteria | 1257 |
| 184 | Ga0307518_10000212 | 3300031838 | Bacteria | 44023 |
| 185 | Ga0307410_10127471 | 3300031852 | Bacteria | 1865 |
| 186 | Ga0307410_10255896 | 3300031852 | Bacteria | 1363 |
| 187 | Ga0307406_10398297 | 3300031901 | Bacteria | 1090 |
| 188 | Ga0307407_10090764 | 3300031903 | Bacteria | 1872 |
| 189 | Ga0307409_100137481 | 3300031995 | Bacteria | 2099 |
| 190 | Ga0307409_100169279 | 3300031995 | Bacteria | 1921 |
| 191 | Ga0307416_100234795 | 3300032002 | Bacteria | 1771 |
| 192 | Ga0307414_10041200 | 3300032004 | Bacteria | 3126 |
| 193 | Ga0307411_10039467 | 3300032005 | Bacteria | 2987 |
| 194 | Ga0307411_10296844 | 3300032005 | Bacteria | 1294 |
| 195 | Ga0307415_100061463 | 3300032126 | Bacteria | 2601 |
| 196 | Ga0307415_100979277 | 3300032126 | Unclassified | 785 |
| 197 | Ga0316583_10167572 | 3300032133 | Bacteria | 764 |
| 198 | Ga0307507_10006399 | 3300033179 | Bacteria | 18120 |
| 199 | Ga0307507_10058085 | 3300033179 | Bacteria | 3635 |
| 200 | Ga0307507_10230673 | 3300033179 | Bacteria | 1228 |
| 201 | Ga0373945_0216135 | 3300035116 | Bacteria | 800 |
| 202 | Ga0373960_0050291 | 3300035121 | Bacteria | 1235 |
| 203 | Ga0373942_0118692 | 3300035207 | Bacteria | 825 |
| 204 | Ga0316584_0345378 | 3300036712 | Unclassified | 1069 |
| 205 | Ga0316584_0477181 | 3300036712 | Unclassified | 879 |
| 206 | Ga0373925_0473038 | 3300037068 | Bacteria | 1027 |
| 207 | Ga0436364_0979235 | 3300037853 | Bacteria | 801 |
| 208 | Ga0395901_0539811 | 3300038443 | Bacteria | 1183 |
| 209 | Ga0400484_20038 | 3300038725 | Bacteria | 3801 |
| 210 | Ga0400488_01023 | 3300038741 | Bacteria | 5517 |
| 211 | Ga0400483_077109 | 3300039062 | Bacteria | 17445 |
| 212 | Ga0400483_270925 | 3300039062 | Bacteria | 3796 |
| 213 | Ga0400489_38384 | 3300039093 | Bacteria | 14811 |
| 214 | Ga0436365_0879580 | 3300039437 | Bacteria | 36654 |
| 215 | Ga0436363_0545708 | 3300039450 | Bacteria | 2564 |
| 216 | Ga0436363_1379863 | 3300039450 | Bacteria | 654 |
| 217 | Ga0436362_0773038 | 3300039453 | Bacteria | 1843 |
| 218 | Ga0436362_1050387 | 3300039453 | Bacteria | 3065 |
| 219 | Ga0451795_1079187 | 3300041456 | Bacteria | 629 |
| 220 | Ga0466969_0394241 | 3300044656 | Bacteria | 628 |
| 221 | Ga0466972_0024305 | 3300044658 | Bacteria | 3006 |
| 222 | Ga0466972_0264937 | 3300044658 | Bacteria | 803 |
| 223 | Ga0466965_0017584 | 3300044683 | Bacteria | 3419 |
| 224 | Ga0466965_0070598 | 3300044683 | Bacteria | 1756 |
| 225 | Ga0466965_0117725 | 3300044683 | Bacteria | 1370 |
| 226 | Ga0466965_0188087 | 3300044683 | Bacteria | 1091 |
| 227 | Ga0466965_0411390 | 3300044683 | Bacteria | 748 |
| 228 | Ga0466966_0001986 | 3300044684 | Bacteria | 13252 |
| 229 | Ga0466966_0046988 | 3300044684 | Bacteria | 2754 |
| 230 | Ga0466966_0254936 | 3300044684 | Bacteria | 1057 |
| 231 | Ga0466961_0003175 | 3300044693 | Bacteria | 10232 |
| 232 | Ga0466961_0043105 | 3300044693 | Bacteria | 2891 |
| 233 | Ga0466961_0060377 | 3300044693 | Bacteria | 2411 |
| 234 | Ga0466961_0099634 | 3300044693 | Bacteria | 1831 |
| 235 | Ga0466961_0269213 | 3300044693 | Bacteria | 1044 |
| 236 | Ga0466961_0619037 | 3300044693 | Bacteria | 650 |
