F427741

General Info

Members Datasets Scaffolds Average Seq Length
377 179 754 188

Family's Representative Sequence

Representative Sequence 3300031733|Ga0316577_10079358|Ga0316577_100793581
Length 198
Sequence MKSPIKKILMFALVGIAILGLSSCGYNRMQQLEEGVNRAWGDLEAQLQRRADLVPNLVATVKGYASHERETLEAVVNARARATSVQLTPEMLSDPEAVAQFQEAQGSLSSALSRLLVVVEAYPDLKANQNFRDLQVQLEGTENRISVARQXXNQAVXXXXFSIRRFPNSLTNRLLLHLERKEYYEADAAAREAPKVEF

Samples

Sample ID Description Type Environment
1 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
78 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
91 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
95 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
96 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
97 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
118 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
119 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
120 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
146 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
147 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
148 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
149 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
150 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
151 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
152 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
153 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
154 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
155 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
156 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
162 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
163 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
164 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
165 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
166 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
177 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.59
Rhizosphere 98.14
Stem 0
Stem Tuber 0
Unclassified 5.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316577_10079358 3300031733 Bacteria 1834
2 Ga0070676_10114629 3300005328 Bacteria 1683
3 Ga0070680_100076680 3300005336 Bacteria 2752
4 Ga0070674_100453503 3300005356 Bacteria 1059
5 Ga0070673_100152701 3300005364 Bacteria 1957
6 Ga0070659_100012845 3300005366 Bacteria 6221
7 Ga0070703_10001631 3300005406 Bacteria 6662
8 Ga0070705_100011580 3300005440 Bacteria 4456
9 Ga0070705_100035914 3300005440 Bacteria 2781
10 Ga0070705_100057744 3300005440 Bacteria 2291
11 Ga0070705_100112061 3300005440 Bacteria 1745
12 Ga0070705_100195882 3300005440 Bacteria 1381
13 Ga0070708_100069645 3300005445 Bacteria 3164
14 Ga0070663_100356364 3300005455 Bacteria 1186
15 Ga0070663_100665497 3300005455 Bacteria 882
16 Ga0070678_100370317 3300005456 Bacteria 1237
17 Ga0070662_100528608 3300005457 Bacteria 986
18 Ga0070681_10089535 3300005458 Bacteria 3029
19 Ga0070681_10154848 3300005458 Bacteria 2217
20 Ga0070681_10566425 3300005458 Bacteria 1050
21 Ga0068867_101249907 3300005459 Bacteria 684
22 Ga0070706_100015330 3300005467 Bacteria 7075
23 Ga0070706_100079397 3300005467 Bacteria 3037
24 Ga0070706_101124710 3300005467 Bacteria 723
25 Ga0070707_100000266 3300005468 Bacteria 51948
26 Ga0070707_100001254 3300005468 Bacteria 24951
27 Ga0070707_100041300 3300005468 Bacteria 4414
28 Ga0070707_100221730 3300005468 Bacteria 1841
29 Ga0070707_100330128 3300005468 Bacteria 1482
30 Ga0070698_100001523 3300005471 Bacteria 25707
31 Ga0070698_100022587 3300005471 Bacteria 6580
32 Ga0070698_100044951 3300005471 Bacteria 4521
33 Ga0070698_100050529 3300005471 Bacteria 4238
34 Ga0070699_100001124 3300005518 Bacteria 24927
35 Ga0070699_100012845 3300005518 Bacteria 7218
36 Ga0070699_100013219 3300005518 Bacteria 7117
