F427532

General Info

Members Datasets Scaffolds Average Seq Length
376 281 340 485

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2501939600|2501939734
Length 510
Sequence MTQTAPGTAPAPVPLERVTHWIDGKPFAGVTERTAPVYDPALGAVRTEVPLASVDEVDQAVASAAAAFASWRTSSLTKRTQVLFAFRELVNRHKQELAELITAEHGKVVSDALGEVTRGLEVVEFACGIPHLLKGGYSEGVSTNVDVYSIRQPVGVCAVISPFNFPVMVPMWFVPIAIAAGNTVVLKPSEKDPSASLLVARLWEQAGLPAGVFNVVHGDKVAVDRLLEHPEVKAVSFVGSTPIARYVYETGTRNGKRVQALGGAKNHMVVLPDADLDLAADAAVNAGFGSAGERCMAISALVVVEPVADDLVARIRERIATLKVGDGRRSCDMGPLVTKEHRDRVASYLDAGVEAGAELVVDGRDVRADGDESGFWLGPSLLDRVSPEMSVYTDEIFGPVLSVVRVGSYDEALALVNANRYGNGTAIFTNDGGAARRFQNEVEVGMVGVNVPIPVPMAYYSFGGWKDSLFGDSHAHGAEGVHFFTRGKVVTSRWLDPSHGGINLGFPENV

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
4 2643221613 Oerskovia sp. Root22 Isolate Unclassified
5 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
6 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
7 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
8 2643221679 Angustibacter sp. Root456 Isolate Unclassified
9 2643221721 Oerskovia sp. Root918 Isolate Unclassified
10 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
11 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
12 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
13 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
14 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
15 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
16 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
17 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
18 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
19 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
20 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
21 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
22 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
23 2891562705 Microbispora tritici MT50 Isolate Unclassified
24 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
25 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
26 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
27 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
28 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
29 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
30 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
31 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
32 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
33 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
34 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
143 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
166 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
167 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
245 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
246 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
247 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
262 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
263 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
264 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
265 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
266 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
267 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
268 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
269 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
270 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
271 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
272 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
273 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
276 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
279 649633069 Micromonospora sp. L5 Isolate Unclassified
280 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
281 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.63
Metatranscriptomes 0.8
Isolates 9.57

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0
Endosphere 4.52
Nodule 0
Rhizoplane 2.66
Rhizosphere 78.19
Stem 0
Stem Tuber 0
Unclassified 14.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10005644 3300003203 Bacteria 5789
2 rootH2_10079573 3300003320 Bacteria 4624
3 Ga0070683_100054265 3300005329 Bacteria 3716
4 Ga0070690_100001897 3300005330 Bacteria 11099
5 Ga0070690_100002660 3300005330 Bacteria 9628
6 Ga0068869_100011210 3300005334 Bacteria 5873
7 Ga0070666_10019259 3300005335 Bacteria 4402
8 Ga0070682_100007558 3300005337 Bacteria 6122
9 Ga0070660_100046734 3300005339 Bacteria 3319
10 Ga0070689_100023063 3300005340 Bacteria 4656
11 Ga0070661_100003282 3300005344 Bacteria 11169
12 Ga0070692_10004130 3300005345 Bacteria 6005
13 Ga0070675_100012661 3300005354 Bacteria 6617
14 Ga0070671_100161062 3300005355 Bacteria 1897
15 Ga0070659_100035917 3300005366 Bacteria 3861
16 Ga0070709_10001288 3300005434 Bacteria 13707
17 Ga0070714_100005719 3300005435 Bacteria 9529
18 Ga0070714_100011426 3300005435 Bacteria 7043
19 Ga0070714_100013938 3300005435 Bacteria 6450
20 Ga0070713_100000541 3300005436 Bacteria 23963
21 Ga0070713_100040455 3300005436 Bacteria 3790
22 Ga0070662_100049200 3300005457 Bacteria 3039
23 Ga0070698_100026244 3300005471 Bacteria 6065
24 Ga0070679_100103880 3300005530 Bacteria 2828
25 Ga0070684_100036893 3300005535 Bacteria 4190
26 Ga0070665_100017867 3300005548 Bacteria 7120
27 Ga0070665_100045224 3300005548 Bacteria 4421
28 Ga0070665_100045260 3300005548 Bacteria 4420
29 Ga0068855_100012008 3300005563 Bacteria 10472
30 Ga0068855_100025480 3300005563 Bacteria 7075
31 Ga0068857_100031404 3300005577 Bacteria 4693
32 Ga0068854_100050692 3300005578 Bacteria 2971
33 Ga0068856_100087732 3300005614 Bacteria 3093
