F427708

General Info

Members Datasets Scaffolds Average Seq Length
377 272 343 305

Family's Representative Sequence

Representative Sequence 3300025898|Ga0207692_10114911|Ga0207692_101149112
Length 360
Sequence MDAPAPRRSRFAGGPAGKGIRVSFEFFPPKTAEMERTLWESIERLAPLAPAFVSVTYGAGGTTRERTHATVKRILAETALVPAAHLTCVAATRAEIDDVIRAYHAAGVRHIVALRGDPTGGAGERYAPHPGGYANGADLAAGIRRIADVEVSVSAYPEKHPDSATVEADVDMLKAKVDAGATRAITQFFFENDLYFRYLERVRARGISIPIVPGILPVQNFKQTKSFAQRCGASVPRWLAERFDGLEEDAATRKLIAAAVAAEQVLDLVDQGVSDFHFYTMNRADLVYAVCHLLGLRPSQPAEVPLHLPLEGGGRPAEGRSGGGDLSVKSAPSASPHPAAFGGDPPPPGEGKARVGSVDV

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
3 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
4 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
5 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
6 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
7 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
8 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
9 2643221733 Bosea sp. Root381 Isolate Unclassified
10 2643221736 Bosea sp. Root483D1 Isolate Unclassified
11 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
12 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
13 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
14 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
15 2818991467 Bosea vestrisii 3192 Isolate Unclassified
16 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
17 2851182111 Bosea sp. Tri-44 Isolate Nodule
18 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
19 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
20 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
21 2902330777 Methylobacterium sp. 2A Isolate Unclassified
22 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
23 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
24 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
25 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
26 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
27 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
28 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
29 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
127 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
257 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
258 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
262 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
263 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 641522639 Methylobacterium sp. 4-46 Isolate Nodule
267 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
268 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
269 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
270 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
271 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
272 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.98
Metatranscriptomes 0
Isolates 9.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.08
Nodule 2.12
Rhizoplane 6.1
Rhizosphere 71.62
Stem 0
Stem Tuber 0
Unclassified 10.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1001244 3300003214 Bacteria 15085
2 JGI25161J50226_1000001 3300003374 Bacteria 655036
3 Ga0055526_1000470 3300003771 Bacteria 32053
4 Ga0055543_1000003 3300004625 Bacteria 358656
5 Ga0065165_1000068 3300005262 Bacteria 170609
6 Ga0065165_1000095 3300005262 Bacteria 145470
7 Ga0070658_10021925 3300005327 Bacteria 5123
8 Ga0070690_100209917 3300005330 Bacteria 1359
9 Ga0070689_100467610 3300005340 Bacteria 1075
10 Ga0070688_100169637 3300005365 Bacteria 1505
11 Ga0070667_100557800 3300005367 Bacteria 1053
12 Ga0070714_100590296 3300005435 Bacteria 1066
13 Ga0070713_100312458 3300005436 Bacteria 1449
14 Ga0070713_100546273 3300005436 Bacteria 1097
15 Ga0070711_100090147 3300005439 Bacteria 2207
16 Ga0070681_10009006 3300005458 Bacteria 9813
17 Ga0070699_100002544 3300005518 Bacteria 16387
18 Ga0070679_100035173 3300005530 Bacteria 4969
19 Ga0070679_100136822 3300005530 Bacteria 2431
20 Ga0070679_100159256 3300005530 Bacteria 2232
21 Ga0070684_100537819 3300005535 Bacteria 1084
22 Ga0070686_100120053 3300005544 Bacteria 1804
23 Ga0070665_100158996 3300005548 Bacteria 2261
24 Ga0070665_100172644 3300005548 Bacteria 2163
25 Ga0068856_100129308 3300005614 Bacteria 2530
26 Ga0068852_100010243 3300005616 Bacteria 6992
27 Ga0068852_100450035 3300005616 Bacteria 1275
28 Ga0068859_100661351 3300005617 Bacteria 1136
29 Ga0068864_100108747 3300005618 Bacteria 2467
30 Ga0081538_10004081 3300005981 Bacteria 13578
31 Ga0081540_1006311 3300005983 Bacteria 8672
32 Ga0070717_10081393 3300006028 Bacteria 2718
33 Ga0070717_10160166 3300006028 Bacteria 1952
34 Ga0075368_10019579 3300006042 Bacteria 2556
35 Ga0075363_100039650 3300006048 Bacteria 2479
36 Ga0075363_100041697 3300006048 Bacteria 2422
37 Ga0075364_10048144 3300006051 Bacteria 2778
38 Ga0075367_10035810 3300006178 Bacteria 2875
39 Ga0075366_10001094 3300006195 Bacteria 13300
40 Ga0075366_10090771 3300006195 Bacteria 1830
41 Ga0075370_10059814 3300006353 Bacteria 2169
42 Ga0075428_100058332 3300006844 Bacteria 4226
43 Ga0075430_100098092 3300006846 Bacteria 2448
44 Ga0075431_100013035 3300006847 Bacteria 8397
45 Ga0075431_100014199 3300006847 Bacteria 8054
46 Ga0075434_100046956 3300006871 Bacteria 4285
47 Ga0075434_100175666 3300006871 Bacteria 2162
48 Ga0075429_100009950 3300006880 Bacteria 8240
49 Ga0075436_100033938 3300006914 Bacteria 3517
50 Ga0075436_100151934 3300006914 Bacteria 1630
51 Ga0097620_100661340 3300006931 Bacteria 1136
52 Ga0075435_100013550 3300007076 Bacteria 6070
53 Ga0075435_100597371 3300007076 Bacteria 957