37 Ga0070699_100014427 3300005518 Bacteria 6793
38 Ga0070699_100021338 3300005518 Bacteria 5586
39 Ga0070699_100080179 3300005518 Bacteria 2845
40 Ga0070699_100291387 3300005518 Bacteria 1463
41 Ga0070679_100092844 3300005530 Bacteria 3005
42 Ga0070684_100517632 3300005535 Bacteria 1106
43 Ga0070697_100259803 3300005536 Bacteria 1487
44 Ga0070697_100346189 3300005536 Bacteria 1283
45 Ga0070672_100026985 3300005543 Bacteria 4281
46 Ga0070695_100369429 3300005545 Bacteria 1080
47 Ga0070695_100542466 3300005545 Bacteria 905
48 Ga0070696_100162380 3300005546 Bacteria 1647
49 Ga0070696_100678946 3300005546 Bacteria 838
50 Ga0070704_100000053 3300005549 Bacteria 37727
51 Ga0070704_100112568 3300005549 Bacteria 2074
52 Ga0070664_100988633 3300005564 Bacteria 791
53 Ga0068857_100500708 3300005577 Bacteria 1140
54 Ga0070702_100203328 3300005615 Bacteria 1313
55 Ga0068852_100680624 3300005616 Bacteria 1038
56 Ga0068859_100009362 3300005617 Bacteria 9890
57 Ga0068859_100154302 3300005617 Bacteria 2373
58 Ga0068859_100222054 3300005617 Bacteria 1977
59 Ga0068862_100674479 3300005844 Bacteria 999
60 Ga0068862_100917132 3300005844 Bacteria 862
61 Ga0075428_100057131 3300006844 Bacteria 4273
62 Ga0075428_100367100 3300006844 Bacteria 1544
63 Ga0075428_101195303 3300006844 Bacteria 802
64 Ga0075431_100381000 3300006847 Bacteria 1414
65 Ga0075431_100737824 3300006847 Bacteria 961
66 Ga0075433_10040313 3300006852 Bacteria 4042
67 Ga0075433_10041739 3300006852 Bacteria 3976
68 Ga0075433_10271170 3300006852 Bacteria 1504
69 Ga0075434_100030844 3300006871 Bacteria 5282
70 Ga0075434_100130539 3300006871 Bacteria 2531
71 Ga0075434_100130797 3300006871 Bacteria 2529
72 Ga0075434_100408379 3300006871 Bacteria 1379
73 Ga0075429_100000196 3300006880 Bacteria 40118
74 Ga0075429_100136315 3300006880 Bacteria 2148
75 Ga0075429_100280980 3300006880 Bacteria 1458
76 Ga0068865_100197659 3300006881 Bacteria 1559
77 Ga0097620_100009362 3300006931 Bacteria 9890
78 Ga0097620_100154294 3300006931 Bacteria 2373
79 Ga0097620_100222054 3300006931 Bacteria 1977
80 Ga0075435_100200196 3300007076 Bacteria 1692
81 Ga0075435_100253440 3300007076 Bacteria 1498
82 Ga0075435_100300371 3300007076 Bacteria 1373
83 Ga0099794_10145016 3300007265 Bacteria 1204
84 Ga0111539_10922497 3300009094 Bacteria 1016
85 Ga0111539_12313578 3300009094 Bacteria 623
86 Ga0114129_10000967 3300009147 Bacteria 37553
87 Ga0114129_10066072 3300009147 Bacteria 5045
88 Ga0114129_10095755 3300009147 Bacteria 4111
89 Ga0114129_10137554 3300009147 Bacteria 3351
90 Ga0114129_10199384 3300009147 Bacteria 2712
91 Ga0114129_10536617 3300009147 Unclassified 1523
92 Ga0114129_10942081 3300009147 Bacteria 1091
93 Ga0105241_10408121 3300009174 Bacteria 1193
94 Ga0105248_11268062 3300009177 Bacteria 833
95 Ga0105249_10256189 3300009553 Bacteria 1737
96 Ga0105249_10912552 3300009553 Bacteria 945
97 Ga0163163_10017523 3300014325 Bacteria 6682
98 Ga0157379_10087117 3300014968 Bacteria 2800
99 Ga0207653_10000024 3300025885 Bacteria 117069
100 Ga0207684_10010611 3300025910 Bacteria 8097
101 Ga0207684_10057141 3300025910 Bacteria 3310
102 Ga0207654_10736466 3300025911 Bacteria 710
103 Ga0207707_10001068 3300025912 Bacteria 26271
104 Ga0207707_10591866 3300025912 Bacteria 939
105 Ga0207660_10067500 3300025917 Bacteria 2590
106 Ga0207657_10298744 3300025919 Bacteria 1276
107 Ga0207652_10112335 3300025921 Bacteria 2417
108 Ga0207652_10620263 3300025921 Bacteria 969
109 Ga0207646_10002204 3300025922 Bacteria 23196
110 Ga0207646_10012808 3300025922 Bacteria 8040
111 Ga0207646_10045301 3300025922 Bacteria 3949
112 Ga0207646_10363923 3300025922 Bacteria 1306
113 Ga0207659_10216786 3300025926 Bacteria 1537
114 Ga0207644_10009160 3300025931 Bacteria 6493
115 Ga0207690_10348412 3300025932 Bacteria 1170
