F427668

General Info

Members Datasets Scaffolds Average Seq Length
377 266 754 203

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10025147|Ga0105240_100251474
Length 244
Sequence LWRRAKARDQPTGDVGVNGRRFQSTEPLMSISPRLYEGLPVRIAYVGASGAVGAYVVAELSRRGHQVTAITTHPDAVAELPGVTAQFGDANDGPALTALLSGHDVAVTSIQFAKTDPETLIEAVKASAVPRYVVAGGSGTLHAPGTTTRLMDSPTFPANFAAPAAAAARFFDRLLLETELDWAYLSPPPGFAPGPATGTFRLGLDEMLVGPDGTATVSYGDYAIAMADEIERPKHHRRRFTIGY

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
38 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
39 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
52 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
67 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
94 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
95 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
96 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
133 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
202 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
203 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
204 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
205 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
206 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
207 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
208 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
211 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
212 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
213 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
214 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
217 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
219 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
220 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
221 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
224 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
225 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
226 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
227 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
228 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
231 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
234 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
235 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
236 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
237 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
238 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
239 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
240 2643221569 Achromobacter sp. Root565 Isolate Unclassified
241 2643221594 Achromobacter sp. Root170 Isolate Unclassified
242 2643221621 Achromobacter sp. Root83 Isolate Unclassified
243 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
244 2643221733 Bosea sp. Root381 Isolate Unclassified
245 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
246 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
247 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
248 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
249 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
250 2904699407
251 2909042592 Labrys sp. LIt4 Isolate Nodule
252 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
253 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
254 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
255 2941479691
256 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
257 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
258 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
259 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
260 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
261 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
262 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
263 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
264 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
265 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
266 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.22