54 Ga0105240_10000076 3300009093 Bacteria 198848
55 Ga0111539_10038593 3300009094 Bacteria 5762
56 Ga0111539_10042795 3300009094 Bacteria 5435
57 Ga0111539_10509468 3300009094 Bacteria 1402
58 Ga0105245_10206565 3300009098 Bacteria 1888
59 Ga0114129_10028068 3300009147 Bacteria 7973
60 Ga0114129_10051885 3300009147 Bacteria 5757
61 Ga0105237_10000226 3300009545 Bacteria 79798
62 Ga0105238_10056074 3300009551 Bacteria 3953
63 Ga0105239_10010871 3300010375 Bacteria 10170
64 Ga0157373_10236881 3300013100 Bacteria 1290
65 Ga0157370_10001902 3300013104 Bacteria 25703
66 Ga0171462_1006 3300013250 Bacteria 432986
67 Ga0157380_10551379 3300014326 Bacteria 1131
68 Ga0182008_10017301 3300014497 Bacteria 3742
69 Ga0182007_10001912 3300015262 Bacteria 10815
70 Ga0213873_10059687 3300021358 Bacteria 1029
71 Ga0213872_10028624 3300021361 Bacteria 2555
72 Ga0213876_10000302 3300021384 Bacteria 44239
73 Ga0213876_10046909 3300021384 Bacteria 2284
74 Ga0213875_10003032 3300021388 Bacteria 9740
75 Ga0228598_1028921 3300024227 Bacteria 1090
76 Ga0209437_100051 3300025233 Bacteria 392523
77 Ga0209677_101110 3300025253 Bacteria 12626
78 Ga0209233_1000113 3300025261 Bacteria 253455
79 Ga0209233_1000148 3300025261 Bacteria 185135
80 Ga0209130_1000003 3300025284 Bacteria 677988
81 Ga0209130_1000117 3300025284 Bacteria 129338
82 Ga0209564_1000065 3300025295 Bacteria 315205
83 Ga0207426_1000011 3300025302 Bacteria 791203
84 Ga0207426_1045457 3300025302 Bacteria 1335
85 Ga0207692_10052211 3300025898 Bacteria 2077
86 Ga0207692_10114911 3300025898 Bacteria 1498
87 Ga0207707_10083570 3300025912 Bacteria 2788
88 Ga0207707_10146627 3300025912 Bacteria 2063
89 Ga0207695_10000011 3300025913 Bacteria 910221
90 Ga0207671_10000093 3300025914 Bacteria 138939
91 Ga0207693_10026377 3300025915 Bacteria 4598
92 Ga0207657_10070231 3300025919 Bacteria 2969
93 Ga0207652_10064717 3300025921 Bacteria 3164
94 Ga0207652_10123221 3300025921 Bacteria 2308
95 Ga0207652_10259092 3300025921 Bacteria 1569
96 Ga0207694_10055758 3300025924 Bacteria 3068
97 Ga0207659_10068166 3300025926 Bacteria 2587
98 Ga0207665_10032792 3300025939 Bacteria 3439
99 Ga0207665_10070432 3300025939 Bacteria 2386
100 Ga0207665_10142625 3300025939 Bacteria 1710
101 Ga0207667_10010788 3300025949 Bacteria 10657
102 Ga0207667_10160615 3300025949 Bacteria 2311
103 Ga0207668_10060129 3300025972 Bacteria 2666
104 Ga0207703_10286976 3300026035 Bacteria 1497
105 Ga0207639_10108846 3300026041 Bacteria 2254
106 Ga0207639_10258479 3300026041 Bacteria 1522
107 Ga0207678_10043067 3300026067 Bacteria 3907
108 Ga0207702_10096520 3300026078 Bacteria 2600
109 Ga0207676_10206482 3300026095 Bacteria 1739
110 Ga0207698_10011952 3300026142 Bacteria 5656
111 Ga0209813_10013430 3300027866 Bacteria 2186
112 Ga0209813_10057589 3300027866 Bacteria 1233
113 Ga0207428_10023244 3300027907 Bacteria 5215
114 Ga0268266_10047160 3300028379 Bacteria 3690
115 Ga0268266_10215604 3300028379 Bacteria 1762
116 Ga0268264_10132527 3300028381 Bacteria 2211
117 Ga0265338_10069935 3300028800 Bacteria 3013
118 Ga0265332_10002231 3300031238 Bacteria 9936
119 Ga0265325_10001240 3300031241 Bacteria 18214
120 Ga0265329_10028904 3300031242 Bacteria 1815
121 Ga0265340_10001326 3300031247 Bacteria 14185
122 Ga0265339_10003257 3300031249 Bacteria 11376
123 Ga0307513_10180192 3300031456 Bacteria 1977
124 Ga0307513_10208948 3300031456 Bacteria 1785
125 Ga0265313_10000339 3300031595 Bacteria 50809
126 Ga0265313_10039084 3300031595 Bacteria 2356
127 Ga0265342_10000085 3300031712 Bacteria 100652
128 Ga0265342_10001313 3300031712 Bacteria 23333
129 Ga0373934_0082246 3300035086 Bacteria 1294
130 Ga0373923_0001153 3300035111 Bacteria 7339
131 Ga0373923_0037797 3300035111 Bacteria 1976
132 Ga0373936_0021447 3300035113 Bacteria 2512
133 Ga0373954_0014893 3300035118 Bacteria 3470
134 Ga0373956_0031263 3300035119 Bacteria 2332
135 Ga0373943_0002264 3300035170 Bacteria 8732
136 Ga0373946_0033953 3300035171 Bacteria 2056
137 Ga0373946_0118103 3300035171 Bacteria 1208
138 Ga0373955_0001945 3300035172 Bacteria 8902
139 Ga0373961_0019115 3300035241 Bacteria 1796
140 Ga0316574_0085545 3300035398 Bacteria 2006
141 Ga0373927_0004428 3300035695 Bacteria 9839
142 Ga0373927_0007268 3300035695 Bacteria 7511
143 Ga0373933_0001366 3300035724 Bacteria 14367
144 Ga0373933_0146364 3300035724 Bacteria 1494
145 Ga0373947_0162853 3300035725 Bacteria 1443
146 Ga0373937_0000068 3300036401 Bacteria 94138
147 Ga0316582_0028902 3300036647 Bacteria 3363
148 Ga0373925_0000295 3300037068 Bacteria 52150
149 Ga0373925_0279841 3300037068 Bacteria 1343
150 Ga0395900_0269966 3300037418 Bacteria 1696
151 Ga0395898_0091074 3300037466 Bacteria 2934
152 Ga0436364_0216228 3300037853 Bacteria 11956
153 Ga0436364_0824955 3300037853 Bacteria 1411
154 Ga0436364_1012628 3300037853 Bacteria 4786
155 Ga0436365_0889526 3300039437 Bacteria 1813
156 Ga0436365_0918625 3300039437 Bacteria 13649
157 Ga0436365_1130377 3300039437 Bacteria 1285
158 Ga0436365_1179379 3300039437 Bacteria 4719
159 Ga0436365_1205523 3300039437 Bacteria 29367
160 Ga0436360_1229371 3300039438 Bacteria 1131
161 Ga0436361_0423100 3300039447 Bacteria 5370
162 Ga0436363_0268732 3300039450 Bacteria 6549
163 Ga0436363_0686830 3300039450 Bacteria 13837
164 Ga0436362_1050412 3300039453 Bacteria 1389
165 Ga0439461_0034813 3300041410 Bacteria 1065
166 Ga0466963_0076370 3300044694 Bacteria 2262
167 Ga0453684_0221093 3300044712 Bacteria 2194
168 Ga0466968_0021987 3300044735 Bacteria 2588
169 Ga0451576_0011121 3300045051 Bacteria 10267
170 Ga0495592_0000793 3300046454 Bacteria 21835