116 Ga0207706_10345608 3300025933 Bacteria 1294
117 Ga0207670_10524041 3300025936 Bacteria 965
118 Ga0207669_10414215 3300025937 Bacteria 1059
119 Ga0207704_10517551 3300025938 Bacteria 964
120 Ga0207691_10086892 3300025940 Bacteria 2806
121 Ga0207711_10862089 3300025941 Bacteria 843
122 Ga0207639_10920570 3300026041 Bacteria 817
123 Ga0207678_10061526 3300026067 Bacteria 3229
124 Ga0207678_10374154 3300026067 Bacteria 1231
125 Ga0207708_10048892 3300026075 Bacteria 3220
126 Ga0207708_10399411 3300026075 Bacteria 1136
127 Ga0207674_10248574 3300026116 Bacteria 1725
128 Ga0207683_10568332 3300026121 Bacteria 1049
129 Ga0207698_10517907 3300026142 Bacteria 1163
130 Ga0209983_1008040 3300027665 Bacteria 2157
131 Ga0209974_10024347 3300027876 Bacteria 2004
132 Ga0209974_10259491 3300027876 Unclassified 656
133 Ga0207428_10296082 3300027907 Bacteria 1198
134 Ga0268265_10201986 3300028380 Bacteria 1725
135 Ga0268264_10573900 3300028381 Bacteria 1109
136 Ga0307408_100008565 3300031548 Bacteria 6756
137 Ga0307408_100055608 3300031548 Bacteria 2866
138 Ga0307408_100138703 3300031548 Bacteria 1906
139 Ga0316575_10173868 3300031665 Bacteria 893
140 Ga0316579_10014691 3300031691 Bacteria 3392
141 Ga0316579_10076029 3300031691 Bacteria 1596
142 Ga0307405_10022172 3300031731 Bacteria 3586
143 Ga0307405_10182541 3300031731 Bacteria 1508
144 Ga0307405_10240360 3300031731 Bacteria 1341
145 Ga0307413_10014693 3300031824 Bacteria 3987
146 Ga0307413_10043090 3300031824 Bacteria 2657
147 Ga0307413_10049271 3300031824 Bacteria 2523
148 Ga0307413_10231142 3300031824 Bacteria 1358
149 Ga0307413_10651818 3300031824 Bacteria 868
150 Ga0307410_10017253 3300031852 Bacteria 4330
151 Ga0307410_10033341 3300031852 Bacteria 3324
152 Ga0307410_10046668 3300031852 Bacteria 2891
153 Ga0307410_10051583 3300031852 Bacteria 2773
154 Ga0307410_10056898 3300031852 Bacteria 2661
155 Ga0307410_10060429 3300031852 Bacteria 2590
156 Ga0307410_10147676 3300031852 Unclassified 1746
157 Ga0307410_10237618 3300031852 Bacteria 1410
158 Ga0307406_10060258 3300031901 Unclassified 2446
159 Ga0307406_10085878 3300031901 Bacteria 2105
160 Ga0307406_10101696 3300031901 Bacteria 1959
161 Ga0307406_10187837 3300031901 Bacteria 1510
162 Ga0307406_10328303 3300031901 Bacteria 1186
163 Ga0307407_10036728 3300031903 Bacteria 2702
164 Ga0307407_10070057 3300031903 Bacteria 2083
165 Ga0307407_10167190 3300031903 Bacteria 1445
166 Ga0307407_10240521 3300031903 Bacteria 1235
167 Ga0307407_10671103 3300031903 Bacteria 778
168 Ga0307407_10732135 3300031903 Bacteria 747
169 Ga0307412_10016507 3300031911 Bacteria 4400
170 Ga0307412_10521535 3300031911 Bacteria 993
171 Ga0307409_100004334 3300031995 Bacteria 7950
172 Ga0307409_100008556 3300031995 Bacteria 6220
173 Ga0307409_100035204 3300031995 Bacteria 3666
174 Ga0307409_100118005 3300031995 Bacteria 2240
175 Ga0307409_100235966 3300031995 Unclassified 1661
176 Ga0307409_100268742 3300031995 Bacteria 1569
177 Ga0307409_100372018 3300031995 Bacteria 1355
178 Ga0307409_101505105 3300031995 Bacteria 700
179 Ga0307416_100002674 3300032002 Bacteria 10315
180 Ga0307416_100004930 3300032002 Bacteria 8128
181 Ga0307416_100008182 3300032002 Bacteria 6723
182 Ga0307416_100011313 3300032002 Bacteria 5939
183 Ga0307416_100031607 3300032002 Bacteria 3988
184 Ga0307416_100047575 3300032002 Bacteria 3396
185 Ga0307416_100079303 3300032002 Bacteria 2766
186 Ga0307414_10022341 3300032004 Unclassified 3988
187 Ga0307414_10086928 3300032004 Bacteria 2308
188 Ga0307414_10099728 3300032004 Bacteria 2183
189 Ga0307414_10374510 3300032004 Bacteria 1229
190 Ga0307414_10521399 3300032004 Bacteria 1055
191 Ga0307411_10004102 3300032005 Bacteria 6909
192 Ga0307411_10006743 3300032005 Bacteria 5775
193 Ga0307411_10137181 3300032005 Bacteria 1798
194 Ga0307411_10213637 3300032005 Bacteria 1491