| 237 | Ga0466963_0002631 | 3300044694 | Bacteria | 10087 |
| 238 | Ga0466963_0224464 | 3300044694 | Bacteria | 1316 |
| 239 | Ga0466963_0457729 | 3300044694 | Bacteria | 900 |
| 240 | Ga0466963_0689079 | 3300044694 | Bacteria | 721 |
| 241 | Ga0466964_0068611 | 3300044706 | Bacteria | 1493 |
| 242 | Ga0453684_1414661 | 3300044712 | Bacteria | 721 |
| 243 | Ga0466971_0010980 | 3300044719 | Bacteria | 3962 |
| 244 | Ga0466971_0172763 | 3300044719 | Bacteria | 1014 |
| 245 | Ga0466971_0370113 | 3300044719 | Bacteria | 696 |
| 246 | Ga0466971_0422459 | 3300044719 | Bacteria | 652 |
| 247 | Ga0466968_0385413 | 3300044735 | Bacteria | 685 |
| 248 | Ga0466968_0668714 | 3300044735 | Bacteria | 528 |
| 249 | Ga0466970_0153024 | 3300044765 | Bacteria | 1274 |
| 250 | Ga0466970_0363674 | 3300044765 | Bacteria | 822 |
| 251 | Ga0466970_0487834 | 3300044765 | Bacteria | 709 |
| 252 | Ga0466970_0764565 | 3300044765 | Bacteria | 565 |
| 253 | Ga0466957_0079185 | 3300044842 | Bacteria | 2044 |
| 254 | Ga0466957_0095170 | 3300044842 | Bacteria | 1870 |
| 255 | Ga0466957_0178497 | 3300044842 | Bacteria | 1386 |
| 256 | Ga0466957_0354321 | 3300044842 | Bacteria | 996 |
| 257 | Ga0466960_0005864 | 3300044901 | Bacteria | 4896 |
| 258 | Ga0466960_0055322 | 3300044901 | Bacteria | 1929 |
| 259 | Ga0466960_0772134 | 3300044901 | Bacteria | 580 |
| 260 | Ga0466959_0005290 | 3300045049 | Bacteria | 8822 |
| 261 | Ga0466959_0256624 | 3300045049 | Bacteria | 1204 |
| 262 | Ga0466959_0349502 | 3300045049 | Bacteria | 1008 |
| 263 | Ga0466959_0829173 | 3300045049 | Bacteria | 618 |
| 264 | Ga0451576_0508825 | 3300045051 | Bacteria | 1265 |
| 265 | Ga0466958_0000094 | 3300045836 | Bacteria | 27609 |
| 266 | Ga0466958_0001151 | 3300045836 | Bacteria | 12266 |
| 267 | Ga0466967_0032019 | 3300045976 | Bacteria | 4436 |
| 268 | Ga0466967_0285345 | 3300045976 | Bacteria | 1585 |
| 269 | Ga0466967_0296576 | 3300045976 | Bacteria | 1554 |
| 270 | Ga0466967_0302543 | 3300045976 | Bacteria | 1539 |
| 271 | Ga0466967_0543276 | 3300045976 | Bacteria | 1143 |
| 272 | Ga0466967_0591803 | 3300045976 | Bacteria | 1094 |
| 273 | Ga0466967_0625683 | 3300045976 | Bacteria | 1063 |
| 274 | Ga0466967_0788574 | 3300045976 | Bacteria | 943 |
| 275 | Ga0466967_1302576 | 3300045976 | Bacteria | 724 |
| 276 | Ga0466967_1352474 | 3300045976 | Bacteria | 709 |
| 277 | Ga0466967_1895847 | 3300045976 | Bacteria | 593 |
| 278 | Ga0495592_0233608 | 3300046454 | Bacteria | 1223 |
| 279 | Ga0495641_0079476 | 3300046461 | Bacteria | 1469 |
| 280 | Ga0495651_0703797 | 3300046462 | Bacteria | 629 |
| 281 | Ga0495639_0419594 | 3300046475 | Bacteria | 677 |
| 282 | Ga0495662_0342977 | 3300046476 | Bacteria | 734 |
| 283 | Ga0495608_0368014 | 3300046511 | Bacteria | 883 |
| 284 | Ga0495630_0180230 | 3300046517 | Bacteria | 1611 |
| 285 | Ga0495652_0208447 | 3300046529 | Bacteria | 1478 |
| 286 | Ga0495586_0046876 | 3300046535 | Bacteria | 2331 |
| 287 | Ga0495587_0377159 | 3300046536 | Bacteria | 789 |
| 288 | Ga0495613_0071561 | 3300046689 | Bacteria | 2527 |
| 289 | Ga0495581_0035527 | 3300047315 | Bacteria | 2884 |
| 290 | Ga0496102_0069949 | 3300048905 | Bacteria | 3222 |