34 Ga0068852_100027013 3300005616 Bacteria 4673
35 Ga0068852_100247142 3300005616 Bacteria 1708
36 Ga0068859_100023946 3300005617 Bacteria 6127
37 Ga0068863_100003147 3300005841 Bacteria 16290
38 Ga0068858_100033940 3300005842 Bacteria 4733
39 Ga0068858_100051874 3300005842 Bacteria 3795
40 Ga0068860_100007014 3300005843 Bacteria 11287
41 Ga0081455_10046100 3300005937 Bacteria 3786
42 Ga0081539_10000846 3300005985 Bacteria 58555
43 Ga0070717_10021469 3300006028 Bacteria 5088
44 Ga0070717_10033897 3300006028 Bacteria 4122
45 Ga0075365_10073683 3300006038 Bacteria 2302
46 Ga0070712_100008797 3300006175 Bacteria 6358
47 Ga0075434_100049836 3300006871 Bacteria 4159
48 Ga0075429_100046892 3300006880 Bacteria 3760
49 Ga0097620_100023951 3300006931 Bacteria 6127
50 Ga0105251_10009073 3300009011 Bacteria 5921
51 Ga0111539_10009078 3300009094 Bacteria 12586
52 Ga0105245_10000114 3300009098 Bacteria 78195
53 Ga0105245_10005849 3300009098 Bacteria 10800
54 Ga0114129_10159845 3300009147 Bacteria 3079
55 Ga0105241_10001107 3300009174 Bacteria 20507
56 Ga0105242_10081061 3300009176 Bacteria 2713
57 Ga0105248_10002021 3300009177 Bacteria 22495
58 Ga0105238_10007120 3300009551 Bacteria 11192
59 Ga0105238_10347286 3300009551 Bacteria 1472
60 Ga0105239_10030303 3300010375 Bacteria 5947
61 Ga0105246_10008511 3300011119 Bacteria 6308
62 Ga0157371_10026713 3300013102 Bacteria 4193
63 Ga0157369_10046375 3300013105 Bacteria 4723
64 Ga0157374_10010668 3300013296 Bacteria 7915
65 Ga0157374_10010881 3300013296 Bacteria 7851
66 Ga0157372_10015051 3300013307 Bacteria 8280
67 Ga0157372_10204493 3300013307 Bacteria 2288
68 Ga0157377_10000534 3300014745 Bacteria 16151
69 Ga0157379_10008756 3300014968 Bacteria 8822
70 Ga0157376_10016113 3300014969 Bacteria 5666
71 Ga0197907_11449058 3300020069 Bacteria 2744
72 Ga0213876_10010514 3300021384 Bacteria 4963
73 Ga0213875_10002068 3300021388 Bacteria 12317
74 Ga0213875_10030719 3300021388 Bacteria 2542
75 Ga0224712_10012425 3300022467 Bacteria 2679
76 Ga0224712_10026661 3300022467 Bacteria 2046
77 Ga0207713_1015766 3300025735 Bacteria 3862
78 Ga0207688_10009983 3300025901 Bacteria 5166
79 Ga0207699_10030302 3300025906 Bacteria 3026
80 Ga0207707_10008896 3300025912 Bacteria 8720
81 Ga0207695_10027241 3300025913 Bacteria 6367
82 Ga0207695_10037369 3300025913 Bacteria 5239
83 Ga0207695_10137068 3300025913 Bacteria 2400
84 Ga0207671_10000313 3300025914 Bacteria 71480
85 Ga0207693_10047764 3300025915 Bacteria 3362
86 Ga0207663_10021086 3300025916 Bacteria 3703
87 Ga0207660_10083144 3300025917 Bacteria 2357
88 Ga0207657_10042526 3300025919 Bacteria 4008
89 Ga0207694_10002137 3300025924 Bacteria 16242
90 Ga0207659_10002633 3300025926 Bacteria 10690
91 Ga0207687_10000051 3300025927 Bacteria 92954
92 Ga0207700_10000785 3300025928 Bacteria 18352
93 Ga0207700_10072586 3300025928 Bacteria 2655
94 Ga0207700_10132668 3300025928 Bacteria 2036
95 Ga0207664_10000404 3300025929 Bacteria 30859
96 Ga0207664_10010749 3300025929 Bacteria 6475
97 Ga0207664_10012413 3300025929 Bacteria 6089
98 Ga0207706_10017394 3300025933 Bacteria 6477
99 Ga0207706_10216935 3300025933 Bacteria 1676
100 Ga0207686_10107416 3300025934 Bacteria 1876
101 Ga0207670_10011478 3300025936 Bacteria 5147
102 Ga0207711_10046148 3300025941 Bacteria 3722
103 Ga0207689_10001441 3300025942 Bacteria 22747
104 Ga0207689_10028975 3300025942 Bacteria 4628
105 Ga0207661_10000490 3300025944 Bacteria 25452
106 Ga0207679_10000314 3300025945 Bacteria 36372
107 Ga0207667_10067025 3300025949 Bacteria 3739
108 Ga0207667_10082367 3300025949 Bacteria 3333
109 Ga0207668_10050403 3300025972 Bacteria 2869
110 Ga0207640_10031313 3300025981 Bacteria 3285
111 Ga0207703_10042975 3300026035 Bacteria 3626
112 Ga0207708_10132877 3300026075 Bacteria 1947
113 Ga0207702_10072391 3300026078 Bacteria 2970
114 Ga0207641_10131211 3300026088 Bacteria 2250
115 Ga0207676_10003858 3300026095 Bacteria 10586
116 Ga0207674_10000656 3300026116 Bacteria 45006
117 Ga0207674_10002764 3300026116 Bacteria 21895
118 Ga0207698_10038720 3300026142 Bacteria 3525
119 Ga0207698_10101984 3300026142 Bacteria 2381
120 Ga0207428_10024979 3300027907 Bacteria 5010
121 Ga0268266_10015033 3300028379 Bacteria 6644
122 Ga0268266_10032081 3300028379 Bacteria 4462
123 Ga0268264_10011659 3300028381 Bacteria 7249
124 Ga0265319_1019264 3300028563 Bacteria 2552
125 Ga0265318_10004559 3300028577 Bacteria 6694
126 Ga0307517_10006962 3300028786 Bacteria 16612
127 Ga0307517_10007273 3300028786 Bacteria 16188
128 Ga0307517_10037385 3300028786 Bacteria 5424
129 Ga0307515_10000541 3300028794 Bacteria 88944
130 Ga0265338_10000073 3300028800 Bacteria 181521
131 Ga0265338_10003474 3300028800 Bacteria 22142
132 Ga0265332_10010797 3300031238 Bacteria 4059
133 Ga0265325_10008103 3300031241 Bacteria 6226
134 Ga0265325_10051474 3300031241 Bacteria 2117
135 Ga0265339_10009068 3300031249 Bacteria 6284
136 Ga0265331_10014773 3300031250 Bacteria 4145
137 Ga0265316_10057053 3300031344 Bacteria 3047
138 Ga0307509_10001164 3300031507 Bacteria 44979
139 Ga0307509_10004629 3300031507 Bacteria 19673
140 Ga0307509_10083937 3300031507 Bacteria 3282
141 Ga0265313_10001810 3300031595 Bacteria 19558
142 Ga0307508_10083619 3300031616 Bacteria 2774
143 Ga0307508_10124049 3300031616 Bacteria 2185
144 Ga0307514_10025423 3300031649 Bacteria 4790
145 Ga0316579_10045112 3300031691 Bacteria 2055
146 Ga0307516_10027943 3300031730 Bacteria 5714
147 Ga0307415_100004912 3300032126 Bacteria 7023
148 Ga0307507_10000001 3300033179 Bacteria 417520
149 Ga0307507_10119514 3300033179 Bacteria 2114
150 Ga0373934_0006853 3300035086 Bacteria 4229
151 Ga0373954_0024071 3300035118 Bacteria 2774