195 Ga0307411_10242672 3300032005 Bacteria 1411
196 Ga0307411_10302263 3300032005 Bacteria 1284
197 Ga0307415_100112854 3300032126 Unclassified 2020
198 Ga0307415_100288968 3300032126 Bacteria 1352
199 Ga0307415_101527775 3300032126 Unclassified 639
200 Ga0307415_101603915 3300032126 Bacteria 625
201 Ga0316583_10009543 3300032133 Bacteria 3495
202 Ga0373961_0163074 3300035241 Bacteria 767
203 Ga0373937_0564488 3300036401 Bacteria 1081
204 Ga0316582_0034422 3300036647 Bacteria 3120
205 Ga0316582_0075494 3300036647 Bacteria 2190
206 Ga0316581_0058405 3300037588 Bacteria 1183
207 Ga0400489_88973 3300039093 Bacteria 3468
208 Ga0439446_0026034 3300042156 Bacteria 1674
209 Ga0439434_0042915 3300042435 Bacteria 1391
210 Ga0451577_1116045 3300042876 Bacteria 705
211 Ga0453683_0100260 3300044673 Bacteria 1818
212 Ga0453684_0204460 3300044712 Bacteria 2300
213 Ga0451576_0022259 3300045051 Bacteria 6875
214 Ga0451576_0108508 3300045051 Bacteria 2888
215 Ga0451576_0392494 3300045051 Bacteria 1455
216 Ga0466967_0748769 3300045976 Bacteria 969
217 Ga0495582_0018766 3300046473 Bacteria 3782
218 Ga0495664_0013087 3300046477 Bacteria 4705
219 Ga0495594_0035504 3300046499 Bacteria 2716
220 Ga0495666_0100304 3300046526 Bacteria 1364
221 Ga0495621_0143616 3300046539 Bacteria 935
222 Ga0495667_0565698 3300046559 Bacteria 710
223 Ga0495647_0049686 3300046681 Bacteria 1625
224 Ga0495658_0032598 3300046683 Bacteria 2846
225 Ga0495581_0253678 3300047315 Bacteria 1029
226 Ga0496102_1378602 3300048905 Bacteria 624
227 Ga0496103_0118469 3300048906 Bacteria 1686
228 Ga0496108_0868900 3300048911 Bacteria 775
229 Ga0496109_0919913 3300048912 Bacteria 813
230 Ga0496110_0088515 3300048913 Bacteria 2766
231 Ga0496110_0580333 3300048913 Bacteria 1018
232 Ga0501296_021593 3300049519 Bacteria 826
233 Ga0501298_015842 3300049521 Bacteria 1361
234 Ga0501299_027069 3300049522 Bacteria 1086
235 Ga0501299_144407 3300049522 Bacteria 595
236 Ga0501031_0070189 3300049568 Bacteria 2282
237 Ga0501032_0425644 3300049569 Unclassified 852
238 Ga0501033_0094387 3300049570 Bacteria 2188
239 Ga0501033_0249991 3300049570 Bacteria 1257
240 Ga0501034_0213298 3300049571 Bacteria 1885
241 Ga0501036_0110368 3300049572 Bacteria 2324
242 Ga0501036_1049254 3300049572 Unclassified 666
243 Ga0501037_0090039 3300049573 Bacteria 2220
244 Ga0501038_0086321 3300049574 Bacteria 2637
245 Ga0501038_0336758 3300049574 Unclassified 1177
246 Ga0501040_0180076 3300049576 Unclassified 1498
247 Ga0501041_0065091 3300049577 Bacteria 2233
248 Ga0501041_0084139 3300049577 Bacteria 1961
249 Ga0501042_0052940 3300049578 Bacteria 2896
250 Ga0501042_0246300 3300049578 Bacteria 1290
251 Ga0501043_0947407 3300049579 Bacteria 615
252 Ga0501046_0069236 3300049580 Unclassified 2746
253 Ga0501046_0282603 3300049580 Bacteria 1215
254 Ga0501047_0183444 3300049581 Bacteria 1959
255 Ga0501048_0103308 3300049582 Bacteria 2011
256 Ga0501067_0005132 3300049583 Bacteria 7276
257 Ga0501068_0004432 3300049584 Bacteria 7637
258 Ga0501068_0180720 3300049584 Bacteria 1334
259 Ga0501068_0209892 3300049584 Bacteria 1236
260 Ga0501069_0000944 3300049585 Bacteria 13852
261 Ga0501069_0119906 3300049585 Bacteria 1502
262 Ga0501070_0167385 3300049586 Bacteria 1811
263 Ga0501071_0005398 3300049587 Bacteria 8209
264 Ga0501071_0104708 3300049587 Bacteria 2088
265 Ga0501071_0152049 3300049587 Unclassified 1727
266 Ga0501072_0058103 3300049588 Bacteria 3049
267 Ga0501072_0159022 3300049588 Bacteria 1802
268 Ga0501072_0337665 3300049588 Unclassified 1197
269 Ga0501072_0581181 3300049588 Bacteria 884
270 Ga0501073_0504432 3300049589 Bacteria 836
271 Ga0501073_0559438 3300049589 Unclassified 790
272 Ga0501074_0003495 3300049590 Bacteria 11156
273 Ga0501074_0263564 3300049590 Bacteria 1225
274 Ga0501074_0381802 3300049590 Bacteria 999