171 Ga0495592_0193638 3300046454 Bacteria 1376
172 Ga0495592_0237398 3300046454 Bacteria 1211
173 Ga0495638_0048121 3300046460 Bacteria 2670
174 Ga0495651_0236090 3300046462 Bacteria 1256
175 Ga0495653_0000947 3300046463 Bacteria 22293
176 Ga0495653_0066604 3300046463 Bacteria 2708
177 Ga0495662_0032699 3300046476 Bacteria 2514
178 Ga0495664_0000060 3300046477 Bacteria 52213
179 Ga0495584_0139488 3300046491 Bacteria 1231
180 Ga0495608_0000308 3300046511 Bacteria 34379
181 Ga0495608_0103010 3300046511 Bacteria 1839
182 Ga0495610_0070828 3300046512 Bacteria 1627
183 Ga0495618_0000792 3300046514 Bacteria 22077
184 Ga0495628_0000005 3300046516 Bacteria 420969
185 Ga0495630_0002182 3300046517 Bacteria 13641
186 Ga0495642_0115063 3300046528 Bacteria 1152
187 Ga0495652_0000897 3300046529 Bacteria 34143
188 Ga0495652_0200552 3300046529 Bacteria 1514
189 Ga0495665_0077852 3300046531 Bacteria 1745
190 Ga0495640_0000027 3300046533 Bacteria 90638
191 Ga0495640_0240481 3300046533 Bacteria 1136
192 Ga0495587_0000230 3300046536 Bacteria 41395
193 Ga0495587_0104459 3300046536 Bacteria 1630
194 Ga0495645_0000239 3300046543 Bacteria 40105
195 Ga0495645_0054290 3300046543 Bacteria 2911
196 Ga0495622_0031254 3300046557 Bacteria 2489
197 Ga0495667_0000660 3300046559 Bacteria 22055
198 Ga0495667_0099657 3300046559 Bacteria 1880
199 Ga0495634_0000696 3300046642 Bacteria 32694
200 Ga0495625_0283272 3300046660 Bacteria 1066
201 Ga0495635_0000019 3300046663 Bacteria 193402
202 Ga0495657_0015672 3300046675 Bacteria 5540
203 Ga0495657_0130945 3300046675 Bacteria 1571
204 Ga0495599_0000051 3300046678 Bacteria 81853
205 Ga0495599_0026100 3300046678 Bacteria 3660
206 Ga0495623_0003794 3300046679 Bacteria 9955
207 Ga0495623_0134228 3300046679 Bacteria 1478
208 Ga0495646_0000455 3300046680 Bacteria 21674
209 Ga0495647_0132350 3300046681 Bacteria 1058
210 Ga0495613_0082987 3300046689 Bacteria 2327
211 Ga0495613_0103086 3300046689 Bacteria 2060
212 Ga0495600_0001448 3300046809 Bacteria 13154
213 Ga0495604_0000507 3300047317 Bacteria 34224
214 Ga0495674_0000580 3300047319 Bacteria 34223
215 Ga0495672_0072678 3300047320 Bacteria 1942
216 Ga0495680_0000216 3300047322 Bacteria 62986
217 Ga0495680_0069817 3300047322 Bacteria 2679
218 Ga0495675_0003127 3300047444 Bacteria 9936
219 Ga0495675_0025384 3300047444 Bacteria 3778
220 Ga0495684_0001079 3300047471 Bacteria 22061
221 Ga0495686_0138350 3300047472 Bacteria 1439
222 Ga0495593_0115047 3300047673 Bacteria 1371
223 Ga0495602_0001686 3300048088 Bacteria 22004
224 Ga0495602_0038276 3300048088 Bacteria 4438
225 Ga0496100_0039046 3300048903 Bacteria 3012
226 Ga0496100_0087020 3300048903 Bacteria 2124
227 Ga0496100_0271029 3300048903 Bacteria 1262
228 Ga0496102_0047061 3300048905 Bacteria 3918
229 Ga0496102_0248495 3300048905 Bacteria 1677
230 Ga0496103_0002316 3300048906 Bacteria 12042
231 Ga0496104_0011395 3300048907 Bacteria 7960
232 Ga0496104_0138198 3300048907 Bacteria 2341
233 Ga0496105_0038949 3300048908 Bacteria 3917
234 Ga0496105_0041017 3300048908 Bacteria 3815
235 Ga0496105_0255098 3300048908 Bacteria 1420
236 Ga0496108_0002927 3300048911 Bacteria 13724
237 Ga0496108_0063091 3300048911 Bacteria 3120
238 Ga0496109_0081733 3300048912 Bacteria 2977
239 Ga0496110_0035562 3300048913 Bacteria 4322
240 Ga0496110_0109567 3300048913 Bacteria 2480
241 Ga0496111_0023641 3300048914 Bacteria 4317
242 Ga0496112_0018082 3300048915 Bacteria 6632
243 Ga0496112_0191913 3300048915 Bacteria 2004
244 Ga0496113_0072378 3300048916 Bacteria 2623
245 Ga0496115_0116477 3300048918 Bacteria 2198
246 Ga0496115_0123176 3300048918 Bacteria 2134
247 Ga0496117_0016063 3300048920 Bacteria 6339
248 Ga0496118_0018301 3300048921 Bacteria 6325
249 Ga0496119_0026781 3300048922 Bacteria 3985
250 Ga0496119_0085978 3300048922 Bacteria 1799
251 Ga0496120_0013309 3300048923 Bacteria 5545
252 Ga0496121_0002536 3300048924 Bacteria 27686
253 Ga0496121_0060956 3300048924 Bacteria 3099
254 Ga0496121_0245246 3300048924 Bacteria 1246
255 Ga0496122_0014566 3300048925 Bacteria 7591
256 Ga0496123_0031546 3300048926 Bacteria 3853
257 Ga0496125_0062114 3300048928 Bacteria 2990
258 Ga0501031_0022543 3300049568 Bacteria 4103
259 Ga0501032_0016809 3300049569 Bacteria 5141
260 Ga0501032_0116363 3300049569 Bacteria 1768
261 Ga0501033_0155394 3300049570 Bacteria 1648
262 Ga0501034_0009766 3300049571 Bacteria 10035
263 Ga0501034_0187701 3300049571 Bacteria 2030
264 Ga0501034_0236590 3300049571 Bacteria 1774
265 Ga0501036_0028601 3300049572 Bacteria 4710
266 Ga0501036_0088713 3300049572 Bacteria 2613
267 Ga0501036_0406109 3300049572 Bacteria 1136
268 Ga0501037_0010384 3300049573 Bacteria 6831
269 Ga0501038_0102116 3300049574 Bacteria 2387
270 Ga0501039_0161475 3300049575 Bacteria 1761
271 Ga0501040_0079804 3300049576 Bacteria 2266
272 Ga0501042_0040746 3300049578 Bacteria 3301
273 Ga0501042_0066368 3300049578 Bacteria 2579
274 Ga0501043_0085584 3300049579 Bacteria 2477
275 Ga0501046_0015453 3300049580 Bacteria 6411
276 Ga0501046_0282841 3300049580 Bacteria 1215
277 Ga0501047_0038580 3300049581 Bacteria 4621
278 Ga0501047_0213261 3300049581 Bacteria 1789
279 Ga0501048_0034030 3300049582 Bacteria 3679
280 Ga0501048_0040364 3300049582 Bacteria 3345
281 Ga0501067_0015693 3300049583 Bacteria 4191
282 Ga0501068_0098147 3300049584 Bacteria 1813
283 Ga0501069_0003901 3300049585 Bacteria 7689
284 Ga0501069_0012902 3300049585 Bacteria 4450
285 Ga0501070_0002160 3300049586 Bacteria 17289
286 Ga0501070_0059435 3300049586 Bacteria 3169
287 Ga0501070_0060615 3300049586 Bacteria 3136
288 Ga0501071_0156905 3300049587 Bacteria 1699