| 291 | Ga0496104_0106950 | 3300048907 | Bacteria | 2681 |
| 292 | Ga0496104_0570785 | 3300048907 | Bacteria | 1042 |
| 293 | Ga0496105_0342103 | 3300048908 | Bacteria | 1196 |
| 294 | Ga0496108_0422083 | 3300048911 | Bacteria | 1165 |
| 295 | Ga0496109_0362012 | 3300048912 | Bacteria | 1370 |
| 296 | Ga0496110_0338473 | 3300048913 | Bacteria | 1371 |
| 297 | Ga0496111_0108691 | 3300048914 | Bacteria | 2042 |
| 298 | Ga0496112_0013351 | 3300048915 | Bacteria | 7582 |
| 299 | Ga0496114_0437633 | 3300048917 | Bacteria | 1158 |
| 300 | Ga0496115_0046510 | 3300048918 | Bacteria | 3469 |
| 301 | Ga0501032_0944159 | 3300049569 | Bacteria | 542 |
| 302 | Ga0501033_0488519 | 3300049570 | Bacteria | 853 |
| 303 | Ga0501034_0271952 | 3300049571 | Bacteria | 1635 |
| 304 | Ga0501043_0831678 | 3300049579 | Bacteria | 666 |
| 305 | Ga0501047_0393434 | 3300049581 | Bacteria | 1219 |
| 306 | Ga0501069_0057832 | 3300049585 | Bacteria | 2162 |
| 307 | Ga0501069_0738379 | 3300049585 | Bacteria | 595 |
| 308 | Ga0501070_0000203 | 3300049586 | Bacteria | 55882 |
| 309 | Ga0501070_0002280 | 3300049586 | Bacteria | 16871 |
| 310 | Ga0501070_0040645 | 3300049586 | Bacteria | 3877 |
| 311 | Ga0501070_0140561 | 3300049586 | Bacteria | 1993 |
| 312 | Ga0501070_0158251 | 3300049586 | Bacteria | 1868 |
| 313 | Ga0501070_0548043 | 3300049586 | Bacteria | 926 |
| 314 | Ga0501071_0409384 | 3300049587 | Bacteria | 1036 |
| 315 | Ga0501073_0090248 | 3300049589 | Bacteria | 2130 |
| 316 | Ga0501074_0014034 | 3300049590 | Bacteria | 5823 |
| 317 | Ga0501074_0219062 | 3300049590 | Bacteria | 1355 |
| 318 | Ga0501074_0768723 | 3300049590 | Bacteria | 679 |
| 319 | Ga0501077_0670766 | 3300049593 | Bacteria | 666 |
| 320 | Ga0501079_0000589 | 3300049741 | Bacteria | 24044 |
| 321 | Ga0501080_0000164 | 3300049742 | Bacteria | 47786 |
| 322 | Ga0501080_0088208 | 3300049742 | Bacteria | 2882 |
| 323 | Ga0501080_0389121 | 3300049742 | Bacteria | 1255 |
| 324 | Ga0501044_0071014 | 3300049823 | Bacteria | 3541 |
| 325 | Ga0501044_0158690 | 3300049823 | Bacteria | 2240 |
| 326 | nmdc:mga05p37_306976_c1 | 3300050507 | Bacteria | 1882 |
| 327 | nmdc:mga05p37_335865_c1 | 3300050507 | Bacteria | 1783 |
| 328 | nmdc:mga05p37_869110_c1 | 3300050507 | Bacteria | 977 |
| 329 | nmdc:mga06r32_1649153_c1 | 3300050510 | Bacteria | 579 |
| 330 | nmdc:mga08x19_103_c1 | 3300050514 | Bacteria | 75178 |
| 331 | nmdc:mga08x19_1_c1 | 3300050514 | Bacteria | 2010344 |
| 332 | Ga0500644_0044714 | 3300053088 | Bacteria | 1488 |
| 333 | Ga0500572_045154 | 3300053111 | Bacteria | 1294 |
| 334 | Ga0500559_0012820 | 3300053136 | Bacteria | 3557 |
| 335 | Ga0500590_250649 | 3300053148 | Bacteria | 704 |
| 336 | Ga0501084_0261605 | 3300054114 | Bacteria | 1461 |
| 337 | Ga0587079_189485 | 3300059647 | Bacteria | 555 |
| 338 | Ga0466962_0019980 | 3300061719 | Bacteria | 3219 |
| 339 | Ga0466962_0075269 | 3300061719 | Bacteria | 1613 |
| 340 | 2586063212 | 2585427649 | Bacteria | 9053857 |
| 341 | 2643759763 | 2643221548 | Bacteria | 8053412 |
| 342 | 2643897888 | 2643221578 | Bacteria | 9213798 |
| 343 | 2644409033 | 2643221673 | Bacteria | 9196637 |
| 344 | 2644462818 | 2643221682 | Bacteria | 6743283 |