275 Ga0501075_0178172 3300049591 Bacteria 1622
276 Ga0501075_0248185 3300049591 Bacteria 1357
277 Ga0501075_0255679 3300049591 Bacteria 1335
278 Ga0501075_0361707 3300049591 Bacteria 1106
279 Ga0501075_0699526 3300049591 Bacteria 772
280 Ga0501076_0027764 3300049592 Bacteria 4389
281 Ga0501076_0118045 3300049592 Bacteria 2147
282 Ga0501076_0183757 3300049592 Bacteria 1705
283 Ga0501076_0191436 3300049592 Bacteria 1669
284 Ga0501076_0257607 3300049592 Bacteria 1428
285 Ga0501076_0428869 3300049592 Bacteria 1088
286 Ga0501076_0845203 3300049592 Bacteria 755
287 Ga0501077_0019831 3300049593 Bacteria 4253
288 Ga0501077_0074666 3300049593 Bacteria 2147
289 Ga0501077_0238620 3300049593 Bacteria 1155
290 Ga0501199_020227 3300049650 Bacteria 769
291 Ga0501209_002661 3300049656 Unclassified 2802
292 Ga0501216_079334 3300049660 Bacteria 692
293 Ga0501235_021677 3300049669 Bacteria 1428
294 Ga0501242_024054 3300049674 Bacteria 797
295 Ga0501247_002431 3300049677 Bacteria 1935
296 Ga0501249_010872 3300049679 Bacteria 1907
297 Ga0501249_031452 3300049679 Bacteria 1184
298 Ga0501249_044217 3300049679 Bacteria 1014
299 Ga0501257_105762 3300049686 Bacteria 742
300 Ga0501258_015932 3300049687 Bacteria 846
301 Ga0501219_012222 3300049703 Bacteria 663
302 Ga0501221_071108 3300049704 Bacteria 821
303 Ga0501234_013200 3300049707 Bacteria 1296
304 Ga0501079_0001685 3300049741 Bacteria 15715
305 Ga0501079_0023802 3300049741 Bacteria 4699
306 Ga0501079_0056787 3300049741 Bacteria 3021
307 Ga0501079_0428487 3300049741 Bacteria 1038
308 Ga0501079_0774340 3300049741 Bacteria 755
309 Ga0501080_0003750 3300049742 Bacteria 13419
310 Ga0501080_0038680 3300049742 Unclassified 4453
311 Ga0501080_0270310 3300049742 Unclassified 1547
312 Ga0501080_0313196 3300049742 Bacteria 1422
313 Ga0501080_0338007 3300049742 Bacteria 1361
314 Ga0501081_0003218 3300049743 Bacteria 10383
315 Ga0501081_0044540 3300049743 Bacteria 3046
316 Ga0501083_0013881 3300049744 Bacteria 5631
317 Ga0501083_0074730 3300049744 Bacteria 2251
318 Ga0501083_0168956 3300049744 Bacteria 1430
319 Ga0501263_032681 3300049760 Bacteria 740
320 Ga0501265_052667 3300049762 Bacteria 645
321 Ga0501268_000153 3300049765 Bacteria 6226
322 Ga0501268_071098 3300049765 Bacteria 704
323 Ga0501272_007513 3300049769 Bacteria 1182
324 Ga0501273_017591 3300049770 Bacteria 945
325 Ga0501279_019879 3300049775 Bacteria 952
326 Ga0501045_0059936 3300049824 Bacteria 2789
327 Ga0501045_0094958 3300049824 Bacteria 2206
328 Ga0501045_0204841 3300049824 Bacteria 1470
329 Ga0501045_0348240 3300049824 Bacteria 1103
330 Ga0501045_0431522 3300049824 Bacteria 980
331 nmdc:mga05p37_20705_c1 3300050507 Bacteria 7958
332 nmdc:mga05p37_263808_c1 3300050507 Bacteria 2060
333 nmdc:mga05p37_296793_c1 3300050507 Bacteria 1921
334 nmdc:mga05p37_29984_c1 3300050507 Bacteria 6637
335 nmdc:mga05p37_382456_c1 3300050507 Unclassified 1649
336 nmdc:mga05p37_602577_c1 3300050507 Bacteria 1240
337 nmdc:mga09592_1330_c1 3300050508 Bacteria 19792
338 nmdc:mga09592_257662_c1 3300050508 Bacteria 1512
339 nmdc:mga09592_324772_c1 3300050508 Bacteria 1333
340 nmdc:mga09592_69551_c1 3300050508 Bacteria 2986
341 nmdc:mga06r32_182024_c1 3300050510 Bacteria 2087
342 nmdc:mga06r32_23213_c1 3300050510 Bacteria 5737
343 nmdc:mga06r32_277641_c1 3300050510 Bacteria 1662
344 nmdc:mga06r32_357567_c1 3300050510 Bacteria 1444
345 nmdc:mga0n895_1476644_c1 3300050512 Bacteria 647
346 nmdc:mga0n895_280320_c1 3300050512 Bacteria 1690
347 nmdc:mga0n895_33210_c1 3300050512 Bacteria 4957
348 nmdc:mga0n895_48925_c1 3300050512 Bacteria 4141
349 nmdc:mga0n895_85843_c1 3300050512 Bacteria 3143
350 nmdc:mga0rr50_29073_c1 3300050513 Bacteria 3893
351 nmdc:mga0rr50_457827_c1 3300050513 Bacteria 1082
352 nmdc:mga0rr50_465627_c1 3300050513 Bacteria 1072