Metatranscriptomes 0.27
Isolates 8.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.3
Nodule 6.63
Rhizoplane 1.86
Rhizosphere 58.09
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10025147 3300009093 Bacteria 7830
2 JGI25151J46595_10000483 3300003187 Bacteria 37686
3 rootL2_10019792 3300003322 Bacteria 1122
4 JGI25404J52841_10029506 3300003659 Bacteria 1176
5 Ga0055526_1012680 3300003771 Bacteria 3646
6 Ga0055524_1000399 3300003775 Bacteria 37137
7 Ga0055534_1020391 3300003784 Bacteria 1121
8 JGI25405J52794_10034249 3300003911 Bacteria 1061
9 Ga0070683_100016081 3300005329 Bacteria 6585
10 Ga0070683_100017893 3300005329 Bacteria 6265
11 Ga0070683_100174531 3300005329 Bacteria 2040
12 Ga0068869_100253037 3300005334 Bacteria 1408
13 Ga0070669_101127263 3300005353 Bacteria 676
14 Ga0070714_100256534 3300005435 Bacteria 1618
15 Ga0070713_100040143 3300005436 Bacteria 3804
16 Ga0070713_100923181 3300005436 Bacteria 840
17 Ga0070710_10292347 3300005437 Bacteria 1061
18 Ga0070708_100370697 3300005445 Bacteria 1350
19 Ga0070663_100098184 3300005455 Bacteria 2181
20 Ga0070663_100498087 3300005455 Bacteria 1011
21 Ga0070663_100974378 3300005455 Bacteria 736
22 Ga0070706_100090989 3300005467 Bacteria 2829
23 Ga0070707_100149757 3300005468 Bacteria 2272
24 Ga0070699_100343787 3300005518 Bacteria 1343
25 Ga0068853_100169068 3300005539 Bacteria 1977
26 Ga0070665_100689330 3300005548 Bacteria 1035
27 Ga0068855_100003510 3300005563 Bacteria 19199
28 Ga0068855_100475999 3300005563 Bacteria 1360
29 Ga0068856_100017871 3300005614 Bacteria 6878
30 Ga0068852_100136795 3300005616 Bacteria 2263
31 Ga0068859_100441450 3300005617 Bacteria 1398
32 Ga0068851_10191843 3300005834 Bacteria 1136
33 Ga0068858_100072264 3300005842 Bacteria 3201
34 Ga0068858_100122098 3300005842 Bacteria 2437
35 Ga0068858_100344527 3300005842 Bacteria 1427
36 Ga0081455_10071357 3300005937 Bacteria 2879
37 Ga0081540_1127211 3300005983 Bacteria 1047
38 Ga0081540_1139147 3300005983 Bacteria 978
39 Ga0070717_10005767 3300006028 Bacteria 9068
40 Ga0070717_10016559 3300006028 Bacteria 5717
41 Ga0075365_10206656 3300006038 Bacteria 1376
42 Ga0075368_10001146 3300006042 Bacteria 8361
43 Ga0075368_10040496 3300006042 Bacteria 1829
44 Ga0070716_100291324 3300006173 Bacteria 1131
45 Ga0075367_10000114 3300006178 Bacteria 23062
46 Ga0075367_10173955 3300006178 Bacteria 1341
47 Ga0075367_10434741 3300006178 Bacteria 831
48 Ga0075370_10039438 3300006353 Bacteria 2661
49 Ga0097620_100441454 3300006931 Bacteria 1398
50 Ga0099825_1031497 3300006941 Bacteria 2240
51 Ga0099824_1016379 3300006942 Bacteria 6734
52 Ga0099822_1010465 3300006943 Bacteria 11499
53 Ga0099794_10029658 3300007265 Bacteria 2550
54 Ga0099794_10197457 3300007265 Bacteria 1030
55 Ga0105251_10011413 3300009011 Bacteria 5078
56 Ga0105244_10001932 3300009036 Bacteria 16098
57 Ga0105240_10001711 3300009093 Bacteria 37047
58 Ga0105245_10004848 3300009098 Bacteria 11854
59 Ga0105247_10024524 3300009101 Bacteria 3635
60 Ga0105241_10133051 3300009174 Bacteria 2016
61 Ga0105242_10335469 3300009176 Bacteria 1392
62 Ga0105248_10131387 3300009177 Bacteria 2825
63 Ga0105237_10020180 3300009545 Bacteria 6878
64 Ga0105237_10053443 3300009545 Bacteria 4052
65 Ga0105237_10188444 3300009545 Bacteria 2063
66 Ga0105237_10199135 3300009545 Bacteria 2002
67 Ga0105237_10213837 3300009545 Bacteria 1928
68 Ga0105237_10374316 3300009545 Bacteria 1429
69 Ga0105238_10110622 3300009551 Bacteria 2728
70 Ga0105249_10107391 3300009553 Bacteria 2634
71 Ga0123341_1006390 3300009765 Bacteria 10661
72 Ga0123342_1009831 3300009766 Bacteria 11233
73 Ga0105239_10007012 3300010375 Bacteria 12969
74 Ga0105239_10008619 3300010375 Bacteria 11562
75 Ga0105239_10049032 3300010375 Bacteria 4630
76 Ga0105239_10054359 3300010375 Bacteria 4392
77 Ga0157373_10354241 3300013100 Bacteria 1047
78 Ga0157371_10116024 3300013102 Bacteria 1902
79 Ga0157370_10127322 3300013104 Bacteria 2377
80 Ga0157369_10031850 3300013105 Bacteria 5802