289 Ga0501072_0002952 3300049588 Bacteria 12805
290 Ga0501072_0211411 3300049588 Bacteria 1546
291 Ga0501073_0023648 3300049589 Bacteria 4409
292 Ga0501074_0029776 3300049590 Bacteria 3955
293 Ga0501075_0027061 3300049591 Bacteria 4225
294 Ga0501076_0005769 3300049592 Bacteria 8929
295 Ga0501076_0308285 3300049592 Bacteria 1298
296 Ga0501079_0412809 3300049741 Bacteria 1059
297 Ga0501080_0166089 3300049742 Bacteria 2037
298 Ga0501035_0010586 3300049822 Bacteria 8542
299 Ga0501035_0025828 3300049822 Bacteria 5382
300 Ga0501035_0116053 3300049822 Bacteria 2343
301 Ga0501035_0129343 3300049822 Bacteria 2202
302 Ga0501035_0130140 3300049822 Bacteria 2194
303 Ga0501035_0319745 3300049822 Bacteria 1304
304 Ga0501044_0000266 3300049823 Bacteria 66205
305 Ga0501044_0115453 3300049823 Bacteria 2690
306 Ga0501044_0118582 3300049823 Bacteria 2649
307 Ga0501044_0335814 3300049823 Bacteria 1433
308 Ga0501045_0162572 3300049824 Bacteria 1662
309 nmdc:mga03n38_64956_c1 3300050490 Bacteria 1672
310 nmdc:mga0k408_39782_c1 3300050493 Bacteria 2704
311 nmdc:mga0k408_88599_c1 3300050493 Bacteria 1817
312 nmdc:mga06z11_31660_c1 3300050494 Bacteria 2572
313 nmdc:mga04h51_3186_c1 3300050495 Bacteria 3963
314 nmdc:mga05p37_20108_c1 3300050507 Bacteria 8080
315 nmdc:mga05p37_590935_c1 3300050507 Bacteria 1255
316 nmdc:mga09592_17706_c1 3300050508 Bacteria 5839
317 nmdc:mga0qj67_19969_c1 3300050509 Bacteria 5127
318 nmdc:mga06r32_172646_c1 3300050510 Bacteria 2146
319 nmdc:mga06r32_2759_c1 3300050510 Bacteria 15722
320 nmdc:mga08y16_12994_c1 3300050511 Bacteria 8762
321 nmdc:mga08y16_194050_c1 3300050511 Bacteria 2106
322 nmdc:mga08y16_384905_c1 3300050511 Bacteria 1437
323 nmdc:mga0n895_287381_c1 3300050512 Bacteria 1667
324 nmdc:mga0n895_84562_c1 3300050512 Bacteria 3166
325 nmdc:mga0rr50_34660_c1 3300050513 Bacteria 3617
326 nmdc:mga0a205_105251_c1 3300050515 Bacteria 2720
327 nmdc:mga0a205_153901_c1 3300050515 Bacteria 2198
328 Ga0495601_0000146 3300053077 Bacteria 40193
329 Ga0495601_0165367 3300053077 Bacteria 1446
330 Ga0495612_0000030 3300053078 Bacteria 81917
331 Ga0495595_0000098 3300053084 Bacteria 39925
332 Ga0495619_0000238 3300053085 Bacteria 40071
333 Ga0500641_0005203 3300053096 Bacteria 4610
334 Ga0500556_0000511 3300053104 Bacteria 26561
335 Ga0500593_000296 3300053117 Bacteria 20184
336 Ga0500568_0000002 3300053139 Bacteria 880601
337 Ga0500616_0105153 3300053153 Bacteria 1373
338 Ga0500622_0021939 3300053156 Bacteria 3388
339 Ga0500636_0001570 3300053177 Bacteria 12445
340 Ga0500645_041829 3300053730 Bacteria 1353
341 Ga0501084_0103092 3300054114 Bacteria 2396
342 Ga0501082_0132305 3300060353 Bacteria 2164
343 Ga0501082_0500181 3300060353 Bacteria 1062

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10032792 Ga0207665_100327922 276
2 3300049569 Ga0501032_0116363 Ga0501032_0116363_518_1432 279
3 3300049571 Ga0501034_0187701 Ga0501034_0187701_984_1898 279
4 3300049572 Ga0501036_0028601 Ga0501036_0028601_2407_3321 279
5 3300049579 Ga0501043_0085584 Ga0501043_0085584_380_1294 279
6 3300049581 Ga0501047_0038580 Ga0501047_0038580_932_1846 279
7 3300049586 Ga0501070_0059435 Ga0501070_0059435_2090_3004 279
8 3300049822 Ga0501035_0116053 Ga0501035_0116053_232_1146 279
9 3300049823 Ga0501044_0118582 Ga0501044_0118582_1402_2316 279
10 3300035171 Ga0373946_0118103 Ga0373946_0118103_163_1104 280
11 3300028381 Ga0268264_10132527 Ga0268264_101325272 285
12 3300035725 Ga0373947_0162853 Ga0373947_0162853_23_913 286
13 3300046681 Ga0495647_0132350 Ga0495647_0132350_23_913 286
14 3300046528 Ga0495642_0115063 Ga0495642_0115063_116_991 288
15 3300046557 Ga0495622_0031254 Ga0495622_0031254_1331_2206 288
16 3300005458 Ga0070681_10009006 Ga0070681_100090068 289
17 3300005530 Ga0070679_100035173 Ga0070679_1000351734 289
18 3300005544 Ga0070686_100120053 Ga0070686_1001200532 289
19 3300025302 Ga0207426_1045457 Ga0207426_10454572 289
20 3300025912 Ga0207707_10146627 Ga0207707_101466271 289
21 3300025921 Ga0207652_10064717 Ga0207652_100647172 289
22 3300031241 Ga0265325_10001240 Ga0265325_100012407 289
23 3300035241 Ga0373961_0019115 Ga0373961_0019115_406_1275 289
24 3300048918 Ga0496115_0123176 Ga0496115_0123176_1165_2034 289
25 3300048924 Ga0496121_0245246 Ga0496121_0245246_320_1222 289
26 3300049568 Ga0501031_0022543 Ga0501031_0022543_2989_3858 289
27 3300049569 Ga0501032_0016809 Ga0501032_0016809_4036_4905 289
28 3300049570 Ga0501033_0155394 Ga0501033_0155394_223_1092 289
29 3300049573 Ga0501037_0010384 Ga0501037_0010384_1105_1974 289
30 3300049574 Ga0501038_0102116 Ga0501038_0102116_1281_2150 289
31 3300049575 Ga0501039_0161475 Ga0501039_0161475_580_1449 289
32 3300049578 Ga0501042_0066368 Ga0501042_0066368_676_1545 289
33 3300049580 Ga0501046_0015453 Ga0501046_0015453_4259_5128 289
34 3300049580 Ga0501046_0282841 Ga0501046_0282841_83_952 289
35 3300049583 Ga0501067_0015693 Ga0501067_0015693_49_918 289
36 3300049584 Ga0501068_0098147 Ga0501068_0098147_39_908 289
37 3300049585 Ga0501069_0003901 Ga0501069_0003901_6495_7364 289
38 3300049587 Ga0501071_0156905 Ga0501071_0156905_632_1501 289
39 3300049588 Ga0501072_0211411 Ga0501072_0211411_334_1203 289
40 3300049589 Ga0501073_0023648 Ga0501073_0023648_2707_3576 289
41 3300049590 Ga0501074_0029776 Ga0501074_0029776_2253_3122 289
42 3300049592 Ga0501076_0308285 Ga0501076_0308285_349_1218 289
43 3300049822 Ga0501035_0130140 Ga0501035_0130140_237_1106 289
44 3300049823 Ga0501044_0000266 Ga0501044_0000266_13448_14317 289
45 3300049823 Ga0501044_0115453 Ga0501044_0115453_1769_2638 289
46 3300053117 Ga0500593_000296 Ga0500593_000296_4881_5783 289