152 Ga0373956_0002539 3300035119 Bacteria 7419
153 Ga0373943_0003248 3300035170 Bacteria 7378
154 Ga0373943_0018138 3300035170 Bacteria 3230
155 Ga0373946_0006849 3300035171 Bacteria 4147
156 Ga0373955_0000331 3300035172 Bacteria 19705
157 Ga0373961_0000156 3300035241 Bacteria 32884
158 Ga0373924_0003761 3300035410 Bacteria 5244
159 Ga0373927_0002032 3300035695 Bacteria 14898
160 Ga0373927_0005992 3300035695 Bacteria 8324
161 Ga0373947_0026753 3300035725 Bacteria 3373
162 Ga0373947_0044802 3300035725 Bacteria 2646
163 Ga0373937_0001088 3300036401 Bacteria 22904
164 Ga0373925_0002378 3300037068 Bacteria 15091
165 Ga0373925_0014913 3300037068 Bacteria 5616
166 Ga0395899_0001617 3300037312 Bacteria 18830
167 Ga0395900_0040290 3300037418 Bacteria 4814
168 Ga0395898_0099675 3300037466 Bacteria 2790
169 Ga0395898_0104177 3300037466 Bacteria 2721
170 Ga0395898_0155691 3300037466 Bacteria 2186
171 Ga0395905_0102920 3300037471 Bacteria 2681
172 Ga0436364_0108192 3300037853 Bacteria 28498
173 Ga0436364_1263823 3300037853 Bacteria 35965
174 Ga0395901_0063916 3300038443 Bacteria 3830
175 Ga0395901_0105569 3300038443 Bacteria 2956
176 Ga0450896_001153 3300042133 Bacteria 3149
177 Ga0450898_007468 3300042134 Bacteria 1704
178 Ga0450906_002787 3300042145 Bacteria 3809
179 Ga0466969_0018777 3300044656 Bacteria 3598
180 Ga0466969_0035869 3300044656 Bacteria 2507
181 Ga0466965_0007567 3300044683 Bacteria 4996
182 Ga0466966_0005864 3300044684 Bacteria 8101
183 Ga0466966_0021660 3300044684 Bacteria 4219
184 Ga0466961_0002090 3300044693 Bacteria 12444
185 Ga0466961_0010801 3300044693 Bacteria 5832
186 Ga0466961_0033267 3300044693 Bacteria 3313
187 Ga0466961_0065558 3300044693 Bacteria 2308
188 Ga0466961_0083151 3300044693 Bacteria 2024
189 Ga0466963_0011336 3300044694 Bacteria 5425
190 Ga0466963_0053976 3300044694 Bacteria 2670
191 Ga0466964_0020119 3300044706 Bacteria 2569
192 Ga0453684_0246297 3300044712 Bacteria 2055
193 Ga0466971_0000060 3300044719 Bacteria 42431
194 Ga0466971_0001837 3300044719 Bacteria 9021
195 Ga0466971_0006463 3300044719 Bacteria 5092
196 Ga0466970_0013738 3300044765 Bacteria 4152
197 Ga0466960_0008681 3300044901 Bacteria 4169
198 Ga0466960_0015178 3300044901 Bacteria 3316
199 Ga0466959_0000813 3300045049 Bacteria 18384
200 Ga0466959_0028755 3300045049 Bacteria 4119
201 Ga0466959_0050280 3300045049 Bacteria 3060
202 Ga0466958_0053576 3300045836 Bacteria 2446
203 Ga0466967_0011120 3300045976 Bacteria 6799
204 Ga0466967_0016854 3300045976 Bacteria 5777
205 Ga0466967_0120754 3300045976 Bacteria 2421
206 Ga0495592_0012073 3300046454 Bacteria 6548
207 Ga0495592_0087670 3300046454 Bacteria 2238
208 Ga0495603_0010808 3300046455 Bacteria 5539
209 Ga0495603_0034717 3300046455 Bacteria 3031
210 Ga0495629_0007359 3300046459 Bacteria 8116
211 Ga0495629_0012534 3300046459 Bacteria 6139
212 Ga0495629_0016720 3300046459 Bacteria 5264
213 Ga0495629_0062914 3300046459 Bacteria 2591
214 Ga0495629_0118287 3300046459 Bacteria 1846
215 Ga0495651_0000746 3300046462 Bacteria 25159
216 Ga0495651_0004099 3300046462 Bacteria 11147
217 Ga0495651_0005034 3300046462 Bacteria 10094
218 Ga0495651_0011792 3300046462 Bacteria 6718
219 Ga0495653_0037978 3300046463 Bacteria 3780
220 Ga0495580_0001689 3300046472 Bacteria 19379
221 Ga0495582_0001587 3300046473 Bacteria 12827
222 Ga0495639_0003187 3300046475 Bacteria 7124
223 Ga0495608_0005863 3300046511 Bacteria 8743
224 Ga0495618_0016281 3300046514 Bacteria 4547
225 Ga0495618_0063523 3300046514 Bacteria 2344
226 Ga0495628_0031001 3300046516 Bacteria 4325
227 Ga0495628_0173261 3300046516 Bacteria 1635
228 Ga0495630_0001821 3300046517 Bacteria 14872
229 Ga0495630_0033547 3300046517 Bacteria 3829
230 Ga0495643_0001114 3300046522 Bacteria 26618
231 Ga0495652_0000965 3300046529 Bacteria 32930
232 Ga0495652_0002668 3300046529 Bacteria 18144
233 Ga0495652_0005365 3300046529 Bacteria 12084
234 Ga0495652_0062143 3300046529 Bacteria 3150
235 Ga0495665_0001407 3300046531 Bacteria 12888
236 Ga0495645_0007885 3300046543 Bacteria 7408
237 Ga0495645_0021208 3300046543 Bacteria 4695
238 Ga0495645_0039062 3300046543 Bacteria 3461
239 Ga0495667_0027178 3300046559 Bacteria 3857
240 Ga0495625_0039498 3300046660 Bacteria 3445
241 Ga0495635_0014829 3300046663 Bacteria 5451
242 Ga0495635_0027228 3300046663 Bacteria 3976
243 Ga0495588_0000462 3300046674 Bacteria 20373
244 Ga0495588_0009541 3300046674 Bacteria 4490
245 Ga0495599_0019579 3300046678 Bacteria 4219
246 Ga0495646_0001102 3300046680 Bacteria 15721
247 Ga0495658_0000812 3300046683 Bacteria 16764
248 Ga0495613_0006807 3300046689 Bacteria 8536
249 Ga0495670_0009064 3300046691 Bacteria 4895
250 Ga0495671_0034357 3300046692 Bacteria 2578
251 Ga0495600_0005058 3300046809 Bacteria 7921
252 Ga0495600_0031149 3300046809 Bacteria 3454
253 Ga0495660_0016992 3300046810 Bacteria 4190
254 Ga0495581_0004758 3300047315 Bacteria 7839
255 Ga0495604_0043468 3300047317 Bacteria 3517
256 Ga0495604_0069032 3300047317 Bacteria 2680
257 Ga0495604_0083067 3300047317 Bacteria 2394
258 Ga0495674_0030281 3300047319 Bacteria 4922
259 Ga0495687_001148 3300047443 Bacteria 25640
260 Ga0495675_0008928 3300047444 Bacteria 6230
261 Ga0495675_0018943 3300047444 Bacteria 4372
262 Ga0495685_002731 3300047447 Bacteria 5562
263 Ga0495685_041331 3300047447 Bacteria 1576
264 Ga0495681_0001712 3300047470 Bacteria 16221
265 Ga0495681_0001954 3300047470 Bacteria 15086
266 Ga0495684_0003777 3300047471 Bacteria 11824
267 Ga0495686_0026169 3300047472 Bacteria 3818
268 Ga0495593_0007945 3300047673 Bacteria 6179
269 Ga0495602_0011279 3300048088 Bacteria 9244