81 Ga0157369_10093718 3300013105 Bacteria 3205
82 Ga0157369_10801270 3300013105 Bacteria 968
83 Ga0171462_1051 3300013250 Bacteria 38389
84 Ga0157372_10059785 3300013307 Bacteria 4264
85 Ga0157372_10355354 3300013307 Bacteria 1707
86 Ga0157375_10016220 3300013308 Bacteria 6683
87 Ga0157375_11312408 3300013308 Bacteria 851
88 Ga0163163_10252866 3300014325 Bacteria 1813
89 Ga0163163_10753117 3300014325 Bacteria 1037
90 Ga0157377_10206403 3300014745 Bacteria 1250
91 Ga0163161_10104073 3300017792 Bacteria 2116
92 Ga0163161_10311372 3300017792 Bacteria 1242
93 Ga0163161_10472684 3300017792 Bacteria 1017
94 Ga0213872_10021926 3300021361 Bacteria 2941
95 Ga0213872_10032757 3300021361 Bacteria 2382
96 Ga0213872_10091252 3300021361 Bacteria 1363
97 Ga0213872_10216951 3300021361 Bacteria 815
98 Ga0213875_10013717 3300021388 Bacteria 3971
99 Ga0213871_10090541 3300021441 Bacteria 886
100 Ga0209677_101499 3300025253 Bacteria 10019
101 Ga0209233_1000931 3300025261 Bacteria 12737
102 Ga0209455_1001426 3300025272 Bacteria 10833
103 Ga0209455_1005466 3300025272 Bacteria 3920
104 Ga0209675_1000515 3300025291 Bacteria 28533
105 Ga0209025_1000357 3300025294 Bacteria 98040
106 Ga0209564_1012446 3300025295 Bacteria 3710
107 Ga0209256_1000876 3300025299 Bacteria 37189
108 Ga0207655_1000731 3300025728 Bacteria 37084
109 Ga0207655_1000997 3300025728 Bacteria 28813
110 Ga0207710_10053024 3300025900 Bacteria 1824
111 Ga0207647_10015649 3300025904 Bacteria 5193
112 Ga0207647_10351239 3300025904 Bacteria 835
113 Ga0207684_10094978 3300025910 Bacteria 2544
114 Ga0207695_10001652 3300025913 Bacteria 35931
115 Ga0207671_10032701 3300025914 Bacteria 3869
116 Ga0207671_10050595 3300025914 Bacteria 3077
117 Ga0207671_10138308 3300025914 Bacteria 1874
118 Ga0207671_10142223 3300025914 Unclassified 1849
119 Ga0207671_10784380 3300025914 Bacteria 756
120 Ga0207646_10858306 3300025922 Bacteria 807
121 Ga0207694_10007659 3300025924 Bacteria 8180
122 Ga0207687_10000912 3300025927 Bacteria 20131
123 Ga0207700_10026402 3300025928 Bacteria 4048
124 Ga0207700_10070283 3300025928 Bacteria 2690
125 Ga0207686_10114918 3300025934 Bacteria 1822
126 Ga0207665_10338962 3300025939 Bacteria 1132
127 Ga0207711_10007537 3300025941 Bacteria 9102
128 Ga0207711_10526542 3300025941 Bacteria 1102
129 Ga0207667_10002955 3300025949 Bacteria 21097
130 Ga0207703_10101902 3300026035 Bacteria 2435
131 Ga0207703_10567979 3300026035 Bacteria 1071
132 Ga0207639_10211043 3300026041 Bacteria 1671
133 Ga0207678_10007286 3300026067 Bacteria 9804
134 Ga0207678_10551882 3300026067 Bacteria 1008
135 Ga0207702_10016031 3300026078 Bacteria 6204
136 Ga0207698_10053582 3300026142 Bacteria 3098
137 Ga0209589_1000018 3300027357 Bacteria 192614
138 Ga0209489_100026 3300027361 Bacteria 192614
139 Ga0209700_100035 3300027363 Bacteria 192614
140 Ga0209588_1021097 3300027671 Bacteria 2044
141 Ga0209588_1156155 3300027671 Bacteria 721
142 Ga0209588_1163903 3300027671 Bacteria 701
143 Ga0209813_10000134 3300027866 Bacteria 25655
144 Ga0268266_10565624 3300028379 Bacteria 1090
145 Ga0265334_10014863 3300028573 Bacteria 3240
146 Ga0265336_10000682 3300028666 Bacteria 18331
147 Ga0307515_10092532 3300028794 Bacteria 3762
148 Ga0265338_10000746 3300028800 Bacteria 55415
149 Ga0265324_10012913 3300029957 Bacteria 3133
150 Ga0265332_10156866 3300031238 Bacteria 951
151 Ga0265328_10089117 3300031239 Bacteria 1139
152 Ga0265325_10178935 3300031241 Bacteria 988
153 Ga0265340_10022471 3300031247 Bacteria 3224
154 Ga0265339_10022401 3300031249 Bacteria 3662
155 Ga0265316_10048748 3300031344 Bacteria 3341
156 Ga0307513_10254364 3300031456 Bacteria 1551
157 Ga0265313_10004280 3300031595 Bacteria 11053
158 Ga0265314_10091948 3300031711 Bacteria 1973
159 Ga0265342_10087434 3300031712 Bacteria 1791
160 Ga0265342_10201084 3300031712 Bacteria 1082
161 Ga0307405_10381180 3300031731 Bacteria 1098
162 Ga0307413_10274017 3300031824 Bacteria 1265
163 Ga0307410_10098270 3300031852 Bacteria 2093