47 3300053139 Ga0500568_0000002 Ga0500568_0000002_269364_270266 289
48 3300054114 Ga0501084_0103092 Ga0501084_0103092_319_1188 289
49 3300060353 Ga0501082_0132305 Ga0501082_0132305_266_1135 289
50 3300005367 Ga0070667_100557800 Ga0070667_1005578001 290
51 iso_pu_bacteria 2508501050 2508729315 290
52 iso_pu_bacteria 2775506901 2776258733 290
53 3300006048 Ga0075363_100039650 Ga0075363_1000396502 291
54 3300006195 Ga0075366_10001094 Ga0075366_1000109413 291
55 3300026041 Ga0207639_10258479 Ga0207639_102584792 291
56 3300027866 Ga0209813_10057589 Ga0209813_100575892 291
57 3300031238 Ga0265332_10002231 Ga0265332_100022318 291
58 3300031242 Ga0265329_10028904 Ga0265329_100289042 291
59 3300031247 Ga0265340_10001326 Ga0265340_100013269 291
60 3300031249 Ga0265339_10003257 Ga0265339_100032578 291
61 3300031712 Ga0265342_10000085 Ga0265342_1000008556 291
62 3300041410 Ga0439461_0034813 Ga0439461_0034813_10_912 291
63 3300044694 Ga0466963_0076370 Ga0466963_0076370_1066_2025 291
64 3300044712 Ga0453684_0221093 Ga0453684_0221093_637_1536 291
65 3300050493 nmdc:mga0k408_39782_c1 nmdc:mga0k408_39782_c1_1043_1942 291
66 3300053104 Ga0500556_0000511 Ga0500556_0000511_17056_17991 291
67 iso_pu_bacteria 2917554339 2917558032 291
68 3300005340 Ga0070689_100467610 Ga0070689_1004676102 292
69 3300005617 Ga0068859_100661351 Ga0068859_1006613512 292
70 3300005618 Ga0068864_100108747 Ga0068864_1001087472 292
71 3300006846 Ga0075430_100098092 Ga0075430_1000980922 292
72 3300006847 Ga0075431_100014199 Ga0075431_1000141993 292
73 3300006880 Ga0075429_100009950 Ga0075429_1000099503 292
74 3300006914 Ga0075436_100033938 Ga0075436_1000339384 292
75 3300006931 Ga0097620_100661340 Ga0097620_1006613402 292
76 3300009094 Ga0111539_10042795 Ga0111539_100427952 292
77 3300009147 Ga0114129_10028068 Ga0114129_100280684 292
78 3300013100 Ga0157373_10236881 Ga0157373_102368811 292
79 3300025912 Ga0207707_10083570 Ga0207707_100835702 292
80 3300025921 Ga0207652_10259092 Ga0207652_102590921 292
81 3300026035 Ga0207703_10286976 Ga0207703_102869762 292
82 3300026095 Ga0207676_10206482 Ga0207676_102064822 292
83 3300027907 Ga0207428_10023244 Ga0207428_100232443 292
84 3300031456 Ga0307513_10180192 Ga0307513_101801922 292
85 3300031456 Ga0307513_10208948 Ga0307513_102089482 292
86 3300035111 Ga0373923_0001153 Ga0373923_0001153_6051_6962 292
87 3300039437 Ga0436365_0889526 Ga0436365_0889526_572_1489 292
88 3300046460 Ga0495638_0048121 Ga0495638_0048121_1717_2622 292
89 3300047320 Ga0495672_0072678 Ga0495672_0072678_43_948 292
90 3300048903 Ga0496100_0271029 Ga0496100_0271029_59_973 292
91 3300048907 Ga0496104_0138198 Ga0496104_0138198_1115_2029 292
92 3300050507 nmdc:mga05p37_20108_c1 nmdc:mga05p37_20108_c1_4097_5020 292
93 3300050508 nmdc:mga09592_17706_c1 nmdc:mga09592_17706_c1_2189_3112 292
94 3300050509 nmdc:mga0qj67_19969_c1 nmdc:mga0qj67_19969_c1_1985_2908 292
95 3300050510 nmdc:mga06r32_2759_c1 nmdc:mga06r32_2759_c1_10703_11626 292
96 3300050511 nmdc:mga08y16_12994_c1 nmdc:mga08y16_12994_c1_3470_4393 292
97 3300053730 Ga0500645_041829 Ga0500645_041829_414_1319 292
98 iso_pu_bacteria 2738543031 2739350515 292
99 iso_pu_bacteria 2829745981 2829746524 292
100 iso_pu_bacteria 2861691609 2861691722 292
101 3300005327 Ga0070658_10021925 Ga0070658_100219252 293
102 3300005530 Ga0070679_100136822 Ga0070679_1001368222 293
103 3300005530 Ga0070679_100159256 Ga0070679_1001592562 293
104 3300005535 Ga0070684_100537819 Ga0070684_1005378192 293
105 3300005614 Ga0068856_100129308 Ga0068856_1001293082 293
106 3300005616 Ga0068852_100010243 Ga0068852_1000102432 293
107 3300005616 Ga0068852_100450035 Ga0068852_1004500352 293
108 3300009094 Ga0111539_10509468 Ga0111539_105094682 293
109 3300009551 Ga0105238_10056074 Ga0105238_100560745 293
110 3300025919 Ga0207657_10070231 Ga0207657_100702312 293
111 3300025921 Ga0207652_10123221 Ga0207652_101232212 293
112 3300025924 Ga0207694_10055758 Ga0207694_100557582 293
113 3300025949 Ga0207667_10010788 Ga0207667_100107882 293
114 3300025949 Ga0207667_10160615 Ga0207667_101606152 293
115 3300025972 Ga0207668_10060129 Ga0207668_100601292 293
116 3300026041 Ga0207639_10108846 Ga0207639_101088462 293
117 3300026078 Ga0207702_10096520 Ga0207702_100965202 293
118 3300026142 Ga0207698_10011952 Ga0207698_100119522 293
119 3300031595 Ga0265313_10039084 Ga0265313_100390842 293
120 3300031712 Ga0265342_10001313 Ga0265342_100013132 293
121 3300035118 Ga0373954_0014893 Ga0373954_0014893_671_1621 293
122 3300035170 Ga0373943_0002264 Ga0373943_0002264_7197_8147 293
123 3300035171 Ga0373946_0033953 Ga0373946_0033953_127_1077 293
124 3300035172 Ga0373955_0001945 Ga0373955_0001945_5367_6317 293
125 3300035695 Ga0373927_0007268 Ga0373927_0007268_6488_7438 293
126 3300035724 Ga0373933_0001366 Ga0373933_0001366_3147_4097 293
127 3300036401 Ga0373937_0000068 Ga0373937_0000068_33347_34297 293
128 3300037068 Ga0373925_0000295 Ga0373925_0000295_33122_34072 293
129 3300046454 Ga0495592_0000793 Ga0495592_0000793_11_961 293
130 3300046462 Ga0495651_0236090 Ga0495651_0236090_63_1013 293
131 3300046463 Ga0495653_0000947 Ga0495653_0000947_21283_22233 293
132 3300046477 Ga0495664_0000060 Ga0495664_0000060_18086_19036 293
133 3300046491 Ga0495584_0139488 Ga0495584_0139488_140_1045 293
134 3300046511 Ga0495608_0000308 Ga0495608_0000308_74_1024 293
135 3300046514 Ga0495618_0000792 Ga0495618_0000792_216_1166 293
136 3300046516 Ga0495628_0000005 Ga0495628_0000005_33177_34127 293
137 3300046517 Ga0495630_0002182 Ga0495630_0002182_1753_2703 293
138 3300046529 Ga0495652_0000897 Ga0495652_0000897_54_1004 293