270 Ga0495614_0005368 3300048089 Bacteria 5781
271 Ga0496101_0001210 3300048904 Bacteria 15447
272 Ga0496101_0074699 3300048904 Bacteria 2494
273 Ga0496105_0032658 3300048908 Bacteria 4273
274 Ga0496107_0070315 3300048910 Bacteria 2541
275 Ga0496109_0004390 3300048912 Bacteria 11780
276 Ga0496109_0100776 3300048912 Bacteria 2680
277 Ga0496110_0032098 3300048913 Bacteria 4533
278 Ga0496114_0025379 3300048917 Bacteria 4843
279 Ga0496114_0102309 3300048917 Bacteria 2447
280 Ga0496115_0009224 3300048918 Bacteria 7325
281 Ga0496117_0008510 3300048920 Bacteria 9730
282 Ga0496118_0000360 3300048921 Bacteria 77010
283 Ga0496119_0044992 3300048922 Bacteria 2772
284 Ga0496121_0042132 3300048924 Bacteria 3978
285 Ga0496122_0083232 3300048925 Bacteria 2219
286 Ga0496124_0000173 3300048927 Bacteria 129688
287 Ga0496126_0000003 3300048929 Bacteria 961576
288 Ga0496126_0124408 3300048929 Bacteria 2233
289 Ga0501031_0060209 3300049568 Bacteria 2475
290 Ga0501033_0014121 3300049570 Bacteria 6071
291 Ga0501033_0093981 3300049570 Bacteria 2193
292 Ga0501034_0010750 3300049571 Bacteria 9506
293 Ga0501036_0005584 3300049572 Bacteria 10201
294 Ga0501036_0027965 3300049572 Bacteria 4767
295 Ga0501039_0143915 3300049575 Bacteria 1873
296 Ga0501043_0085578 3300049579 Bacteria 2477
297 Ga0501046_0027505 3300049580 Bacteria 4638
298 Ga0501067_0040733 3300049583 Bacteria 2579
299 Ga0501070_0007529 3300049586 Bacteria 9252
300 Ga0501070_0128660 3300049586 Bacteria 2092
301 Ga0501216_000700 3300049660 Bacteria 4135
302 Ga0501217_001118 3300049661 Bacteria 4902
303 Ga0501227_001402 3300049665 Bacteria 5394
304 Ga0501225_0006877 3300049705 Bacteria 3317
305 Ga0501080_0110545 3300049742 Bacteria 2547
306 Ga0501081_0123124 3300049743 Bacteria 1849
307 Ga0501083_0000016 3300049744 Bacteria 156309
308 Ga0501083_0026183 3300049744 Bacteria 4033
309 Ga0501035_0006134 3300049822 Bacteria 11317
310 Ga0501044_0094612 3300049823 Bacteria 3012
311 Ga0501045_0014034 3300049824 Bacteria 5670
312 nmdc:mga09592_16663_c1 3300050508 Bacteria 6013
313 nmdc:mga08y16_14406_c1 3300050511 Bacteria 8320
314 nmdc:mga0n895_188279_c1 3300050512 Bacteria 2095
315 Ga0495601_0014672 3300053077 Bacteria 4725
316 Ga0495612_0007843 3300053078 Bacteria 4353
317 Ga0495612_0034244 3300053078 Bacteria 2056
318 Ga0495595_0058377 3300053084 Bacteria 1802
319 Ga0495619_0020883 3300053085 Bacteria 4176
320 Ga0495619_0064376 3300053085 Bacteria 2444
321 Ga0500578_0048214 3300053086 Bacteria 2733
322 Ga0500566_0009775 3300053094 Bacteria 5664
323 Ga0500640_008614 3300053095 Bacteria 4041
324 Ga0500554_001102 3300053102 Bacteria 5225
325 Ga0500560_011274 3300053107 Bacteria 2274
326 Ga0500595_000822 3300053119 Bacteria 17876
327 Ga0500621_051385 3300053126 Bacteria 1668
328 Ga0500628_002706 3300053129 Bacteria 2918
329 Ga0500658_0003443 3300053134 Bacteria 5973
330 Ga0500559_0000584 3300053136 Bacteria 25005
331 Ga0500568_0014198 3300053139 Bacteria 3605
332 Ga0500573_0073773 3300053140 Bacteria 1944
333 Ga0500600_0018549 3300053149 Bacteria 4192
334 Ga0500616_0088369 3300053153 Bacteria 1540
335 Ga0500633_0002180 3300053160 Bacteria 3964
336 Ga0500634_0010312 3300053161 Bacteria 4768
337 Ga0501082_0015412 3300060353 Bacteria 6579
338 Ga0466962_0004724 3300061719 Bacteria 6546
339 Ga0466962_0005401 3300061719 Bacteria 6146
340 Ga0466962_0006959 3300061719 Bacteria 5422

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046516 Ga0495628_0173261 Ga0495628_0173261_37_1329 397
2 3300045976 Ga0466967_0120754 Ga0466967_0120754_1090_2376 408
3 3300035725 Ga0373947_0044802 Ga0373947_0044802_24_1316 409
4 3300046514 Ga0495618_0063523 Ga0495618_0063523_26_1318 409
5 3300049583 Ga0501067_0040733 Ga0501067_0040733_66_1358 409
6 3300049824 Ga0501045_0014034 Ga0501045_0014034_4360_5652 410
7 3300026116 Ga0207674_10002764 Ga0207674_1000276417 416
8 3300050512 nmdc:mga0n895_188279_c1 nmdc:mga0n895_188279_c1_24_1523 416
9 iso_pu_bacteria 2880495981 2880502613 417
10 3300025933 Ga0207706_10216935 Ga0207706_102169352 431
11 3300048929 Ga0496126_0124408 Ga0496126_0124408_822_2186 431
12 3300035170 Ga0373943_0018138 Ga0373943_0018138_1308_2807 435
13 3300025901 Ga0207688_10009983 Ga0207688_100099833 436
14 3300006871 Ga0075434_100049836 Ga0075434_1000498361 443
15 3300053126 Ga0500621_051385 Ga0500621_051385_11_1408 443
16 3300053153 Ga0500616_0088369 Ga0500616_0088369_12_1409 443
17 3300005436 Ga0070713_100040455 Ga0070713_1000404553 446
18 3300025928 Ga0207700_10072586 Ga0207700_100725862 446
19 3300044693 Ga0466961_0010801 Ga0466961_0010801_2941_4431 447
20 3300044694 Ga0466963_0011336 Ga0466963_0011336_357_1847 447
21 3300005434 Ga0070709_10001288 Ga0070709_100012888 448
22 3300005435 Ga0070714_100005719 Ga0070714_1000057194 448
23 3300005436 Ga0070713_100000541 Ga0070713_1000005411 448
24 3300006028 Ga0070717_10021469 Ga0070717_100214694 448
25 3300006175 Ga0070712_100008797 Ga0070712_1000087976 448
26 3300025906 Ga0207699_10030302 Ga0207699_100303022 448
27 3300025915 Ga0207693_10047764 Ga0207693_100477643 448
28 3300025916 Ga0207663_10021086 Ga0207663_100210863 448
29 3300025928 Ga0207700_10000785 Ga0207700_100007851 448
30 3300025929 Ga0207664_10010749 Ga0207664_100107496 448
31 3300025917 Ga0207660_10083144 Ga0207660_100831442 449
32 3300038443 Ga0395901_0063916 Ga0395901_0063916_1716_3215 449
33 3300044901 Ga0466960_0015178 Ga0466960_0015178_484_2016 450
34 3300049568 Ga0501031_0060209 Ga0501031_0060209_191_1612 450
35 3300044719 Ga0466971_0006463 Ga0466971_0006463_419_1909 452
36 3300045049 Ga0466959_0028755 Ga0466959_0028755_440_1930 452
37 3300042133 Ga0450896_001153 Ga0450896_001153_1409_2911 454