164 Ga0307416_100409280 3300032002 Bacteria 1397
165 Ga0307414_10540579 3300032004 Bacteria 1037
166 Ga0307414_10752137 3300032004 Bacteria 886
167 Ga0307414_11077149 3300032004 Bacteria 742
168 Ga0307415_100035854 3300032126 Bacteria 3244
169 Ga0372808_001167 3300036459 Bacteria 2608
170 Ga0373925_0096989 3300037068 Bacteria 2261
171 Ga0436365_1128725 3300039437 Bacteria 1796
172 Ga0436365_1472677 3300039437 Bacteria 1045
173 Ga0436365_1914126 3300039437 Bacteria 1039
174 Ga0436360_1062717 3300039438 Bacteria 2356
175 Ga0436361_0344309 3300039447 Bacteria 1714
176 Ga0436361_0822154 3300039447 Bacteria 3256
177 Ga0436361_1222200 3300039447 Bacteria 1820
178 Ga0436362_0043050 3300039453 Bacteria 2637
179 Ga0451853_3785624 3300041512 Bacteria 1893
180 Ga0466969_0093950 3300044656 Bacteria 1418
181 Ga0466966_0318792 3300044684 Bacteria 934
182 Ga0466964_0069254 3300044706 Bacteria 1488
183 Ga0466957_0017366 3300044842 Bacteria 4212
184 Ga0466959_0089580 3300045049 Bacteria 2210
185 Ga0466959_0258550 3300045049 Bacteria 1199
186 Ga0466959_0521059 3300045049 Bacteria 803
187 Ga0466959_0634475 3300045049 Bacteria 718
188 Ga0495617_007344 3300046452 Bacteria 3826
189 Ga0495627_000089 3300046453 Bacteria 110113
190 Ga0495627_001449 3300046453 Bacteria 13902
191 Ga0495627_011315 3300046453 Bacteria 3207
192 Ga0495638_0020311 3300046460 Bacteria 4388
193 Ga0495638_0046716 3300046460 Bacteria 2719
194 Ga0495653_0513461 3300046463 Bacteria 746
195 Ga0495582_0224468 3300046473 Bacteria 1075
196 Ga0495584_0123398 3300046491 Bacteria 1312
197 Ga0495596_0159201 3300046500 Bacteria 877
198 Ga0495607_0045106 3300046501 Bacteria 2595
199 Ga0495606_0057008 3300046507 Bacteria 2518
200 Ga0495610_0000186 3300046512 Bacteria 69408
201 Ga0495610_0036307 3300046512 Bacteria 2519
202 Ga0495616_0020118 3300046513 Bacteria 3636
203 Ga0495620_0025669 3300046515 Bacteria 2783
204 Ga0495631_0096643 3300046518 Bacteria 1271
205 Ga0495632_0000001 3300046519 Bacteria 873295
206 Ga0495637_0000417 3300046520 Bacteria 31220
207 Ga0495637_0009051 3300046520 Bacteria 4865
208 Ga0495637_0088173 3300046520 Bacteria 1227
209 Ga0495643_0000020 3300046522 Bacteria 294973
210 Ga0495643_0042004 3300046522 Bacteria 2492
211 Ga0495648_0029396 3300046524 Bacteria 3648
212 Ga0495648_0032833 3300046524 Bacteria 3400
213 Ga0495663_0000002 3300046525 Bacteria 495384
214 Ga0495654_0011888 3300046530 Bacteria 4695
215 Ga0495665_0016048 3300046531 Bacteria 4036
216 Ga0495586_0024615 3300046535 Bacteria 3220
217 Ga0495587_0138841 3300046536 Bacteria 1388
218 Ga0495645_0109789 3300046543 Bacteria 1953
219 Ga0495633_0000276 3300046558 Bacteria 59784
220 Ga0495633_0007732 3300046558 Bacteria 6148
221 Ga0495633_0071593 3300046558 Bacteria 1617
222 Ga0495668_0029351 3300046616 Bacteria 3107
223 Ga0495625_0090229 3300046660 Bacteria 2120
224 Ga0495661_0087319 3300046665 Bacteria 1783
225 Ga0495588_0408241 3300046674 Bacteria 713
226 Ga0495599_0012461 3300046678 Bacteria 5242
227 Ga0495670_0005603 3300046691 Bacteria 6160
228 Ga0495671_0000016 3300046692 Bacteria 294821
229 Ga0495671_0030898 3300046692 Bacteria 2740
230 Ga0495675_0230892 3300047444 Bacteria 1117
231 Ga0495673_0073396 3300047469 Bacteria 1434
232 Ga0495673_0087231 3300047469 Bacteria 1281
233 Ga0495681_0000103 3300047470 Bacteria 75088
234 Ga0495681_0091116 3300047470 Bacteria 1346
235 Ga0495684_0258164 3300047471 Bacteria 1265
236 Ga0495686_0028173 3300047472 Bacteria 3659
237 Ga0495686_0100198 3300047472 Bacteria 1748
238 Ga0495686_0288534 3300047472 Bacteria 910
239 Ga0496102_0146149 3300048905 Bacteria 2219
240 Ga0496110_0807266 3300048913 Bacteria 843
241 Ga0496114_0160416 3300048917 Bacteria 1955
242 Ga0496115_0112636 3300048918 Bacteria 2235
243 Ga0496115_0325320 3300048918 Bacteria 1257
244 Ga0496115_0401558 3300048918 Bacteria 1112
245 Ga0496116_0048401 3300048919 Bacteria 2854
246 Ga0496116_0133132 3300048919 Bacteria 1413
247 Ga0496117_0049736 3300048920 Bacteria 2978
248 Ga0496117_0193502 3300048920 Bacteria 1156