139 3300046533 Ga0495640_0000027 Ga0495640_0000027_29861_30811 293
140 3300046536 Ga0495587_0000230 Ga0495587_0000230_18016_18966 293
141 3300046543 Ga0495645_0000239 Ga0495645_0000239_21074_22024 293
142 3300046559 Ga0495667_0000660 Ga0495667_0000660_59_1009 293
143 3300046642 Ga0495634_0000696 Ga0495634_0000696_20_970 293
144 3300046663 Ga0495635_0000019 Ga0495635_0000019_18067_19017 293
145 3300046675 Ga0495657_0015672 Ga0495657_0015672_316_1266 293
146 3300046678 Ga0495599_0000051 Ga0495599_0000051_59754_60704 293
147 3300046679 Ga0495623_0003794 Ga0495623_0003794_78_1028 293
148 3300046680 Ga0495646_0000455 Ga0495646_0000455_18007_18957 293
149 3300046689 Ga0495613_0103086 Ga0495613_0103086_955_1905 293
150 3300046809 Ga0495600_0001448 Ga0495600_0001448_10972_11922 293
151 3300047317 Ga0495604_0000507 Ga0495604_0000507_49_999 293
152 3300047319 Ga0495674_0000580 Ga0495674_0000580_33182_34132 293
153 3300047322 Ga0495680_0000216 Ga0495680_0000216_21073_22023 293
154 3300047444 Ga0495675_0003127 Ga0495675_0003127_8919_9869 293
155 3300047471 Ga0495684_0001079 Ga0495684_0001079_47_997 293
156 3300047673 Ga0495593_0115047 Ga0495593_0115047_363_1313 293
157 3300048088 Ga0495602_0001686 Ga0495602_0001686_64_1014 293
158 3300049571 Ga0501034_0236590 Ga0501034_0236590_516_1427 293
159 3300053077 Ga0495601_0000146 Ga0495601_0000146_18085_19035 293
160 3300053078 Ga0495612_0000030 Ga0495612_0000030_21047_21997 293
161 3300053084 Ga0495595_0000098 Ga0495595_0000098_20963_21913 293
162 3300053085 Ga0495619_0000238 Ga0495619_0000238_21095_22045 293
163 3300053096 Ga0500641_0005203 Ga0500641_0005203_1688_2599 293
164 iso_pu_bacteria 2545555834 2545679413 293
165 iso_pu_bacteria 2595698237 2596376085 293
166 iso_pu_bacteria 2643221733 2644732261 293
167 iso_pu_bacteria 2643221736 2644745336 293
168 iso_pu_bacteria 2818991467 2819719492 293
169 iso_pu_bacteria 2851182111 2851187494 293
170 iso_pu_bacteria 2889306138 2889311668 293
171 iso_pu_bacteria 2902330777 2902335282 293
172 iso_pu_bacteria 2902405164 2902408784 293
173 iso_pu_bacteria 2917699015 2917704726 293
174 iso_pu_bacteria 2928125067 2928130231 293
175 iso_pu_bacteria 3003665799 3003667289 293
176 iso_pu_bacteria 641522639 641644504 293
177 iso_pu_bacteria 643348564 643602559 293
178 iso_pu_bacteria 8057529695 8057530934 293
179 3300005518 Ga0070699_100002544 Ga0070699_1000025448 294
180 3300005981 Ga0081538_10004081 Ga0081538_100040814 294
181 3300006042 Ga0075368_10019579 Ga0075368_100195792 294
182 3300006051 Ga0075364_10048144 Ga0075364_100481442 294
183 3300006178 Ga0075367_10035810 Ga0075367_100358102 294
184 3300006195 Ga0075366_10090771 Ga0075366_100907712 294
185 3300006353 Ga0075370_10059814 Ga0075370_100598142 294
186 3300006871 Ga0075434_100175666 Ga0075434_1001756662 294
187 3300007076 Ga0075435_100597371 Ga0075435_1005973711 294
188 3300014326 Ga0157380_10551379 Ga0157380_105513792 294
189 3300021361 Ga0213872_10028624 Ga0213872_100286242 294
190 3300025898 Ga0207692_10052211 Ga0207692_100522112 294
191 3300026067 Ga0207678_10043067 Ga0207678_100430673 294
192 3300031595 Ga0265313_10000339 Ga0265313_1000033953 294
193 3300035086 Ga0373934_0082246 Ga0373934_0082246_216_1181 294
194 3300035113 Ga0373936_0021447 Ga0373936_0021447_654_1562 294
195 3300035724 Ga0373933_0146364 Ga0373933_0146364_71_1036 294
196 3300037418 Ga0395900_0269966 Ga0395900_0269966_26_946 294
197 3300037466 Ga0395898_0091074 Ga0395898_0091074_852_1772 294
198 3300039438 Ga0436360_1229371 Ga0436360_1229371_76_1065 294
199 3300039447 Ga0436361_0423100 Ga0436361_0423100_2579_3568 294
200 3300046454 Ga0495592_0237398 Ga0495592_0237398_117_1082 294
201 3300048905 Ga0496102_0248495 Ga0496102_0248495_567_1481 294
202 3300048907 Ga0496104_0011395 Ga0496104_0011395_2313_3224 294
203 3300048908 Ga0496105_0038949 Ga0496105_0038949_1461_2372 294
204 3300048912 Ga0496109_0081733 Ga0496109_0081733_640_1551 294
205 3300049571 Ga0501034_0009766 Ga0501034_0009766_8986_9903 294
206 3300049581 Ga0501047_0213261 Ga0501047_0213261_538_1458 294
207 3300049582 Ga0501048_0040364 Ga0501048_0040364_1717_2637 294
208 3300049585 Ga0501069_0012902 Ga0501069_0012902_1967_2914 294
209 3300049586 Ga0501070_0002160 Ga0501070_0002160_12650_13597 294
210 3300049586 Ga0501070_0060615 Ga0501070_0060615_23_970 294
211 3300049588 Ga0501072_0002952 Ga0501072_0002952_3414_4331 294
212 3300049591 Ga0501075_0027061 Ga0501075_0027061_2184_3101 294
213 3300049592 Ga0501076_0005769 Ga0501076_0005769_5942_6859 294
214 3300049742 Ga0501080_0166089 Ga0501080_0166089_444_1391 294
215 3300049822 Ga0501035_0010586 Ga0501035_0010586_800_1747 294
216 3300049822 Ga0501035_0025828 Ga0501035_0025828_2839_3759 294
217 3300049822 Ga0501035_0319745 Ga0501035_0319745_199_1119 294
218 3300049823 Ga0501044_0335814 Ga0501044_0335814_368_1288 294
219 3300050493 nmdc:mga0k408_88599_c1 nmdc:mga0k408_88599_c1_581_1501 294
220 3300050511 nmdc:mga08y16_384905_c1 nmdc:mga08y16_384905_c1_481_1395 294
221 3300050515 nmdc:mga0a205_105251_c1 nmdc:mga0a205_105251_c1_1787_2710 294
222 3300053077 Ga0495601_0165367 Ga0495601_0165367_51_1016 294
223 3300003771 Ga0055526_1000470 Ga0055526_100047020 295
224 3300005262 Ga0065165_1000095 Ga0065165_1000095145 295
225 3300005330 Ga0070690_100209917 Ga0070690_1002099172 295
226 3300005365 Ga0070688_100169637 Ga0070688_1001696372 295
227 3300005435 Ga0070714_100590296 Ga0070714_1005902961 295
228 3300005436 Ga0070713_100312458 Ga0070713_1003124582 295
229 3300005436 Ga0070713_100546273 Ga0070713_1005462731 295
230 3300005439 Ga0070711_100090147 Ga0070711_1000901472 295