353 nmdc:mga0rr50_61097_c1 3300050513 Bacteria 2838
354 nmdc:mga0a205_11706_c1 3300050515 Bacteria 8090
355 nmdc:mga0a205_21501_c1 3300050515 Bacteria 6101
356 nmdc:mga0a205_25890_c1 3300050515 Bacteria 5588
357 nmdc:mga0a205_569523_c1 3300050515 Bacteria 987
358 Ga0501084_0011101 3300054114 Bacteria 7461
359 Ga0501084_0046503 3300054114 Bacteria 3636
360 Ga0501084_0113498 3300054114 Bacteria 2278
361 Ga0501084_0174328 3300054114 Bacteria 1815
362 Ga0501084_0638999 3300054114 Bacteria 898
363 Ga0590071_003552 3300059421 Bacteria 3830
364 Ga0590071_023789 3300059421 Bacteria 1450
365 Ga0590074_008532 3300059423 Bacteria 1706
366 Ga0590074_009054 3300059423 Bacteria 1659
367 Ga0590075_066548 3300059424 Bacteria 930
368 Ga0501082_0006480 3300060353 Bacteria 10150
369 Ga0501082_0032076 3300060353 Bacteria 4532
370 Ga0501082_0046777 3300060353 Bacteria 3729
371 Ga0501082_0048557 3300060353 Bacteria 3658
372 Ga0501082_0061531 3300060353 Bacteria 3232
373 Ga0501082_0306160 3300060353 Bacteria 1384
374 Ga0501082_1116435 3300060353 Bacteria 689
375 Ga0501082_1291669 3300060353 Bacteria 637
376 Ga0530510_0106086 3300061734 Bacteria 2056
377 Ga0530510_0795437 3300061734 Bacteria 722
378 Ga0316577_10079358
379 Ga0070676_10114629
380 Ga0070680_100076680
381 Ga0070674_100453503
382 Ga0070673_100152701
383 Ga0070659_100012845
384 Ga0070703_10001631
385 Ga0070705_100011580
386 Ga0070705_100035914
387 Ga0070705_100057744
388 Ga0070705_100112061
389 Ga0070705_100195882
390 Ga0070708_100069645
391 Ga0070663_100356364
392 Ga0070663_100665497
393 Ga0070678_100370317
394 Ga0070662_100528608
395 Ga0070681_10089535
396 Ga0070681_10154848
397 Ga0070681_10566425
398 Ga0068867_101249907
399 Ga0070706_100015330
400 Ga0070706_100079397
401 Ga0070706_101124710
402 Ga0070707_100000266
403 Ga0070707_100001254
404 Ga0070707_100041300
405 Ga0070707_100221730
406 Ga0070707_100330128
407 Ga0070698_100001523
408 Ga0070698_100022587
409 Ga0070698_100044951
410 Ga0070698_100050529
411 Ga0070699_100001124
412 Ga0070699_100012845
413 Ga0070699_100013219
414 Ga0070699_100014427
415 Ga0070699_100021338
416 Ga0070699_100080179
417 Ga0070699_100291387
418 Ga0070679_100092844
419 Ga0070684_100517632
420 Ga0070697_100259803
421 Ga0070697_100346189
422 Ga0070672_100026985
423 Ga0070695_100369429
424 Ga0070695_100542466
425 Ga0070696_100162380
426 Ga0070696_100678946
427 Ga0070704_100000053
428 Ga0070704_100112568
429 Ga0070664_100988633
430 Ga0068857_100500708
431 Ga0070702_100203328
432 Ga0068852_100680624
433 Ga0068859_100009362
434 Ga0068859_100154302
435 Ga0068859_100222054
436 Ga0068862_100674479
437 Ga0068862_100917132
438 Ga0075428_100057131
439 Ga0075428_100367100
440 Ga0075428_101195303
441 Ga0075431_100381000
442 Ga0075431_100737824
443 Ga0075433_10040313
444 Ga0075433_10041739
445 Ga0075433_10271170
446 Ga0075434_100030844
447 Ga0075434_100130539
448 Ga0075434_100130797
449 Ga0075434_100408379
450 Ga0075429_100000196
451 Ga0075429_100136315
452 Ga0075429_100280980
453 Ga0068865_100197659
454 Ga0097620_100009362
455 Ga0097620_100154294
456 Ga0097620_100222054
457 Ga0075435_100200196
458 Ga0075435_100253440
459 Ga0075435_100300371
460 Ga0099794_10145016
461 Ga0111539_10922497
462 Ga0111539_12313578
463 Ga0114129_10000967
464 Ga0114129_10066072
465 Ga0114129_10095755
466 Ga0114129_10137554
467 Ga0114129_10199384
468 Ga0114129_10536617
469 Ga0114129_10942081
470 Ga0105241_10408121
471 Ga0105248_11268062
472 Ga0105249_10256189
473 Ga0105249_10912552
474 Ga0163163_10017523
475 Ga0157379_10087117
476 Ga0207653_10000024
477 Ga0207684_10010611
478 Ga0207684_10057141
479 Ga0207654_10736466
480 Ga0207707_10001068
481 Ga0207707_10591866
482 Ga0207660_10067500
483 Ga0207657_10298744
484 Ga0207652_10112335
485 Ga0207652_10620263
486 Ga0207646_10002204
487 Ga0207646_10012808