249 Ga0496117_0376491 3300048920 Bacteria 724
250 Ga0496118_0013338 3300048921 Bacteria 7782
251 Ga0496118_0015328 3300048921 Bacteria 7103
252 Ga0496118_0100911 3300048921 Bacteria 1950
253 Ga0496119_0071439 3300048922 Bacteria 2031
254 Ga0496120_0042211 3300048923 Bacteria 2665
255 Ga0496121_0003730 3300048924 Bacteria 21352
256 Ga0496121_0004075 3300048924 Bacteria 20070
257 Ga0496121_0209256 3300048924 Bacteria 1383
258 Ga0496121_0247753 3300048924 Bacteria 1237
259 Ga0496122_0089431 3300048925 Bacteria 2105
260 Ga0496123_0104255 3300048926 Bacteria 1640
261 Ga0496123_0104765 3300048926 Bacteria 1635
262 Ga0496124_0019200 3300048927 Bacteria 6373
263 Ga0496124_0062524 3300048927 Bacteria 3115
264 Ga0496124_0088844 3300048927 Bacteria 2525
265 Ga0496124_0212561 3300048927 Bacteria 1462
266 Ga0496124_0326025 3300048927 Bacteria 1097
267 Ga0496125_0000869 3300048928 Bacteria 48286
268 Ga0496125_0003929 3300048928 Bacteria 17533
269 Ga0496125_0013173 3300048928 Bacteria 8147
270 Ga0496125_0050458 3300048928 Bacteria 3444
271 Ga0496125_0098430 3300048928 Bacteria 2164
272 Ga0496125_0118793 3300048928 Bacteria 1892
273 Ga0496125_0265080 3300048928 Bacteria 1074
274 Ga0496126_0042530 3300048929 Bacteria 4196
275 Ga0496126_0044356 3300048929 Bacteria 4095
276 Ga0496126_0082924 3300048929 Bacteria 2830
277 Ga0496126_0182636 3300048929 Bacteria 1781
278 Ga0496126_0202429 3300048929 Bacteria 1676
279 Ga0496126_0433617 3300048929 Bacteria 1060
280 Ga0496126_0642292 3300048929 Bacteria 831
281 Ga0495678_021922 3300049459 Bacteria 2803
282 Ga0501036_0150804 3300049572 Bacteria 1961
283 Ga0501042_0590973 3300049578 Bacteria 807
284 Ga0501074_0232523 3300049590 Bacteria 1312
285 Ga0501074_0431026 3300049590 Bacteria 935
286 Ga0501076_0162046 3300049592 Bacteria 1822
287 Ga0501077_0045990 3300049593 Bacteria 2773
288 Ga0501079_0061370 3300049741 Bacteria 2900
289 Ga0501080_0360351 3300049742 Bacteria 1312
290 Ga0501081_0037021 3300049743 Bacteria 3329
291 Ga0501045_0091968 3300049824 Bacteria 2243
292 nmdc:mga00v17_389939_c1 3300050491 Bacteria 905
293 nmdc:mga0yw44_73275_c1 3300050492 Bacteria 2130
294 nmdc:mga0yw44_79738_c1 3300050492 Bacteria 2049
295 nmdc:mga06z11_179_c1 3300050494 Bacteria 25141
296 nmdc:mga04h51_255480_c1 3300050495 Bacteria 703
297 nmdc:mga07m45_23463_c1 3300050496 Bacteria 3373
298 nmdc:mga0n895_454939_c1 3300050512 Bacteria 1292
299 nmdc:mga0sz30_431328_c1 3300050516 Bacteria 591
300 Ga0495619_0409785 3300053085 Bacteria 936
301 Ga0500643_002631 3300053087 Bacteria 9092
302 Ga0500643_011301 3300053087 Bacteria 3264
303 Ga0500644_0001135 3300053088 Bacteria 7777
304 Ga0500646_0027142 3300053090 Bacteria 1556
305 Ga0500646_0194309 3300053090 Bacteria 693
306 Ga0500647_0025166 3300053091 Bacteria 2804
307 Ga0500583_0139145 3300053092 Bacteria 1206
308 Ga0500651_0052487 3300053093 Bacteria 2557
309 Ga0500651_0081234 3300053093 Bacteria 2007
310 Ga0500641_0020972 3300053096 Bacteria 2484
311 Ga0500650_0129476 3300053098 Bacteria 1173
312 Ga0500556_0000081 3300053104 Bacteria 90508
313 Ga0500557_021614 3300053105 Bacteria 1848
314 Ga0500562_046310 3300053108 Bacteria 1159
315 Ga0500572_000654 3300053111 Bacteria 11472
316 Ga0500592_002605 3300053116 Bacteria 2895
317 Ga0500594_0020989 3300053118 Bacteria 1634
318 Ga0500595_000001 3300053119 Bacteria 1088438
319 Ga0500595_006733 3300053119 Bacteria 4845
320 Ga0500642_0000042 3300053130 Bacteria 86476
321 Ga0500652_000365 3300053131 Bacteria 16300
322 Ga0500652_047774 3300053131 Bacteria 1740
323 Ga0500652_092789 3300053131 Bacteria 1261
324 Ga0500658_0013217 3300053134 Bacteria 3048
325 Ga0500588_0118278 3300053146 Bacteria 932
326 Ga0500590_125444 3300053148 Bacteria 1196
327 Ga0500604_0032413 3300053151 Bacteria 1539
328 Ga0500616_0000001 3300053153 Bacteria 1986011
329 Ga0500616_0000227 3300053153 Bacteria 88098
330 Ga0500624_000063 3300053157 Bacteria 65333
331 Ga0500627_0023721 3300053158 Bacteria 2503
332 Ga0500633_0050591 3300053160 Bacteria 1432