231 3300005548 Ga0070665_100172644 Ga0070665_1001726442 295
232 3300005983 Ga0081540_1006311 Ga0081540_10063115 295
233 3300006028 Ga0070717_10081393 Ga0070717_100813932 295
234 3300006048 Ga0075363_100041697 Ga0075363_1000416972 295
235 3300006844 Ga0075428_100058332 Ga0075428_1000583323 295
236 3300006847 Ga0075431_100013035 Ga0075431_1000130359 295
237 3300006871 Ga0075434_100046956 Ga0075434_1000469564 295
238 3300006914 Ga0075436_100151934 Ga0075436_1001519342 295
239 3300007076 Ga0075435_100013550 Ga0075435_1000135504 295
240 3300009094 Ga0111539_10038593 Ga0111539_100385932 295
241 3300009098 Ga0105245_10206565 Ga0105245_102065652 295
242 3300009147 Ga0114129_10051885 Ga0114129_100518854 295
243 3300013250 Ga0171462_1006 Ga0171462_100626 295
244 3300021358 Ga0213873_10059687 Ga0213873_100596871 295
245 3300021384 Ga0213876_10000302 Ga0213876_1000030227 295
246 3300021384 Ga0213876_10046909 Ga0213876_100469092 295
247 3300021388 Ga0213875_10003032 Ga0213875_100030326 295
248 3300025284 Ga0209130_1000117 Ga0209130_100011712 295
249 3300025295 Ga0209564_1000065 Ga0209564_1000065134 295
250 3300025915 Ga0207693_10026377 Ga0207693_100263772 295
251 3300025926 Ga0207659_10068166 Ga0207659_100681662 295
252 3300025939 Ga0207665_10142625 Ga0207665_101426252 295
253 3300027866 Ga0209813_10013430 Ga0209813_100134302 295
254 3300028379 Ga0268266_10047160 Ga0268266_100471602 295
255 3300028800 Ga0265338_10069935 Ga0265338_100699352 295
256 3300035111 Ga0373923_0037797 Ga0373923_0037797_96_1037 295
257 3300035119 Ga0373956_0031263 Ga0373956_0031263_161_1102 295
258 3300035398 Ga0316574_0085545 Ga0316574_0085545_692_1609 295
259 3300035695 Ga0373927_0004428 Ga0373927_0004428_3789_4691 295
260 3300036647 Ga0316582_0028902 Ga0316582_0028902_1735_2649 295
261 3300037068 Ga0373925_0279841 Ga0373925_0279841_59_961 295
262 3300037853 Ga0436364_0216228 Ga0436364_0216228_6693_7619 295
263 3300037853 Ga0436364_0824955 Ga0436364_0824955_15_941 295
264 3300039437 Ga0436365_0918625 Ga0436365_0918625_6318_7244 295
265 3300039437 Ga0436365_1130377 Ga0436365_1130377_267_1190 295
266 3300039437 Ga0436365_1179379 Ga0436365_1179379_990_1916 295
267 3300039437 Ga0436365_1205523 Ga0436365_1205523_25669_26595 295
268 3300039450 Ga0436363_0268732 Ga0436363_0268732_306_1232 295
269 3300039450 Ga0436363_0686830 Ga0436363_0686830_7050_7976 295
270 3300039453 Ga0436362_1050412 Ga0436362_1050412_134_1060 295
271 3300045051 Ga0451576_0011121 Ga0451576_0011121_1600_2505 295
272 3300046454 Ga0495592_0193638 Ga0495592_0193638_38_979 295
273 3300046463 Ga0495653_0066604 Ga0495653_0066604_1140_2081 295
274 3300046476 Ga0495662_0032699 Ga0495662_0032699_44_985 295
275 3300046511 Ga0495608_0103010 Ga0495608_0103010_56_997 295
276 3300046512 Ga0495610_0070828 Ga0495610_0070828_662_1573 295
277 3300046529 Ga0495652_0200552 Ga0495652_0200552_39_980 295
278 3300046531 Ga0495665_0077852 Ga0495665_0077852_75_1016 295
279 3300046533 Ga0495640_0240481 Ga0495640_0240481_168_1109 295
280 3300046536 Ga0495587_0104459 Ga0495587_0104459_542_1483 295
281 3300046543 Ga0495645_0054290 Ga0495645_0054290_96_1037 295
282 3300046559 Ga0495667_0099657 Ga0495667_0099657_541_1482 295
283 3300046660 Ga0495625_0283272 Ga0495625_0283272_23_934 295
284 3300046675 Ga0495657_0130945 Ga0495657_0130945_272_1213 295
285 3300046678 Ga0495599_0026100 Ga0495599_0026100_2369_3310 295
286 3300046679 Ga0495623_0134228 Ga0495623_0134228_460_1401 295
287 3300046689 Ga0495613_0082987 Ga0495613_0082987_856_1797 295
288 3300047322 Ga0495680_0069817 Ga0495680_0069817_936_1877 295
289 3300047444 Ga0495675_0025384 Ga0495675_0025384_879_1820 295
290 3300047472 Ga0495686_0138350 Ga0495686_0138350_99_1010 295
291 3300048088 Ga0495602_0038276 Ga0495602_0038276_152_1093 295
292 3300048903 Ga0496100_0087020 Ga0496100_0087020_230_1171 295
293 3300048908 Ga0496105_0041017 Ga0496105_0041017_1399_2319 295
294 3300048908 Ga0496105_0255098 Ga0496105_0255098_209_1150 295
295 3300048911 Ga0496108_0002927 Ga0496108_0002927_2581_3501 295
296 3300048911 Ga0496108_0063091 Ga0496108_0063091_1139_2074 295
297 3300048913 Ga0496110_0035562 Ga0496110_0035562_1359_2279 295
298 3300048913 Ga0496110_0109567 Ga0496110_0109567_1219_2154 295
299 3300048914 Ga0496111_0023641 Ga0496111_0023641_2334_3254 295
300 3300048915 Ga0496112_0018082 Ga0496112_0018082_347_1288 295
301 3300048915 Ga0496112_0191913 Ga0496112_0191913_1001_1942 295
302 3300048916 Ga0496113_0072378 Ga0496113_0072378_1589_2509 295
303 3300048918 Ga0496115_0116477 Ga0496115_0116477_600_1541 295
304 3300049572 Ga0501036_0088713 Ga0501036_0088713_662_1573 295
305 3300049572 Ga0501036_0406109 Ga0501036_0406109_173_1087 295
306 3300049576 Ga0501040_0079804 Ga0501040_0079804_511_1422 295
307 3300049578 Ga0501042_0040746 Ga0501042_0040746_501_1412 295
308 3300049582 Ga0501048_0034030 Ga0501048_0034030_1715_2626 295
309 3300049741 Ga0501079_0412809 Ga0501079_0412809_121_1047 295
310 3300049822 Ga0501035_0129343 Ga0501035_0129343_791_1705 295
311 3300049824 Ga0501045_0162572 Ga0501045_0162572_356_1267 295
312 3300050490 nmdc:mga03n38_64956_c1 nmdc:mga03n38_64956_c1_286_1206 295
313 3300050494 nmdc:mga06z11_31660_c1 nmdc:mga06z11_31660_c1_32_952 295
314 3300050495 nmdc:mga04h51_3186_c1 nmdc:mga04h51_3186_c1_89_1030 295
315 3300050507 nmdc:mga05p37_590935_c1 nmdc:mga05p37_590935_c1_143_1063 295
316 3300050510 nmdc:mga06r32_172646_c1 nmdc:mga06r32_172646_c1_1116_2039 295
317 3300050511 nmdc:mga08y16_194050_c1 nmdc:mga08y16_194050_c1_694_1614 295
318 3300050512 nmdc:mga0n895_287381_c1 nmdc:mga0n895_287381_c1_427_1362 295