488 Ga0207646_10045301
489 Ga0207646_10363923
490 Ga0207659_10216786
491 Ga0207644_10009160
492 Ga0207690_10348412
493 Ga0207706_10345608
494 Ga0207670_10524041
495 Ga0207669_10414215
496 Ga0207704_10517551
497 Ga0207691_10086892
498 Ga0207711_10862089
499 Ga0207639_10920570
500 Ga0207678_10061526
501 Ga0207678_10374154
502 Ga0207708_10048892
503 Ga0207708_10399411
504 Ga0207674_10248574
505 Ga0207683_10568332
506 Ga0207698_10517907
507 Ga0209983_1008040
508 Ga0209974_10024347
509 Ga0209974_10259491
510 Ga0207428_10296082
511 Ga0268265_10201986
512 Ga0268264_10573900
513 Ga0307408_100008565
514 Ga0307408_100055608
515 Ga0307408_100138703
516 Ga0316575_10173868
517 Ga0316579_10014691
518 Ga0316579_10076029
519 Ga0307405_10022172
520 Ga0307405_10182541
521 Ga0307405_10240360
522 Ga0307413_10014693
523 Ga0307413_10043090
524 Ga0307413_10049271
525 Ga0307413_10231142
526 Ga0307413_10651818
527 Ga0307410_10017253
528 Ga0307410_10033341
529 Ga0307410_10046668
530 Ga0307410_10051583
531 Ga0307410_10056898
532 Ga0307410_10060429
533 Ga0307410_10147676
534 Ga0307410_10237618
535 Ga0307406_10060258
536 Ga0307406_10085878
537 Ga0307406_10101696
538 Ga0307406_10187837
539 Ga0307406_10328303
540 Ga0307407_10036728
541 Ga0307407_10070057
542 Ga0307407_10167190
543 Ga0307407_10240521
544 Ga0307407_10671103
545 Ga0307407_10732135
546 Ga0307412_10016507
547 Ga0307412_10521535
548 Ga0307409_100004334
549 Ga0307409_100008556
550 Ga0307409_100035204
551 Ga0307409_100118005
552 Ga0307409_100235966
553 Ga0307409_100268742
554 Ga0307409_100372018
555 Ga0307409_101505105
556 Ga0307416_100002674
557 Ga0307416_100004930
558 Ga0307416_100008182
559 Ga0307416_100011313
560 Ga0307416_100031607
561 Ga0307416_100047575
562 Ga0307416_100079303
563 Ga0307414_10022341
564 Ga0307414_10086928
565 Ga0307414_10099728
566 Ga0307414_10374510
567 Ga0307414_10521399
568 Ga0307411_10004102
569 Ga0307411_10006743
570 Ga0307411_10137181
571 Ga0307411_10213637
572 Ga0307411_10242672
573 Ga0307411_10302263
574 Ga0307415_100112854
575 Ga0307415_100288968
576 Ga0307415_101527775
577 Ga0307415_101603915
578 Ga0316583_10009543
579 Ga0373961_0163074
580 Ga0373937_0564488
581 Ga0316582_0034422
582 Ga0316582_0075494
583 Ga0316581_0058405
584 Ga0400489_88973
585 Ga0439446_0026034
586 Ga0439434_0042915
587 Ga0451577_1116045
588 Ga0453683_0100260
589 Ga0453684_0204460
590 Ga0451576_0022259
591 Ga0451576_0108508
592 Ga0451576_0392494
593 Ga0466967_0748769
594 Ga0495582_0018766
595 Ga0495664_0013087
596 Ga0495594_0035504
597 Ga0495666_0100304
598 Ga0495621_0143616
599 Ga0495667_0565698
600 Ga0495647_0049686
601 Ga0495658_0032598
602 Ga0495581_0253678
603 Ga0496102_1378602
604 Ga0496103_0118469
605 Ga0496108_0868900
606 Ga0496109_0919913
607 Ga0496110_0088515
608 Ga0496110_0580333
609 Ga0501296_021593
610 Ga0501298_015842
611 Ga0501299_027069
612 Ga0501299_144407
613 Ga0501031_0070189
614 Ga0501032_0425644
615 Ga0501033_0094387
616 Ga0501033_0249991
617 Ga0501034_0213298
618 Ga0501036_0110368
619 Ga0501036_1049254
620 Ga0501037_0090039
621 Ga0501038_0086321
622 Ga0501038_0336758
623 Ga0501040_0180076
624 Ga0501041_0065091
625 Ga0501041_0084139
626 Ga0501042_0052940
627 Ga0501042_0246300
628 Ga0501043_0947407
629 Ga0501046_0069236
630 Ga0501046_0282603
631 Ga0501047_0183444
632 Ga0501048_0103308
633 Ga0501067_0005132
634 Ga0501068_0004432
635 Ga0501068_0180720
636 Ga0501068_0209892
637 Ga0501069_0000944
638 Ga0501069_0119906
639 Ga0501070_0167385
640 Ga0501071_0005398
641 Ga0501071_0104708
642 Ga0501071_0152049
643 Ga0501072_0058103
644 Ga0501072_0159022
645 Ga0501072_0337665
646 Ga0501072_0581181
647 Ga0501073_0504432
648 Ga0501073_0559438
649 Ga0501074_0003495
650 Ga0501074_0263564
651 Ga0501074_0381802
652 Ga0501075_0178172
653 Ga0501075_0248185
654 Ga0501075_0255679