38 3300042134 Ga0450898_007468 Ga0450898_007468_188_1690 454
39 3300042145 Ga0450906_002787 Ga0450906_002787_1829_3331 454
40 3300053084 Ga0495595_0058377 Ga0495595_0058377_29_1453 454
41 3300009551 Ga0105238_10347286 Ga0105238_103472861 455
42 3300037466 Ga0395898_0155691 Ga0395898_0155691_426_1925 458
43 3300005329 Ga0070683_100054265 Ga0070683_1000542652 459
44 3300005330 Ga0070690_100001897 Ga0070690_1000018976 459
45 3300005334 Ga0068869_100011210 Ga0068869_1000112102 459
46 3300005337 Ga0070682_100007558 Ga0070682_1000075581 459
47 3300005339 Ga0070660_100046734 Ga0070660_1000467342 459
48 3300005340 Ga0070689_100023063 Ga0070689_1000230632 459
49 3300005344 Ga0070661_100003282 Ga0070661_1000032826 459
50 3300005345 Ga0070692_10004130 Ga0070692_100041301 459
51 3300005354 Ga0070675_100012661 Ga0070675_1000126611 459
52 3300005355 Ga0070671_100161062 Ga0070671_1001610621 459
53 3300005366 Ga0070659_100035917 Ga0070659_1000359172 459
54 3300005457 Ga0070662_100049200 Ga0070662_1000492001 459
55 3300005535 Ga0070684_100036893 Ga0070684_1000368932 459
56 3300005563 Ga0068855_100025480 Ga0068855_1000254802 459
57 3300005577 Ga0068857_100031404 Ga0068857_1000314043 459
58 3300005614 Ga0068856_100087732 Ga0068856_1000877322 459
59 3300005616 Ga0068852_100247142 Ga0068852_1002471421 459
60 3300005617 Ga0068859_100023946 Ga0068859_1000239461 459
61 3300005841 Ga0068863_100003147 Ga0068863_1000031476 459
62 3300005842 Ga0068858_100051874 Ga0068858_1000518742 459
63 3300005843 Ga0068860_100007014 Ga0068860_1000070147 459
64 3300006931 Ga0097620_100023951 Ga0097620_1000239514 459
65 3300009098 Ga0105245_10005849 Ga0105245_100058494 459
66 3300009177 Ga0105248_10002021 Ga0105248_1000202111 459
67 3300010375 Ga0105239_10030303 Ga0105239_100303031 459
68 3300011119 Ga0105246_10008511 Ga0105246_100085114 459
69 3300013102 Ga0157371_10026713 Ga0157371_100267132 459
70 3300013105 Ga0157369_10046375 Ga0157369_100463753 459
71 3300013296 Ga0157374_10010881 Ga0157374_100108815 459
72 3300013307 Ga0157372_10015051 Ga0157372_100150511 459
73 3300014745 Ga0157377_10000534 Ga0157377_1000053412 459
74 3300014969 Ga0157376_10016113 Ga0157376_100161132 459
75 3300025912 Ga0207707_10008896 Ga0207707_100088965 459
76 3300025919 Ga0207657_10042526 Ga0207657_100425262 459
77 3300025926 Ga0207659_10002633 Ga0207659_100026332 459
78 3300025933 Ga0207706_10017394 Ga0207706_100173944 459
79 3300025941 Ga0207711_10046148 Ga0207711_100461482 459
80 3300025942 Ga0207689_10001441 Ga0207689_1000144119 459
81 3300025944 Ga0207661_10000490 Ga0207661_100004908 459
82 3300025945 Ga0207679_10000314 Ga0207679_100003147 459
83 3300025949 Ga0207667_10082367 Ga0207667_100823671 459
84 3300026088 Ga0207641_10131211 Ga0207641_101312112 459
85 3300026095 Ga0207676_10003858 Ga0207676_100038582 459
86 3300026116 Ga0207674_10000656 Ga0207674_1000065611 459
87 3300026142 Ga0207698_10101984 Ga0207698_101019841 459
88 3300028381 Ga0268264_10011659 Ga0268264_100116596 459
89 3300044706 Ga0466964_0020119 Ga0466964_0020119_499_1986 459
90 3300037418 Ga0395900_0040290 Ga0395900_0040290_2607_4097 460
91 3300037466 Ga0395898_0104177 Ga0395898_0104177_186_1676 460
92 3300005435 Ga0070714_100011426 Ga0070714_1000114262 462
93 3300009176 Ga0105242_10081061 Ga0105242_100810611 462
94 3300025934 Ga0207686_10107416 Ga0207686_101074161 462
95 3300044656 Ga0466969_0035869 Ga0466969_0035869_326_1834 463
96 3300048929 Ga0496126_0000003 Ga0496126_0000003_629083_630579 463
97 3300009011 Ga0105251_10009073 Ga0105251_100090732 464
98 3300025735 Ga0207713_1015766 Ga0207713_10157662 464
99 3300028786 Ga0307517_10007273 Ga0307517_100072734 464
100 3300028794 Ga0307515_10000541 Ga0307515_100005416 464
101 3300031616 Ga0307508_10083619 Ga0307508_100836192 464
102 3300031616 Ga0307508_10124049 Ga0307508_101240491 464
103 3300037466 Ga0395898_0099675 Ga0395898_0099675_1001_2503 464
104 3300044694 Ga0466963_0053976 Ga0466963_0053976_1128_2630 464
105 3300044765 Ga0466970_0013738 Ga0466970_0013738_801_2321 464
106 3300045976 Ga0466967_0016854 Ga0466967_0016854_3219_4721 464
107 3300046455 Ga0495603_0010808 Ga0495603_0010808_2727_4256 464
108 3300046459 Ga0495629_0007359 Ga0495629_0007359_5521_7050 464
109 3300046459 Ga0495629_0118287 Ga0495629_0118287_84_1604 464
110 3300046660 Ga0495625_0039498 Ga0495625_0039498_909_2429 464
111 3300046674 Ga0495588_0009541 Ga0495588_0009541_600_2120 464
112 3300046692 Ga0495671_0034357 Ga0495671_0034357_556_2076 464
113 3300047443 Ga0495687_001148 Ga0495687_001148_10269_11789 464
114 3300047470 Ga0495681_0001712 Ga0495681_0001712_3543_5063 464
115 3300048089 Ga0495614_0005368 Ga0495614_0005368_4091_5611 464
116 3300048912 Ga0496109_0004390 Ga0496109_0004390_7122_8630 464
117 3300049570 Ga0501033_0014121 Ga0501033_0014121_1181_2683 464
118 3300049571 Ga0501034_0010750 Ga0501034_0010750_5590_7092 464
119 3300049572 Ga0501036_0005584 Ga0501036_0005584_5597_7099 464
120 3300049572 Ga0501036_0027965 Ga0501036_0027965_192_1694 464
121 3300049575 Ga0501039_0143915 Ga0501039_0143915_290_1792 464
122 3300049579 Ga0501043_0085578 Ga0501043_0085578_923_2425 464
123 3300049586 Ga0501070_0007529 Ga0501070_0007529_5262_6764 464
124 3300049822 Ga0501035_0006134 Ga0501035_0006134_5574_7076 464
125 3300053107 Ga0500560_011274 Ga0500560_011274_230_1750 464
126 3300021384 Ga0213876_10010514 Ga0213876_100105143 465
127 3300046462 Ga0495651_0000746 Ga0495651_0000746_12164_13678 465
128 3300046529 Ga0495652_0002668 Ga0495652_0002668_2588_4102 465
129 3300046543 Ga0495645_0039062 Ga0495645_0039062_667_2181 465
130 3300026075 Ga0207708_10132877 Ga0207708_101328772 466