| 345 | 2753070527 | 2751185734 | Bacteria | 8863695 |
| 346 | 2793976143 | 2791355406 | Bacteria | 11364898 |
| 347 | 2795784633 | 2795385470 | Bacteria | 8317180 |
| 348 | 2809587639 | 2808606522 | Bacteria | 9488490 |
| 349 | 2819693667 | 2818991463 | Bacteria | 7948711 |
| 350 | 2856743203 | 2856741275 | Bacteria | 8096094 |
| 351 | 2867479673 | 2867475112 | Bacteria | 6909112 |
| 352 | 2870729641 | 2870721527 | Bacteria | 9689237 |
| 353 | 2873317999 | 2873314349 | Bacteria | 8512634 |
| 354 | 2875393799 | 2875391855 | Bacteria | 7600475 |
| 355 | 2891396141 | 2891395885 | Bacteria | 9251614 |
| 356 | 2891558573 | 2891554331 | Bacteria | 8812224 |
| 357 | 2891568682 | 2891562705 | Bacteria | 8039471 |
| 358 | 2899362918 | 2899359706 | Bacteria | 10940472 |
| 359 | 2899371508 | 2899370129 | Bacteria | 6781179 |
| 360 | 2915771223 | 2915768154 | Bacteria | 8424322 |
| 361 | 2917737228 | 2917736166 | Bacteria | 9690793 |
| 362 | 2920114304 | 2920107658 | Bacteria | 10042636 |
| 363 | 2935392280 | 2935390628 | Bacteria | 7043367 |
| 364 | 2946050854 | 2946045630 | Bacteria | 8527308 |
| 365 | 2966603279 | 2966598605 | Bacteria | 7676064 |
| 366 | 2997456554 | 2997451912 | Bacteria | 8492419 |
| 367 | 3006488642 | 3006486233 | Bacteria | 8157040 |
| 368 | 8003318394 | 8003314358 | Bacteria | 10575343 |
| 369 | 8025480690 | 8025478263 | Bacteria | 8209203 |
| 370 | 8047711485 | 8047710418 | Bacteria | 11023148 |
| 371 | 8047898944 | 8047893842 | Bacteria | 11723082 |
| 372 | 8048359975 | 8048356638 | Bacteria | 11044339 |
| 373 | 8048375902 | 8048369669 | Bacteria | 11666822 |
| 374 | 8048382305 | 8048379754 | Bacteria | 11877923 |
| 375 | 8055067251 | 8055066027 | Bacteria | 9479577 |
| 376 | 8056452413 | 8056447290 | Bacteria | 7680491 |
| 377 | 8056673168 | 8056667051 | Bacteria | 6953971 |
| 378 | Ga0373956_0002232 | |||
| 379 | Ga0058862_10013131 | |||
| 380 | Ga0070658_10082906 | |||
| 381 | Ga0070658_10184031 | |||
| 382 | Ga0070658_10871715 | |||
| 383 | Ga0070683_100383719 | |||
| 384 | Ga0070683_100826601 | |||
| 385 | Ga0070683_101386406 | |||
| 386 | Ga0070666_10306650 | |||
| 387 | Ga0070680_100016859 | |||
| 388 | Ga0070680_100057391 | |||
| 389 | Ga0070680_100490672 | |||
| 390 | Ga0070680_100507622 | |||
| 391 | Ga0070682_100278319 | |||
| 392 | Ga0068868_100036072 | |||
| 393 | Ga0070660_100044731 | |||
| 394 | Ga0070660_100503439 | |||
| 395 | Ga0070660_101773559 | |||
| 396 | Ga0070661_101198536 | |||
| 397 | Ga0070668_100633231 | |||
| 398 | Ga0070674_100091300 | |||
| 399 | Ga0070674_100389835 | |||
| 400 | Ga0070673_101528229 | |||
| 401 | Ga0070659_100005377 | |||
| 402 | Ga0070659_100008180 | |||
| 403 | Ga0070659_100435029 | |||
| 404 | Ga0070714_100740600 | |||
| 405 | Ga0070714_101025919 | |||
| 406 | Ga0070710_10019869 | |||
| 407 | Ga0070700_100123937 | |||
| 408 | Ga0070694_101047089 | |||
| 409 | Ga0070708_100410992 | |||
| 410 | Ga0070663_100000334 | |||
| 411 | Ga0070681_10000028 | |||
| 412 | Ga0070681_10002546 | |||
| 413 | Ga0070681_10007661 | |||
| 414 | Ga0070681_10103660 | |||
| 415 | Ga0070706_100008343 | |||
| 416 | Ga0070679_100000092 | |||
| 417 | Ga0070679_100098013 | |||