333 Ga0500634_0031442 3300053161 Bacteria 2894
334 Ga0500634_0035273 3300053161 Bacteria 2725
335 Ga0500636_0082184 3300053177 Bacteria 1854
336 Ga0500636_0351458 3300053177 Bacteria 703
337 Ga0500611_044838 3300053727 Bacteria 987
338 Ga0500645_000374 3300053730 Bacteria 31484
339 Ga0500645_011374 3300053730 Bacteria 2909
340 Ga0500645_049050 3300053730 Bacteria 1235
341 Ga0500552_002118 3300053733 Bacteria 1919
342 Ga0500601_004294 3300053737 Bacteria 1550
343 Ga0501082_0283754 3300060353 Bacteria 1441
344 Ga0530510_0232909 3300061734 Bacteria 1370
345 2512642858 2512564014 Bacteria 4639632
346 2513661179 2513237096 Bacteria 8722461
347 2513860414 2513237137 Bacteria 9558895
348 2513922849 2513237145 Bacteria 8979722
349 2517894114 2517572143 Bacteria 9484767
350 2599902921 2599185292 Bacteria 6290804
351 2643861744 2643221569 Bacteria 6064337
352 2643983221 2643221594 Bacteria 5811388
353 2644123482 2643221621 Bacteria 6212786
354 2644362122 2643221665 Bacteria 4699229
355 2644728526 2643221733 Bacteria 5690728
356 2728749515 2728368998 Bacteria 8720350
357 2793073095 2791355197 Bacteria 8420563
358 2809033254 2808606395 Bacteria 6020352
359 2857526549 2857524615 Bacteria 6615449
360 2894239208 2894232714 Bacteria 8834183
361 2904705226
362 2909047182 2909042592 Bacteria 6499737
363 2917703023 2917699015 Bacteria 7043791
364 2919073631 2919073203 Bacteria 6531949
365 2935637875 2935630451 Bacteria 8169952
366 2941482496
367 2941486903 2941485952 Bacteria 3591484
368 2941514548 2941507105 Bacteria 8166816
369 2941522444 2941515067 Bacteria 8166720
370 2941530315 2941523033 Bacteria 8169134
371 3005478389 3005474847 Bacteria 9259049
372 643597702 643348564 Bacteria 8839022
373 8006942844 8006933436 Bacteria 10410654
374 8006982563 8006973647 Bacteria 10679141
375 8019558604 8019555841 Bacteria 9642137
376 8019566695 8019565922 Bacteria 9639779
377 8055913729 8055909800 Bacteria 7278581
378 Ga0105240_10025147
379 JGI25151J46595_10000483
380 rootL2_10019792
381 JGI25404J52841_10029506
382 Ga0055526_1012680
383 Ga0055524_1000399
384 Ga0055534_1020391
385 JGI25405J52794_10034249
386 Ga0070683_100016081
387 Ga0070683_100017893
388 Ga0070683_100174531
389 Ga0068869_100253037
390 Ga0070669_101127263
391 Ga0070714_100256534
392 Ga0070713_100040143
393 Ga0070713_100923181
394 Ga0070710_10292347
395 Ga0070708_100370697
396 Ga0070663_100098184
397 Ga0070663_100498087
398 Ga0070663_100974378
399 Ga0070706_100090989
400 Ga0070707_100149757
401 Ga0070699_100343787
402 Ga0068853_100169068
403 Ga0070665_100689330
404 Ga0068855_100003510
405 Ga0068855_100475999
406 Ga0068856_100017871
407 Ga0068852_100136795
408 Ga0068859_100441450
409 Ga0068851_10191843
410 Ga0068858_100072264
411 Ga0068858_100122098
412 Ga0068858_100344527
413 Ga0081455_10071357
414 Ga0081540_1127211
415 Ga0081540_1139147
416 Ga0070717_10005767
417 Ga0070717_10016559
418 Ga0075365_10206656
419 Ga0075368_10001146
420 Ga0075368_10040496
421 Ga0070716_100291324
422 Ga0075367_10000114
423 Ga0075367_10173955
424 Ga0075367_10434741
425 Ga0075370_10039438
426 Ga0097620_100441454
427 Ga0099825_1031497
428 Ga0099824_1016379
429 Ga0099822_1010465
430 Ga0099794_10029658
431 Ga0099794_10197457
432 Ga0105251_10011413
433 Ga0105244_10001932
434 Ga0105240_10001711
435 Ga0105245_10004848
436 Ga0105247_10024524
437 Ga0105241_10133051
438 Ga0105242_10335469
439 Ga0105248_10131387
440 Ga0105237_10020180
441 Ga0105237_10053443
442 Ga0105237_10188444
443 Ga0105237_10199135
444 Ga0105237_10213837
445 Ga0105237_10374316
446 Ga0105238_10110622
447 Ga0105249_10107391
448 Ga0123341_1006390
449 Ga0123342_1009831
450 Ga0105239_10007012
451 Ga0105239_10008619
452 Ga0105239_10049032
453 Ga0105239_10054359
454 Ga0157373_10354241
455 Ga0157371_10116024
456 Ga0157370_10127322
457 Ga0157369_10031850
458 Ga0157369_10093718
459 Ga0157369_10801270
460 Ga0171462_1051
461 Ga0157372_10059785
462 Ga0157372_10355354
463 Ga0157375_10016220
464 Ga0157375_11312408