319 3300050512 nmdc:mga0n895_84562_c1 nmdc:mga0n895_84562_c1_1379_2308 295
320 3300050513 nmdc:mga0rr50_34660_c1 nmdc:mga0rr50_34660_c1_1485_2414 295
321 3300050515 nmdc:mga0a205_153901_c1 nmdc:mga0a205_153901_c1_782_1717 295
322 3300053153 Ga0500616_0105153 Ga0500616_0105153_164_1075 295
323 3300053156 Ga0500622_0021939 Ga0500622_0021939_2027_2938 295
324 3300053177 Ga0500636_0001570 Ga0500636_0001570_11178_12089 295
325 3300060353 Ga0501082_0500181 Ga0501082_0500181_121_1032 295
326 3300037853 Ga0436364_1012628 Ga0436364_1012628_3651_4607 296
327 3300044735 Ga0466968_0021987 Ga0466968_0021987_326_1255 296
328 iso_pu_bacteria 2582581308 2585277500 296
329 iso_pu_bacteria 2582581315 2585323316 296
330 iso_pu_bacteria 2585427527 2585535127 296
331 iso_pu_bacteria 2585427530 2585555977 296
332 iso_pu_bacteria 2615840626 2616308975 296
333 iso_pu_bacteria 2667528174 2671111413 296
334 iso_pu_bacteria 2818991453 2819637606 296
335 iso_pu_bacteria 2852387548 2852390243 296
336 iso_pu_bacteria 3005416602 3005417393 296
337 iso_pu_bacteria 8005314921 8005315818 296
338 iso_pu_bacteria 8005484373 8005489170 296
339 iso_pu_bacteria 8005645114 8005648154 296
340 3300006028 Ga0070717_10160166 Ga0070717_101601662 297
341 3300025898 Ga0207692_10114911 Ga0207692_101149112 297
342 3300025939 Ga0207665_10070432 Ga0207665_100704322 297
343 3300024227 Ga0228598_1028921 Ga0228598_10289212 298
344 iso_pu_bacteria 8018150411 8018153245 298
345 3300003214 JGI25165J46597_1001244 JGI25165J46597_100124413 300
346 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001118 300
347 3300004625 Ga0055543_1000003 Ga0055543_1000003134 300
348 3300005262 Ga0065165_1000068 Ga0065165_100006834 300
349 3300005548 Ga0070665_100158996 Ga0070665_1001589962 300
350 3300009093 Ga0105240_10000076 Ga0105240_10000076179 300
351 3300009545 Ga0105237_10000226 Ga0105237_1000022615 300
352 3300010375 Ga0105239_10010871 Ga0105239_100108716 300
353 3300013104 Ga0157370_10001902 Ga0157370_1000190222 300
354 3300014497 Ga0182008_10017301 Ga0182008_100173011 300
355 3300015262 Ga0182007_10001912 Ga0182007_100019125 300
356 3300025233 Ga0209437_100051 Ga0209437_100051308 300
357 3300025253 Ga0209677_101110 Ga0209677_1011107 300
358 3300025261 Ga0209233_1000113 Ga0209233_100011335 300
359 3300025261 Ga0209233_1000148 Ga0209233_1000148178 300
360 3300025284 Ga0209130_1000003 Ga0209130_1000003140 300
361 3300025302 Ga0207426_1000011 Ga0207426_1000011637 300
362 3300025913 Ga0207695_10000011 Ga0207695_1000001122 300
363 3300025914 Ga0207671_10000093 Ga0207671_10000093111 300
364 3300028379 Ga0268266_10215604 Ga0268266_102156042 300
365 3300048903 Ga0496100_0039046 Ga0496100_0039046_280_1182 300
366 3300048905 Ga0496102_0047061 Ga0496102_0047061_1604_2506 300
367 3300048906 Ga0496103_0002316 Ga0496103_0002316_9583_10485 300
368 3300048920 Ga0496117_0016063 Ga0496117_0016063_3694_4596 300
369 3300048921 Ga0496118_0018301 Ga0496118_0018301_3693_4595 300
370 3300048922 Ga0496119_0026781 Ga0496119_0026781_1624_2526 300
371 3300048922 Ga0496119_0085978 Ga0496119_0085978_161_1063 300
372 3300048923 Ga0496120_0013309 Ga0496120_0013309_1652_2554 300
373 3300048924 Ga0496121_0002536 Ga0496121_0002536_1661_2563 300
374 3300048924 Ga0496121_0060956 Ga0496121_0060956_1874_2776 300
375 3300048925 Ga0496122_0014566 Ga0496122_0014566_1557_2459 300
376 3300048926 Ga0496123_0031546 Ga0496123_0031546_1492_2394 300
377 3300048928 Ga0496125_0062114 Ga0496125_0062114_1798_2700 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02219

MTHFR

Methylenetetrahydrofolate reductase

11

295

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zpt-assembly1.cif.gz_A escherichia coli methylenetetrahydrofolate reductase (reduced) complexed with nadh, ph 7.25 0.9545 9 289
3fsu-assembly1.cif.gz_E crystal structure of escherichia coli methylenetetrahydrofolate reductase double mutant phe223leuglu28gln complexed with methyltetrahydrofolate 0.9537 9 289
3fst-assembly1.cif.gz_E crystal structure of escherichia coli methylenetetrahydrofolate reductase mutant phe223leu at ph 7.4 0.9537 9 289
1zp3-assembly2.cif.gz_A e. coli methylenetetrahydrofolate reductase (oxidized) 0.9517 9 289
1b5t-assembly1.cif.gz_C escherichia coli methylenetetrahydrofolate reductase 0.9507 12 290
ID Description Score Start End Superfamily
1zp3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9426 9 289 3.20.20.220
af_Q75HE6_1_304_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9348 12 288 3.20.20.220
1v93A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9306 9 290 3.20.20.220
af_A0A1D6GER4_1_215_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9202 83 286 3.20.20.220
af_Q9WU20_42_335_3.20.20.220 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9117 12 286 3.20.20.220
ID Description Score Start End GO Terms
AF-A0A659UAU7-F1-model_v4 Methylenetetrahydrofolate reductase 0.9777 87 181 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A833G8T3-F1-model_v4 Methylenetetrahydrofolate reductase 0.9729 9 191 GO:0004489
GO:0005829
GO:0009086
GO:0035999
GO:0071949
AF-A0A6B3C954-F1-model_v4 Methylenetetrahydrofolate reductase 0.9683 23 200 GO:0004489
GO:0005829
GO:0009086
GO:0035999
GO:0071949
AF-A0A520J8B6-F1-model_v4 Methylenetetrahydrofolate reductase 0.965 10 200 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312
AF-A0A531AJ79-F1-model_v4 Methylenetetrahydrofolate reductase 0.9638 12 170 GO:0005829
GO:0009086
GO:0035999
GO:0071949
GO:0106312

Feature Viewer

pLDDT pTM Quality
87.24 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map