| 418 | Ga0070679_100184007 | |||
| 419 | Ga0070679_100226306 | |||
| 420 | Ga0070679_100229239 | |||
| 421 | Ga0070679_100519576 | |||
| 422 | Ga0070684_100751043 | |||
| 423 | Ga0070684_100995706 | |||
| 424 | Ga0070684_101340265 | |||
| 425 | Ga0068853_102049660 | |||
| 426 | Ga0070686_100174376 | |||
| 427 | Ga0070665_100289561 | |||
| 428 | Ga0070665_100593532 | |||
| 429 | Ga0070704_100203905 | |||
| 430 | Ga0068855_100422594 | |||
| 431 | Ga0068855_101262737 | |||
| 432 | Ga0068857_100248880 | |||
| 433 | Ga0068856_100452575 | |||
| 434 | Ga0068852_100159997 | |||
| 435 | Ga0068861_100795181 | |||
| 436 | Ga0068863_101139845 | |||
| 437 | Ga0081455_10000024 | |||
| 438 | Ga0081455_10057856 | |||
| 439 | Ga0070716_100495929 | |||
| 440 | Ga0075370_10118193 | |||
| 441 | Ga0075428_100700488 | |||
| 442 | Ga0075436_100000003 | |||
| 443 | Ga0075436_100000241 | |||
| 444 | Ga0105240_11153801 | |||
| 445 | Ga0111539_10089052 | |||
| 446 | Ga0111539_12885586 | |||
| 447 | Ga0105245_10439171 | |||
| 448 | Ga0105245_11586155 | |||
| 449 | Ga0114129_10278468 | |||
| 450 | Ga0114129_10377302 | |||
| 451 | Ga0114129_10961239 | |||
| 452 | Ga0114129_11491177 | |||
| 453 | Ga0105242_10324863 | |||
| 454 | Ga0105242_10953366 | |||
| 455 | Ga0105238_10615767 | |||
| 456 | Ga0105238_11351113 | |||
| 457 | Ga0105249_10280694 | |||
| 458 | Ga0105239_12749193 | |||
| 459 | Ga0157373_10210140 | |||
| 460 | Ga0157373_10681915 | |||
| 461 | Ga0157371_10355461 | |||
| 462 | Ga0157370_10159392 | |||
| 463 | Ga0157369_10007541 | |||
| 464 | Ga0157369_10012714 | |||
| 465 | Ga0157369_10118515 | |||
| 466 | Ga0157369_10827685 | |||
| 467 | Ga0157369_10897202 | |||
| 468 | Ga0157369_11407972 | |||
| 469 | Ga0157374_10459044 | |||
| 470 | Ga0157374_12557866 | |||
| 471 | Ga0157378_11022466 | |||
| 472 | Ga0157378_11349842 | |||
| 473 | Ga0157372_10488194 | |||
| 474 | Ga0157372_12934386 | |||
| 475 | Ga0157375_10656016 | |||
| 476 | Ga0157375_11076635 | |||
| 477 | Ga0163163_10943175 | |||
| 478 | Ga0157377_10515096 | |||
| 479 | Ga0157379_12071405 | |||
| 480 | Ga0182005_1173454 | |||
| 481 | Ga0206356_10633645 | |||
| 482 | Ga0206354_11327704 | |||
| 483 | Ga0206353_10535170 | |||
| 484 | Ga0213873_10034826 | |||
| 485 | Ga0213876_10000698 | |||
| 486 | Ga0213875_10000692 | |||
| 487 | Ga0224712_10005017 | |||
| 488 | Ga0224712_10173908 | |||
| 489 | Ga0207426_1020717 | |||
| 490 | Ga0207692_10001122 | |||
| 491 | Ga0207680_10263896 | |||
| 492 | Ga0207647_10219009 | |||
| 493 | Ga0207647_10221136 | |||
| 494 | Ga0207705_10005529 | |||
| 495 | Ga0207705_10143767 | |||
| 496 | Ga0207705_10608499 | |||
| 497 | Ga0207707_10000584 | |||
| 498 | Ga0207707_10004431 | |||
| 499 | Ga0207707_10008490 | |||
| 500 | Ga0207707_10011374 | |||
| 501 | Ga0207707_10298193 | |||
| 502 | Ga0207660_10001153 | |||
| 503 | Ga0207660_10037760 | |||
| 504 | Ga0207660_10445378 | |||
| 505 | Ga0207660_10457600 | |||
| 506 | Ga0207660_10478025 | |||
| 507 | Ga0207657_10041752 | |||
| 508 | Ga0207657_10079750 | |||
| 509 | Ga0207657_10170053 | |||
| 510 | Ga0207657_10699728 | |||
| 511 | Ga0207657_10893130 | |||
| 512 | Ga0207652_10000092 | |||
| 513 | Ga0207652_10027506 | |||