465 Ga0163163_10252866
466 Ga0163163_10753117
467 Ga0157377_10206403
468 Ga0163161_10104073
469 Ga0163161_10311372
470 Ga0163161_10472684
471 Ga0213872_10021926
472 Ga0213872_10032757
473 Ga0213872_10091252
474 Ga0213872_10216951
475 Ga0213875_10013717
476 Ga0213871_10090541
477 Ga0209677_101499
478 Ga0209233_1000931
479 Ga0209455_1001426
480 Ga0209455_1005466
481 Ga0209675_1000515
482 Ga0209025_1000357
483 Ga0209564_1012446
484 Ga0209256_1000876
485 Ga0207655_1000731
486 Ga0207655_1000997
487 Ga0207710_10053024
488 Ga0207647_10015649
489 Ga0207647_10351239
490 Ga0207684_10094978
491 Ga0207695_10001652
492 Ga0207671_10032701
493 Ga0207671_10050595
494 Ga0207671_10138308
495 Ga0207671_10142223
496 Ga0207671_10784380
497 Ga0207646_10858306
498 Ga0207694_10007659
499 Ga0207687_10000912
500 Ga0207700_10026402
501 Ga0207700_10070283
502 Ga0207686_10114918
503 Ga0207665_10338962
504 Ga0207711_10007537
505 Ga0207711_10526542
506 Ga0207667_10002955
507 Ga0207703_10101902
508 Ga0207703_10567979
509 Ga0207639_10211043
510 Ga0207678_10007286
511 Ga0207678_10551882
512 Ga0207702_10016031
513 Ga0207698_10053582
514 Ga0209589_1000018
515 Ga0209489_100026
516 Ga0209700_100035
517 Ga0209588_1021097
518 Ga0209588_1156155
519 Ga0209588_1163903
520 Ga0209813_10000134
521 Ga0268266_10565624
522 Ga0265334_10014863
523 Ga0265336_10000682
524 Ga0307515_10092532
525 Ga0265338_10000746
526 Ga0265324_10012913
527 Ga0265332_10156866
528 Ga0265328_10089117
529 Ga0265325_10178935
530 Ga0265340_10022471
531 Ga0265339_10022401
532 Ga0265316_10048748
533 Ga0307513_10254364
534 Ga0265313_10004280
535 Ga0265314_10091948
536 Ga0265342_10087434
537 Ga0265342_10201084
538 Ga0307405_10381180
539 Ga0307413_10274017
540 Ga0307410_10098270
541 Ga0307416_100409280
542 Ga0307414_10540579
543 Ga0307414_10752137
544 Ga0307414_11077149
545 Ga0307415_100035854
546 Ga0372808_001167
547 Ga0373925_0096989
548 Ga0436365_1128725
549 Ga0436365_1472677
550 Ga0436365_1914126
551 Ga0436360_1062717
552 Ga0436361_0344309
553 Ga0436361_0822154
554 Ga0436361_1222200
555 Ga0436362_0043050
556 Ga0451853_3785624
557 Ga0466969_0093950
558 Ga0466966_0318792
559 Ga0466964_0069254
560 Ga0466957_0017366
561 Ga0466959_0089580
562 Ga0466959_0258550
563 Ga0466959_0521059
564 Ga0466959_0634475
565 Ga0495617_007344
566 Ga0495627_000089
567 Ga0495627_001449
568 Ga0495627_011315
569 Ga0495638_0020311
570 Ga0495638_0046716
571 Ga0495653_0513461
572 Ga0495582_0224468
573 Ga0495584_0123398
574 Ga0495596_0159201
575 Ga0495607_0045106
576 Ga0495606_0057008
577 Ga0495610_0000186
578 Ga0495610_0036307
579 Ga0495616_0020118
580 Ga0495620_0025669
581 Ga0495631_0096643
582 Ga0495632_0000001
583 Ga0495637_0000417
584 Ga0495637_0009051
585 Ga0495637_0088173
586 Ga0495643_0000020
587 Ga0495643_0042004
588 Ga0495648_0029396
589 Ga0495648_0032833
590 Ga0495663_0000002
591 Ga0495654_0011888
592 Ga0495665_0016048
593 Ga0495586_0024615
594 Ga0495587_0138841
595 Ga0495645_0109789
596 Ga0495633_0000276
597 Ga0495633_0007732
598 Ga0495633_0071593
599 Ga0495668_0029351
600 Ga0495625_0090229
601 Ga0495661_0087319
602 Ga0495588_0408241
603 Ga0495599_0012461
604 Ga0495670_0005603
605 Ga0495671_0000016
606 Ga0495671_0030898
607 Ga0495675_0230892
608 Ga0495673_0073396
609 Ga0495673_0087231
610 Ga0495681_0000103
611 Ga0495681_0091116
612 Ga0495684_0258164
613 Ga0495686_0028173
614 Ga0495686_0100198
615 Ga0495686_0288534
616 Ga0496102_0146149
617 Ga0496110_0807266
618 Ga0496114_0160416
619 Ga0496115_0112636
620 Ga0496115_0325320
621 Ga0496115_0401558
622 Ga0496116_0048401
623 Ga0496116_0133132
624 Ga0496117_0049736
625 Ga0496117_0193502
626 Ga0496117_0376491
627 Ga0496118_0013338
628 Ga0496118_0015328
629 Ga0496118_0100911
630 Ga0496119_0071439
631 Ga0496120_0042211
632 Ga0496121_0003730
633 Ga0496121_0004075
634 Ga0496121_0209256
635 Ga0496121_0247753
636 Ga0496122_0089431
637 Ga0496123_0104255
638 Ga0496123_0104765
639 Ga0496124_0019200
640 Ga0496124_0062524
641 Ga0496124_0088844
642 Ga0496124_0212561