131 3300047317 Ga0495604_0083067 Ga0495604_0083067_151_1665 466
132 3300047447 Ga0495685_041331 Ga0495685_041331_14_1498 466
133 3300009147 Ga0114129_10159845 Ga0114129_101598452 467
134 3300044712 Ga0453684_0246297 Ga0453684_0246297_300_1799 467
135 3300049580 Ga0501046_0027505 Ga0501046_0027505_2084_3601 467
136 3300031691 Ga0316579_10045112 Ga0316579_100451122 468
137 3300038443 Ga0395901_0105569 Ga0395901_0105569_1035_2528 468
138 3300048904 Ga0496101_0074699 Ga0496101_0074699_720_2213 468
139 3300048924 Ga0496121_0042132 Ga0496121_0042132_799_2292 468
140 3300013307 Ga0157372_10204493 Ga0157372_102044932 469
141 3300049744 Ga0501083_0000016 Ga0501083_0000016_138106_139644 469
142 iso_pu_bacteria 2558860280 2559425325 471
143 iso_pu_bacteria 2856741275 2856745794 471
144 iso_pu_bacteria 2870782633 2870786315 471
145 iso_pu_bacteria 2891562705 2891569121 471
146 3300025928 Ga0207700_10132668 Ga0207700_101326681 472
147 iso_pu_bacteria 2643221635 2644198219 472
148 iso_pu_bacteria 2884693830 2884695895 472
149 iso_pu_bacteria 2895442618 2895447785 472
150 iso_pu_bacteria 2974315732 2974316980 472
151 iso_pu_bacteria 2984523437 2984525187 472
152 3300005548 Ga0070665_100017867 Ga0070665_1000178677 473
153 3300005563 Ga0068855_100012008 Ga0068855_1000120083 473
154 3300005578 Ga0068854_100050692 Ga0068854_1000506923 473
155 3300005616 Ga0068852_100027013 Ga0068852_1000270132 473
156 3300009174 Ga0105241_10001107 Ga0105241_100011074 473
157 3300009551 Ga0105238_10007120 Ga0105238_100071209 473
158 3300025913 Ga0207695_10027241 Ga0207695_100272411 473
159 3300025914 Ga0207671_10000313 Ga0207671_1000031346 473
160 3300025924 Ga0207694_10002137 Ga0207694_1000213716 473
161 3300025949 Ga0207667_10067025 Ga0207667_100670253 473
162 3300025981 Ga0207640_10031313 Ga0207640_100313132 473
163 3300026142 Ga0207698_10038720 Ga0207698_100387203 473
164 3300035086 Ga0373934_0006853 Ga0373934_0006853_1514_2995 473
165 3300035118 Ga0373954_0024071 Ga0373954_0024071_40_1521 473
166 3300035119 Ga0373956_0002539 Ga0373956_0002539_1209_2690 473
167 3300035172 Ga0373955_0000331 Ga0373955_0000331_313_1794 473
168 3300035410 Ga0373924_0003761 Ga0373924_0003761_3420_4901 473
169 3300036401 Ga0373937_0001088 Ga0373937_0001088_16999_18480 473
170 3300044693 Ga0466961_0002090 Ga0466961_0002090_10249_11763 473
171 3300046462 Ga0495651_0004099 Ga0495651_0004099_6180_7661 473
172 3300046463 Ga0495653_0037978 Ga0495653_0037978_1254_2735 473
173 3300046511 Ga0495608_0005863 Ga0495608_0005863_2814_4295 473
174 3300046517 Ga0495630_0033547 Ga0495630_0033547_1720_3201 473
175 3300046529 Ga0495652_0005365 Ga0495652_0005365_6180_7661 473
176 3300046543 Ga0495645_0007885 Ga0495645_0007885_4474_5955 473
177 3300046559 Ga0495667_0027178 Ga0495667_0027178_1331_2812 473
178 3300046663 Ga0495635_0027228 Ga0495635_0027228_1454_2935 473
179 3300046680 Ga0495646_0001102 Ga0495646_0001102_5430_6911 473
180 3300046809 Ga0495600_0005058 Ga0495600_0005058_3112_4593 473
181 3300047319 Ga0495674_0030281 Ga0495674_0030281_557_2038 473
182 3300047444 Ga0495675_0018943 Ga0495675_0018943_1638_3119 473
183 3300047471 Ga0495684_0003777 Ga0495684_0003777_5746_7227 473
184 3300048088 Ga0495602_0011279 Ga0495602_0011279_4477_5958 473
185 3300053077 Ga0495601_0014672 Ga0495601_0014672_3025_4506 473
186 3300053078 Ga0495612_0034244 Ga0495612_0034244_276_1757 473
187 3300053085 Ga0495619_0020883 Ga0495619_0020883_2364_3845 473
188 iso_pu_bacteria 2643221679 2644446533 473
189 iso_pu_bacteria 2675903060 2676495728 473
190 iso_pu_bacteria 2895427314 2895430396 473
191 iso_pu_bacteria 8055172936 8055173513 473
192 3300049586 Ga0501070_0128660 Ga0501070_0128660_319_1803 474
193 3300049742 Ga0501080_0110545 Ga0501080_0110545_979_2463 474
194 3300049743 Ga0501081_0123124 Ga0501081_0123124_223_1707 474
195 3300049744 Ga0501083_0026183 Ga0501083_0026183_666_2150 474
196 3300060353 Ga0501082_0015412 Ga0501082_0015412_1916_3400 474
197 iso_pu_bacteria 2643221601 2644015856 474
198 iso_pu_bacteria 2643221631 2644176463 474
199 iso_pu_bacteria 2643221678 2644436515 474
200 iso_pu_bacteria 2808606359 2808841404 474
201 iso_pu_bacteria 2863404153 2863405419 474
202 iso_pu_bacteria 2919468124 2919468797 474
203 iso_pu_bacteria 2995463766 2995469104 474
204 3300009094 Ga0111539_10009078 Ga0111539_100090784 475
205 3300027907 Ga0207428_10024979 Ga0207428_100249793 475
206 3300035170 Ga0373943_0003248 Ga0373943_0003248_1984_3471 475
207 3300035171 Ga0373946_0006849 Ga0373946_0006849_2060_3547 475
208 3300035695 Ga0373927_0005992 Ga0373927_0005992_4865_6352 475
209 3300035725 Ga0373947_0026753 Ga0373947_0026753_1276_2763 475
210 3300037068 Ga0373925_0002378 Ga0373925_0002378_8125_9612 475
211 3300046455 Ga0495603_0034717 Ga0495603_0034717_368_1855 475
212 3300046459 Ga0495629_0016720 Ga0495629_0016720_1942_3429 475
213 3300046472 Ga0495580_0001689 Ga0495580_0001689_13055_14542 475
214 3300046473 Ga0495582_0001587 Ga0495582_0001587_6475_7962 475
215 3300046475 Ga0495639_0003187 Ga0495639_0003187_996_2483 475
216 3300046517 Ga0495630_0001821 Ga0495630_0001821_1842_3329 475
217 3300046531 Ga0495665_0001407 Ga0495665_0001407_1889_3376 475
218 3300046674 Ga0495588_0000462 Ga0495588_0000462_17024_18511 475
219 3300046683 Ga0495658_0000812 Ga0495658_0000812_8923_10410 475
220 3300046689 Ga0495613_0006807 Ga0495613_0006807_1909_3396 475
221 3300047315 Ga0495581_0004758 Ga0495581_0004758_4328_5815 475
222 3300047673 Ga0495593_0007945 Ga0495593_0007945_1887_3374 475
223 3300050511 nmdc:mga08y16_14406_c1 nmdc:mga08y16_14406_c1_5089_6576 475
224 iso_pu_bacteria 2643221613 2644082827 475