| 514 | Ga0207652_10235927 | |||
| 515 | Ga0207652_10268191 | |||
| 516 | Ga0207652_10422503 | |||
| 517 | Ga0207694_10332220 | |||
| 518 | Ga0207687_10392885 | |||
| 519 | Ga0207664_10910989 | |||
| 520 | Ga0207690_10001321 | |||
| 521 | Ga0207690_10008506 | |||
| 522 | Ga0207686_11257926 | |||
| 523 | Ga0207669_10186308 | |||
| 524 | Ga0207669_10189961 | |||
| 525 | Ga0207661_10165601 | |||
| 526 | Ga0207667_10729179 | |||
| 527 | Ga0207667_10792665 | |||
| 528 | Ga0207668_10009186 | |||
| 529 | Ga0207677_10009292 | |||
| 530 | Ga0207677_10320277 | |||
| 531 | Ga0207678_10000042 | |||
| 532 | Ga0207708_10084260 | |||
| 533 | Ga0207708_10388498 | |||
| 534 | Ga0207641_10129300 | |||
| 535 | Ga0207674_10139334 | |||
| 536 | Ga0207698_10170639 | |||
| 537 | Ga0268266_10278198 | |||
| 538 | Ga0268266_10677775 | |||
| 539 | Ga0268265_11209743 | |||
| 540 | Ga0265334_10082617 | |||
| 541 | Ga0307515_10049087 | |||
| 542 | Ga0307511_10090508 | |||
| 543 | Ga0307512_10192089 | |||
| 544 | Ga0314311_1132469 | |||
| 545 | Ga0316180_1002470 | |||
| 546 | Ga0265762_1011554 | |||
| 547 | Ga0265770_1028003 | |||
| 548 | Ga0265332_10101544 | |||
| 549 | Ga0265320_10058608 | |||
| 550 | Ga0265325_10075110 | |||
| 551 | Ga0265325_10100499 | |||
| 552 | Ga0265340_10014804 | |||
| 553 | Ga0265339_10117213 | |||
| 554 | Ga0265316_10023253 | |||
| 555 | Ga0307509_10163854 | |||
| 556 | Ga0265313_10075205 | |||
| 557 | Ga0307508_10773911 | |||
| 558 | Ga0265342_10050515 | |||
| 559 | Ga0307405_10154105 | |||
| 560 | Ga0307413_10278534 | |||
| 561 | Ga0307518_10000212 | |||
| 562 | Ga0307410_10127471 | |||
| 563 | Ga0307410_10255896 | |||
| 564 | Ga0307406_10398297 | |||
| 565 | Ga0307407_10090764 | |||
| 566 | Ga0307409_100137481 | |||
| 567 | Ga0307409_100169279 | |||
| 568 | Ga0307416_100234795 | |||
| 569 | Ga0307414_10041200 | |||
| 570 | Ga0307411_10039467 | |||
| 571 | Ga0307411_10296844 | |||
| 572 | Ga0307415_100061463 | |||
| 573 | Ga0307415_100979277 | |||
| 574 | Ga0316583_10167572 | |||
| 575 | Ga0307507_10006399 | |||
| 576 | Ga0307507_10058085 | |||
| 577 | Ga0307507_10230673 | |||
| 578 | Ga0373945_0216135 | |||
| 579 | Ga0373960_0050291 | |||
| 580 | Ga0373942_0118692 | |||
| 581 | Ga0316584_0345378 | |||
| 582 | Ga0316584_0477181 | |||
| 583 | Ga0373925_0473038 | |||
| 584 | Ga0436364_0979235 | |||
| 585 | Ga0395901_0539811 | |||
| 586 | Ga0400484_20038 | |||
| 587 | Ga0400488_01023 | |||
| 588 | Ga0400483_077109 | |||
| 589 | Ga0400483_270925 | |||
| 590 | Ga0400489_38384 | |||
| 591 | Ga0436365_0879580 | |||
| 592 | Ga0436363_0545708 | |||
| 593 | Ga0436363_1379863 | |||
| 594 | Ga0436362_0773038 | |||
| 595 | Ga0436362_1050387 | |||
| 596 | Ga0451795_1079187 | |||
| 597 | Ga0466969_0394241 | |||
| 598 | Ga0466972_0024305 | |||
| 599 | Ga0466972_0264937 | |||
| 600 | Ga0466965_0017584 | |||
| 601 | Ga0466965_0070598 | |||
| 602 | Ga0466965_0117725 | |||
| 603 | Ga0466965_0188087 | |||
| 604 | Ga0466965_0411390 | |||
| 605 | Ga0466966_0001986 | |||
| 606 | Ga0466966_0046988 | |||
| 607 | Ga0466966_0254936 | |||
| 608 | Ga0466961_0003175 | |||
| 609 | Ga0466961_0043105 | |||
| 610 | Ga0466961_0060377 | |||