655 Ga0501075_0361707
656 Ga0501075_0699526
657 Ga0501076_0027764
658 Ga0501076_0118045
659 Ga0501076_0183757
660 Ga0501076_0191436
661 Ga0501076_0257607
662 Ga0501076_0428869
663 Ga0501076_0845203
664 Ga0501077_0019831
665 Ga0501077_0074666
666 Ga0501077_0238620
667 Ga0501199_020227
668 Ga0501209_002661
669 Ga0501216_079334
670 Ga0501235_021677
671 Ga0501242_024054
672 Ga0501247_002431
673 Ga0501249_010872
674 Ga0501249_031452
675 Ga0501249_044217
676 Ga0501257_105762
677 Ga0501258_015932
678 Ga0501219_012222
679 Ga0501221_071108
680 Ga0501234_013200
681 Ga0501079_0001685
682 Ga0501079_0023802
683 Ga0501079_0056787
684 Ga0501079_0428487
685 Ga0501079_0774340
686 Ga0501080_0003750
687 Ga0501080_0038680
688 Ga0501080_0270310
689 Ga0501080_0313196
690 Ga0501080_0338007
691 Ga0501081_0003218
692 Ga0501081_0044540
693 Ga0501083_0013881
694 Ga0501083_0074730
695 Ga0501083_0168956
696 Ga0501263_032681
697 Ga0501265_052667
698 Ga0501268_000153
699 Ga0501268_071098
700 Ga0501272_007513
701 Ga0501273_017591
702 Ga0501279_019879
703 Ga0501045_0059936
704 Ga0501045_0094958
705 Ga0501045_0204841
706 Ga0501045_0348240
707 Ga0501045_0431522
708 nmdc:mga05p37_20705_c1
709 nmdc:mga05p37_263808_c1
710 nmdc:mga05p37_296793_c1
711 nmdc:mga05p37_29984_c1
712 nmdc:mga05p37_382456_c1
713 nmdc:mga05p37_602577_c1
714 nmdc:mga09592_1330_c1
715 nmdc:mga09592_257662_c1
716 nmdc:mga09592_324772_c1
717 nmdc:mga09592_69551_c1
718 nmdc:mga06r32_182024_c1
719 nmdc:mga06r32_23213_c1
720 nmdc:mga06r32_277641_c1
721 nmdc:mga06r32_357567_c1
722 nmdc:mga0n895_1476644_c1
723 nmdc:mga0n895_280320_c1
724 nmdc:mga0n895_33210_c1
725 nmdc:mga0n895_48925_c1
726 nmdc:mga0n895_85843_c1
727 nmdc:mga0rr50_29073_c1
728 nmdc:mga0rr50_457827_c1
729 nmdc:mga0rr50_465627_c1
730 nmdc:mga0rr50_61097_c1
731 nmdc:mga0a205_11706_c1
732 nmdc:mga0a205_21501_c1
733 nmdc:mga0a205_25890_c1
734 nmdc:mga0a205_569523_c1
735 Ga0501084_0011101
736 Ga0501084_0046503
737 Ga0501084_0113498
738 Ga0501084_0174328
739 Ga0501084_0638999
740 Ga0590071_003552
741 Ga0590071_023789
742 Ga0590074_008532
743 Ga0590074_009054
744 Ga0590075_066548
745 Ga0501082_0006480
746 Ga0501082_0032076
747 Ga0501082_0046777
748 Ga0501082_0048557
749 Ga0501082_0061531
750 Ga0501082_0306160
751 Ga0501082_1116435
752 Ga0501082_1291669
753 Ga0530510_0106086
754 Ga0530510_0795437

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04011

LemA

LemA family

39

198

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.9242 23 175
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.9053 23 175
3l3o-assembly1.cif.gz_M staphylococcal complement inhibitor (scin) in complex with human complement component c3c 0.8402 35 110
4h6i-assembly1.cif.gz_A crystal structure of staphylococcal complement inhibitor scin-b 0.7645 47 108
3l3o-assembly1.cif.gz_M staphylococcal complement inhibitor (scin) in complex with human complement component c3c 0.7341 35 110
ID Description Score Start End Superfamily
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8542 16 186 1.20.1440.20
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8404 16 186 1.20.1440.20
2winM00 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.8291 34 109 1.20.1270.10
af_Q2FWV6_32_113_1.20.1270.10 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.8112 33 105 1.20.1270.10
4h6iA00 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.7645 47 108 1.20.1270.10
ID Description Score Start End GO Terms
AF-A0A1A3TAW2-F1-model_v4 LemA family protein 0.9736 31 173 GO:0016020
AF-A0A2D8BDX5-F1-model_v4 LemA family protein 0.9714 4 160 GO:0016020
AF-A0A257YBN4-F1-model_v4 LemA family protein 0.9688 4 173 GO:0016020
AF-A0A6V8DQF4-F1-model_v4 LemA family protein 0.9632 3 173 GO:0016020
AF-A0A2H0FCN0-F1-model_v4 LemA family protein 0.9579 1 173 GO:0016020

Map