225 iso_pu_bacteria 2643221721 2644665783 475
226 iso_pu_bacteria 2935890801 2935893255 475
227 3300005335 Ga0070666_10019259 Ga0070666_100192594 476
228 3300005530 Ga0070679_100103880 Ga0070679_1001038802 476
229 3300005842 Ga0068858_100033940 Ga0068858_1000339402 476
230 3300009098 Ga0105245_10000114 Ga0105245_1000011467 476
231 3300014968 Ga0157379_10008756 Ga0157379_100087563 476
232 3300025927 Ga0207687_10000051 Ga0207687_1000005135 476
233 3300025972 Ga0207668_10050403 Ga0207668_100504032 476
234 3300026035 Ga0207703_10042975 Ga0207703_100429754 476
235 3300026078 Ga0207702_10072391 Ga0207702_100723913 476
236 3300028800 Ga0265338_10000073 Ga0265338_100000733 476
237 3300031241 Ga0265325_10008103 Ga0265325_100081033 476
238 3300031249 Ga0265339_10009068 Ga0265339_100090683 476
239 3300031250 Ga0265331_10014773 Ga0265331_100147733 476
240 3300031344 Ga0265316_10057053 Ga0265316_100570532 476
241 3300031507 Ga0307509_10004629 Ga0307509_100046296 476
242 3300031595 Ga0265313_10001810 Ga0265313_100018105 476
243 3300046462 Ga0495651_0005034 Ga0495651_0005034_3174_4679 476
244 3300053136 Ga0500559_0000584 Ga0500559_0000584_1551_3041 476
245 iso_pu_bacteria 2654587600 2655033557 476
246 3300005435 Ga0070714_100013938 Ga0070714_1000139385 477
247 3300005471 Ga0070698_100026244 Ga0070698_1000262442 477
248 3300005548 Ga0070665_100045224 Ga0070665_1000452243 477
249 3300020069 Ga0197907_11449058 Ga0197907_114490582 477
250 3300025929 Ga0207664_10000404 Ga0207664_100004048 477
251 3300025929 Ga0207664_10012413 Ga0207664_100124134 477
252 3300025936 Ga0207670_10011478 Ga0207670_100114782 477
253 3300028379 Ga0268266_10015033 Ga0268266_100150335 477
254 3300033179 Ga0307507_10000001 Ga0307507_10000001187 477
255 3300037471 Ga0395905_0102920 Ga0395905_0102920_1064_2557 477
256 3300044656 Ga0466969_0018777 Ga0466969_0018777_1395_2912 477
257 3300044683 Ga0466965_0007567 Ga0466965_0007567_526_2022 477
258 3300044684 Ga0466966_0005864 Ga0466966_0005864_886_2403 477
259 3300044693 Ga0466961_0033267 Ga0466961_0033267_234_1751 477
260 3300044693 Ga0466961_0065558 Ga0466961_0065558_315_1832 477
261 3300044901 Ga0466960_0008681 Ga0466960_0008681_2454_3947 477
262 3300045836 Ga0466958_0053576 Ga0466958_0053576_714_2231 477
263 3300045976 Ga0466967_0011120 Ga0466967_0011120_2529_4022 477
264 3300049570 Ga0501033_0093981 Ga0501033_0093981_680_2173 477
265 3300061719 Ga0466962_0004724 Ga0466962_0004724_4490_6022 477
266 3300006880 Ga0075429_100046892 Ga0075429_1000468921 478
267 3300022467 Ga0224712_10012425 Ga0224712_100124252 478
268 3300031507 Ga0307509_10083937 Ga0307509_100839373 478
269 3300044684 Ga0466966_0021660 Ga0466966_0021660_199_1722 478
270 3300044693 Ga0466961_0083151 Ga0466961_0083151_157_1680 478
271 3300044719 Ga0466971_0000060 Ga0466971_0000060_12234_13751 478
272 3300044719 Ga0466971_0001837 Ga0466971_0001837_308_1831 478
273 3300045049 Ga0466959_0000813 Ga0466959_0000813_5356_6873 478
274 3300045049 Ga0466959_0050280 Ga0466959_0050280_1316_2839 478
275 3300046454 Ga0495592_0012073 Ga0495592_0012073_401_1924 478
276 3300046454 Ga0495592_0087670 Ga0495592_0087670_72_1589 478
277 3300046459 Ga0495629_0062914 Ga0495629_0062914_84_1613 478
278 3300046462 Ga0495651_0011792 Ga0495651_0011792_256_1773 478
279 3300046514 Ga0495618_0016281 Ga0495618_0016281_334_1851 478
280 3300046516 Ga0495628_0031001 Ga0495628_0031001_2719_4236 478
281 3300046529 Ga0495652_0000965 Ga0495652_0000965_27817_29334 478
282 3300046529 Ga0495652_0062143 Ga0495652_0062143_1539_3053 478
283 3300046543 Ga0495645_0021208 Ga0495645_0021208_2484_4007 478
284 3300046663 Ga0495635_0014829 Ga0495635_0014829_922_2439 478
285 3300046678 Ga0495599_0019579 Ga0495599_0019579_2170_3687 478
286 3300046809 Ga0495600_0031149 Ga0495600_0031149_479_1996 478
287 3300047317 Ga0495604_0069032 Ga0495604_0069032_1123_2637 478
288 3300047444 Ga0495675_0008928 Ga0495675_0008928_138_1661 478
289 3300053078 Ga0495612_0007843 Ga0495612_0007843_1110_2627 478
290 3300053085 Ga0495619_0064376 Ga0495619_0064376_313_1827 478
291 3300053140 Ga0500573_0073773 Ga0500573_0073773_328_1842 478
292 3300061719 Ga0466962_0005401 Ga0466962_0005401_4287_5810 478
293 3300061719 Ga0466962_0006959 Ga0466962_0006959_1525_3042 478
294 iso_pu_bacteria 2751185788 2753301079 478
295 iso_pu_bacteria 2818991472 2819740445 478
296 iso_pu_bacteria 2919042368 2919045897 478
297 iso_pu_bacteria 2928104781 2928107127 478
298 iso_pu_bacteria 2984551494 2984553252 478
299 3300005330 Ga0070690_100002660 Ga0070690_1000026607 479
300 3300005937 Ga0081455_10046100 Ga0081455_100461003 479
301 3300006028 Ga0070717_10033897 Ga0070717_100338972 479
302 3300013296 Ga0157374_10010668 Ga0157374_100106688 479
303 3300021388 Ga0213875_10030719 Ga0213875_100307192 479
304 3300022467 Ga0224712_10026661 Ga0224712_100266611 479
305 3300025913 Ga0207695_10137068 Ga0207695_101370682 479
306 3300025942 Ga0207689_10028975 Ga0207689_100289752 479
307 3300028786 Ga0307517_10006962 Ga0307517_100069628 479
308 3300028786 Ga0307517_10037385 Ga0307517_100373852 479
309 3300028800 Ga0265338_10003474 Ga0265338_1000347418 479
310 3300031507 Ga0307509_10001164 Ga0307509_1000116420 479
311 3300031649 Ga0307514_10025423 Ga0307514_100254234 479
312 3300031730 Ga0307516_10027943 Ga0307516_100279435 479
313 3300032126 Ga0307415_100004912 Ga0307415_1000049124 479
314 3300033179 Ga0307507_10119514 Ga0307507_101195142 479
315 3300035241 Ga0373961_0000156 Ga0373961_0000156_1429_2928 479
316 3300037853 Ga0436364_1263823 Ga0436364_1263823_23743_25248 479
317 3300046459 Ga0495629_0012534 Ga0495629_0012534_3959_5464 479