| 611 | Ga0466961_0099634 | |||
| 612 | Ga0466961_0269213 | |||
| 613 | Ga0466961_0619037 | |||
| 614 | Ga0466963_0002631 | |||
| 615 | Ga0466963_0224464 | |||
| 616 | Ga0466963_0457729 | |||
| 617 | Ga0466963_0689079 | |||
| 618 | Ga0466964_0068611 | |||
| 619 | Ga0453684_1414661 | |||
| 620 | Ga0466971_0010980 | |||
| 621 | Ga0466971_0172763 | |||
| 622 | Ga0466971_0370113 | |||
| 623 | Ga0466971_0422459 | |||
| 624 | Ga0466968_0385413 | |||
| 625 | Ga0466968_0668714 | |||
| 626 | Ga0466970_0153024 | |||
| 627 | Ga0466970_0363674 | |||
| 628 | Ga0466970_0487834 | |||
| 629 | Ga0466970_0764565 | |||
| 630 | Ga0466957_0079185 | |||
| 631 | Ga0466957_0095170 | |||
| 632 | Ga0466957_0178497 | |||
| 633 | Ga0466957_0354321 | |||
| 634 | Ga0466960_0005864 | |||
| 635 | Ga0466960_0055322 | |||
| 636 | Ga0466960_0772134 | |||
| 637 | Ga0466959_0005290 | |||
| 638 | Ga0466959_0256624 | |||
| 639 | Ga0466959_0349502 | |||
| 640 | Ga0466959_0829173 | |||
| 641 | Ga0451576_0508825 | |||
| 642 | Ga0466958_0000094 | |||
| 643 | Ga0466958_0001151 | |||
| 644 | Ga0466967_0032019 | |||
| 645 | Ga0466967_0285345 | |||
| 646 | Ga0466967_0296576 | |||
| 647 | Ga0466967_0302543 | |||
| 648 | Ga0466967_0543276 | |||
| 649 | Ga0466967_0591803 | |||
| 650 | Ga0466967_0625683 | |||
| 651 | Ga0466967_0788574 | |||
| 652 | Ga0466967_1302576 | |||
| 653 | Ga0466967_1352474 | |||
| 654 | Ga0466967_1895847 | |||
| 655 | Ga0495592_0233608 | |||
| 656 | Ga0495641_0079476 | |||
| 657 | Ga0495651_0703797 | |||
| 658 | Ga0495639_0419594 | |||
| 659 | Ga0495662_0342977 | |||
| 660 | Ga0495608_0368014 | |||
| 661 | Ga0495630_0180230 | |||
| 662 | Ga0495652_0208447 | |||
| 663 | Ga0495586_0046876 | |||
| 664 | Ga0495587_0377159 | |||
| 665 | Ga0495613_0071561 | |||
| 666 | Ga0495581_0035527 | |||
| 667 | Ga0496102_0069949 | |||
| 668 | Ga0496104_0106950 | |||
| 669 | Ga0496104_0570785 | |||
| 670 | Ga0496105_0342103 | |||
| 671 | Ga0496108_0422083 | |||
| 672 | Ga0496109_0362012 | |||
| 673 | Ga0496110_0338473 | |||
| 674 | Ga0496111_0108691 | |||
| 675 | Ga0496112_0013351 | |||
| 676 | Ga0496114_0437633 | |||
| 677 | Ga0496115_0046510 | |||
| 678 | Ga0501032_0944159 | |||
| 679 | Ga0501033_0488519 | |||
| 680 | Ga0501034_0271952 | |||
| 681 | Ga0501043_0831678 | |||
| 682 | Ga0501047_0393434 | |||
| 683 | Ga0501069_0057832 | |||
| 684 | Ga0501069_0738379 | |||
| 685 | Ga0501070_0000203 | |||
| 686 | Ga0501070_0002280 | |||
| 687 | Ga0501070_0040645 | |||
| 688 | Ga0501070_0140561 | |||
| 689 | Ga0501070_0158251 | |||
| 690 | Ga0501070_0548043 | |||
| 691 | Ga0501071_0409384 | |||
| 692 | Ga0501073_0090248 | |||
| 693 | Ga0501074_0014034 | |||
| 694 | Ga0501074_0219062 | |||
| 695 | Ga0501074_0768723 | |||
| 696 | Ga0501077_0670766 | |||
| 697 | Ga0501079_0000589 | |||
| 698 | Ga0501080_0000164 | |||
| 699 | Ga0501080_0088208 | |||
| 700 | Ga0501080_0389121 | |||
| 701 | Ga0501044_0071014 | |||
| 702 | Ga0501044_0158690 | |||
| 703 | nmdc:mga05p37_306976_c1 | |||
| 704 | nmdc:mga05p37_335865_c1 | |||
| 705 | nmdc:mga05p37_869110_c1 | |||
| 706 | nmdc:mga06r32_1649153_c1 | |||
| 707 | nmdc:mga08x19_103_c1 | |||
| 708 | nmdc:mga08x19_1_c1 | |||
| 709 | Ga0500644_0044714 | |||