643 Ga0496124_0326025
644 Ga0496125_0000869
645 Ga0496125_0003929
646 Ga0496125_0013173
647 Ga0496125_0050458
648 Ga0496125_0098430
649 Ga0496125_0118793
650 Ga0496125_0265080
651 Ga0496126_0042530
652 Ga0496126_0044356
653 Ga0496126_0082924
654 Ga0496126_0182636
655 Ga0496126_0202429
656 Ga0496126_0433617
657 Ga0496126_0642292
658 Ga0495678_021922
659 Ga0501036_0150804
660 Ga0501042_0590973
661 Ga0501074_0232523
662 Ga0501074_0431026
663 Ga0501076_0162046
664 Ga0501077_0045990
665 Ga0501079_0061370
666 Ga0501080_0360351
667 Ga0501081_0037021
668 Ga0501045_0091968
669 nmdc:mga00v17_389939_c1
670 nmdc:mga0yw44_73275_c1
671 nmdc:mga0yw44_79738_c1
672 nmdc:mga06z11_179_c1
673 nmdc:mga04h51_255480_c1
674 nmdc:mga07m45_23463_c1
675 nmdc:mga0n895_454939_c1
676 nmdc:mga0sz30_431328_c1
677 Ga0495619_0409785
678 Ga0500643_002631
679 Ga0500643_011301
680 Ga0500644_0001135
681 Ga0500646_0027142
682 Ga0500646_0194309
683 Ga0500647_0025166
684 Ga0500583_0139145
685 Ga0500651_0052487
686 Ga0500651_0081234
687 Ga0500641_0020972
688 Ga0500650_0129476
689 Ga0500556_0000081
690 Ga0500557_021614
691 Ga0500562_046310
692 Ga0500572_000654
693 Ga0500592_002605
694 Ga0500594_0020989
695 Ga0500595_000001
696 Ga0500595_006733
697 Ga0500642_0000042
698 Ga0500652_000365
699 Ga0500652_047774
700 Ga0500652_092789
701 Ga0500658_0013217
702 Ga0500588_0118278
703 Ga0500590_125444
704 Ga0500604_0032413
705 Ga0500616_0000001
706 Ga0500616_0000227
707 Ga0500624_000063
708 Ga0500627_0023721
709 Ga0500633_0050591
710 Ga0500634_0031442
711 Ga0500634_0035273
712 Ga0500636_0082184
713 Ga0500636_0351458
714 Ga0500611_044838
715 Ga0500645_000374
716 Ga0500645_011374
717 Ga0500645_049050
718 Ga0500552_002118
719 Ga0500601_004294
720 Ga0501082_0283754
721 Ga0530510_0232909
722 2512642858
723 2513661179
724 2513860414
725 2513922849
726 2517894114
727 2599902921
728 2643861744
729 2643983221
730 2644123482
731 2644362122
732 2644728526
733 2728749515
734 2793073095
735 2809033254
736 2857526549
737 2894239208
738 2904705226
739 2909047182
740 2917703023
741 2919073631
742 2935637875
743 2941482496
744 2941486903
745 2941514548
746 2941522444
747 2941530315
748 3005478389
749 643597702
750 8006942844
751 8006982563
752 8019558604
753 8019566695
754 8055913729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

43

143

0.87

PF13460

NAD_binding_10

NAD(P)H-binding

47

233

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dhn-assembly1.cif.gz_A crystal structure of the putative epimerase q89z24_bactn from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr310. 0.9525 3 207
3dhn-assembly1.cif.gz_A crystal structure of the putative epimerase q89z24_bactn from bacteroides thetaiotaomicron. northeast structural genomics consortium target btr310. 0.9391 3 207
4jgb-assembly1.cif.gz_A crystal structure of putative exported protein from burkholderia pseudomallei 0.9143 5 207
4jgb-assembly2.cif.gz_B crystal structure of putative exported protein from burkholderia pseudomallei 0.9012 5 207
4jgb-assembly1.cif.gz_A crystal structure of putative exported protein from burkholderia pseudomallei 0.8973 5 207
ID Description Score Start End Superfamily
3dhnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9248 3 207 3.40.50.720
af_A0A0P0VRA9_18_110_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9123 5 74 3.40.50.720
3dhnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9118 3 207 3.40.50.720
af_Q4D6Y2_461_606_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.906 2 40 3.40.50.720
4jgbB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9012 5 207 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A436I2N4-F1-model_v4 deleted 1.007 5 75
AF-A0A526V0F8-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 1.003 5 100 GO:0016646
AF-A0A3D2CV11-F1-model_v4 deleted 0.9991 5 74
AF-M1ZR79-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9954 119 207 GO:0016646
AF-A0A090DHJ8-F1-model_v4 NAD(P)-binding domain-containing protein 0.9952 6 207 GO:0016646

Map