318 3300046522 Ga0495643_0001114 Ga0495643_0001114_10072_11577 479
319 3300046691 Ga0495670_0009064 Ga0495670_0009064_2178_3683 479
320 3300046810 Ga0495660_0016992 Ga0495660_0016992_2655_4160 479
321 3300047447 Ga0495685_002731 Ga0495685_002731_3164_4669 479
322 3300047470 Ga0495681_0001954 Ga0495681_0001954_5628_7133 479
323 3300047472 Ga0495686_0026169 Ga0495686_0026169_574_2091 479
324 3300049660 Ga0501216_000700 Ga0501216_000700_2439_3941 479
325 3300049661 Ga0501217_001118 Ga0501217_001118_695_2197 479
326 3300049665 Ga0501227_001402 Ga0501227_001402_3237_4739 479
327 3300049705 Ga0501225_0006877 Ga0501225_0006877_1143_2645 479
328 3300050508 nmdc:mga09592_16663_c1 nmdc:mga09592_16663_c1_4199_5698 479
329 3300053086 Ga0500578_0048214 Ga0500578_0048214_274_1779 479
330 3300053094 Ga0500566_0009775 Ga0500566_0009775_711_2210 479
331 3300053095 Ga0500640_008614 Ga0500640_008614_1180_2679 479
332 3300053102 Ga0500554_001102 Ga0500554_001102_3473_4972 479
333 3300053119 Ga0500595_000822 Ga0500595_000822_3013_4512 479
334 3300053129 Ga0500628_002706 Ga0500628_002706_989_2494 479
335 3300053134 Ga0500658_0003443 Ga0500658_0003443_2655_4160 479
336 3300053139 Ga0500568_0014198 Ga0500568_0014198_719_2221 479
337 3300053149 Ga0500600_0018549 Ga0500600_0018549_2271_3776 479
338 3300053160 Ga0500633_0002180 Ga0500633_0002180_547_2052 479
339 3300053161 Ga0500634_0010312 Ga0500634_0010312_1160_2665 479
340 iso_pu_bacteria 2751185734 2753074592 479
341 iso_pu_bacteria 8055066027 8055072883 479
342 3300049823 Ga0501044_0094612 Ga0501044_0094612_815_2329 480
343 iso_pu_bacteria 2731639228 2731908473 480
344 3300006038 Ga0075365_10073683 Ga0075365_100736832 481
345 3300035695 Ga0373927_0002032 Ga0373927_0002032_9996_11507 481
346 3300037068 Ga0373925_0014913 Ga0373925_0014913_3072_4580 481
347 3300048904 Ga0496101_0001210 Ga0496101_0001210_6177_7682 481
348 3300048908 Ga0496105_0032658 Ga0496105_0032658_1291_2796 481
349 3300048910 Ga0496107_0070315 Ga0496107_0070315_543_2048 481
350 3300048912 Ga0496109_0100776 Ga0496109_0100776_665_2179 481
351 3300048913 Ga0496110_0032098 Ga0496110_0032098_565_2079 481
352 3300048917 Ga0496114_0025379 Ga0496114_0025379_1035_2540 481
353 3300048918 Ga0496115_0009224 Ga0496115_0009224_5255_6760 481
354 3300003320 rootH2_10079573 rootH2_100795733 482
355 3300005548 Ga0070665_100045260 Ga0070665_1000452602 482
356 3300021388 Ga0213875_10002068 Ga0213875_100020688 482
357 3300025913 Ga0207695_10037369 Ga0207695_100373692 482
358 3300028379 Ga0268266_10032081 Ga0268266_100320812 482
359 3300037853 Ga0436364_0108192 Ga0436364_0108192_17175_18686 482
360 3300048920 Ga0496117_0008510 Ga0496117_0008510_5465_6976 482
361 3300048921 Ga0496118_0000360 Ga0496118_0000360_21188_22699 482
362 3300048922 Ga0496119_0044992 Ga0496119_0044992_531_2042 482
363 3300048925 Ga0496122_0083232 Ga0496122_0083232_276_1787 482
364 3300048927 Ga0496124_0000173 Ga0496124_0000173_106896_108407 482
365 3300047317 Ga0495604_0043468 Ga0495604_0043468_1430_2968 483
366 iso_pu_bacteria 2856858025 2856858363 483
367 3300028563 Ga0265319_1019264 Ga0265319_10192643 486
368 3300037312 Ga0395899_0001617 Ga0395899_0001617_16329_17876 486
369 3300048917 Ga0496114_0102309 Ga0496114_0102309_21_1553 486
370 3300028577 Ga0265318_10004559 Ga0265318_100045596 487
371 3300031238 Ga0265332_10010797 Ga0265332_100107974 487
372 3300031241 Ga0265325_10051474 Ga0265325_100514741 487
373 iso_pu_bacteria 2501939600 2501939734 487
374 iso_pu_bacteria 649633069 649813400 487
375 3300003203 JGI25406J46586_10005644 JGI25406J46586_100056442 491
376 3300005985 Ga0081539_10000846 Ga0081539_1000084616 491

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

27

490

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t90-assembly1.cif.gz_D crystal structure of methylmalonate semialdehyde dehydrogenase from bacillus subtilis 0.9391 11 477
4zz7-assembly2.cif.gz_G crystal structure of methylmalonate-semialdehyde dehydrogenase (dddc) from oceanimonas doudoroffii 0.9369 12 480
4iym-assembly1.cif.gz_C crystal structure of putative methylmalonate-semialdehyde dehydrogenase from sinorhizobium meliloti 1021 complexed with nad, target 011934 0.9289 10 482
4go4-assembly4.cif.gz_G crystal structure of pnpe in complex with nicotinamide adenine dinucleotide 0.9259 15 474
6wsa-assembly1.cif.gz_A crystal structure of a betaine aldehyde dehydrogenase from burkholderia pseudomallei without cofactor 0.9254 12 474
ID Description Score Start End Superfamily
1t90B01 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9861 11 257 3.40.605.10
af_O53816_3_249_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9852 14 254 3.40.605.10
af_Q54I10_27_272_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.982 12 256 3.40.605.10
af_A0A1D8PM94_38_281_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9756 14 256 3.40.605.10
af_Q54I10_27_272_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9741 12 256 3.40.605.10
ID Description Score Start End GO Terms
AF-A0A2G8MPF3-F1-model_v4 deleted 0.9856 12 221
AF-A0A506XM08-F1-model_v4 Aldehyde dehydrogenase family protein 0.9821 151 270 GO:0004491
GO:0006210
GO:0006574
AF-A0A357A2F5-F1-model_v4 Malonate-semialdehyde dehydrogenase 0.9816 12 197 GO:0004491
GO:0006210
GO:0006574
AF-A0A382P791-F1-model_v4 Aldehyde dehydrogenase domain-containing protein 0.9795 12 240 GO:0004491
GO:0006210
GO:0006574
AF-A0A7K2APV5-F1-model_v4 methylmalonate-semialdehyde dehydrogenase (CoA acylating) (EC 1.2.1.27) 0.9794 12 307 GO:0004491
GO:0006210
GO:0006574

Feature Viewer

pLDDT pTM Quality
89.88 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map