| 710 | Ga0500572_045154 | |||
| 711 | Ga0500559_0012820 | |||
| 712 | Ga0500590_250649 | |||
| 713 | Ga0501084_0261605 | |||
| 714 | Ga0587079_189485 | |||
| 715 | Ga0466962_0019980 | |||
| 716 | Ga0466962_0075269 | |||
| 717 | 2586063212 | |||
| 718 | 2643759763 | |||
| 719 | 2643897888 | |||
| 720 | 2644409033 | |||
| 721 | 2644462818 | |||
| 722 | 2753070527 | |||
| 723 | 2793976143 | |||
| 724 | 2795784633 | |||
| 725 | 2809587639 | |||
| 726 | 2819693667 | |||
| 727 | 2856743203 | |||
| 728 | 2867479673 | |||
| 729 | 2870729641 | |||
| 730 | 2873317999 | |||
| 731 | 2875393799 | |||
| 732 | 2891396141 | |||
| 733 | 2891558573 | |||
| 734 | 2891568682 | |||
| 735 | 2899362918 | |||
| 736 | 2899371508 | |||
| 737 | 2915771223 | |||
| 738 | 2917737228 | |||
| 739 | 2920114304 | |||
| 740 | 2935392280 | |||
| 741 | 2946050854 | |||
| 742 | 2966603279 | |||
| 743 | 2997456554 | |||
| 744 | 3006488642 | |||
| 745 | 8003318394 | |||
| 746 | 8025480690 | |||
| 747 | 8047711485 | |||
| 748 | 8047898944 | |||
| 749 | 8048359975 | |||
| 750 | 8048375902 | |||
| 751 | 8048382305 | |||
| 752 | 8055067251 | |||
| 753 | 8056452413 | |||
| 754 | 8056673168 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3vvu-assembly1.cif.gz_A | crystal structure of reconstructed bacterial ancestral ndk, bac1 | 0.9905 | 1 | 139 |
| 5v6d-assembly3.cif.gz_F | crystal structure of nucleoside diphosphate kinase from neisseria gonorrhoeae in complex with citrate | 0.9893 | 2 | 139 |
| 3r9l-assembly1.cif.gz_A | crystal structure of nucleoside diphosphate kinase from giardia lamblia featuring a disordered dinucleotide binding site | 0.9893 | 2 | 136 |
| 4anc-assembly1.cif.gz_A | crystal form i of the d93n mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis | 0.9888 | 1 | 131 |
| 4ane-assembly1.cif.gz_E | r80n mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis | 0.988 | 1 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0G2L2L7_25_106_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9879 | 2 | 77 | 3.30.70.141 |
| 1k44A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9876 | 1 | 133 | 3.30.70.141 |
| af_A0A1D6EH51_54_191_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9872 | 19 | 147 | 3.30.70.141 |
| af_C6T4F9_81_235_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9868 | 1 | 148 | 3.30.70.141 |
| 3vgvN00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9797 | 2 | 139 | 3.30.70.141 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9KEH2-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 0.998 | 1 | 131 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A7V9LV15-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 0.9974 | 2 | 131 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A7X7YN19-F1-model_v4 | Nucleoside diphosphate kinase (EC 2.7.4.6) | 0.9964 | 1 | 131 |
GO:0004550
GO:0005524 GO:0006183 GO:0006228 GO:0006241 |
| AF-K9CZ98-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 0.9964 | 1 | 131 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A401I5H2-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 0.9959 | 1 | 131 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |