F427532
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 376 | 281 | 340 | 485 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2501939600|2501939734 |
| Length | 510 |
| Sequence | MTQTAPGTAPAPVPLERVTHWIDGKPFAGVTERTAPVYDPALGAVRTEVPLASVDEVDQAVASAAAAFASWRTSSLTKRTQVLFAFRELVNRHKQELAELITAEHGKVVSDALGEVTRGLEVVEFACGIPHLLKGGYSEGVSTNVDVYSIRQPVGVCAVISPFNFPVMVPMWFVPIAIAAGNTVVLKPSEKDPSASLLVARLWEQAGLPAGVFNVVHGDKVAVDRLLEHPEVKAVSFVGSTPIARYVYETGTRNGKRVQALGGAKNHMVVLPDADLDLAADAAVNAGFGSAGERCMAISALVVVEPVADDLVARIRERIATLKVGDGRRSCDMGPLVTKEHRDRVASYLDAGVEAGAELVVDGRDVRADGDESGFWLGPSLLDRVSPEMSVYTDEIFGPVLSVVRVGSYDEALALVNANRYGNGTAIFTNDGGAARRFQNEVEVGMVGVNVPIPVPMAYYSFGGWKDSLFGDSHAHGAEGVHFFTRGKVVTSRWLDPSHGGINLGFPENV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 3 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 4 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 5 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 6 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 7 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 8 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 9 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 10 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 11 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 12 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 13 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 14 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 15 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 16 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 17 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 18 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 19 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 20 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 21 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 22 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 23 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 24 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 25 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 26 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 27 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 28 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 29 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 30 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 31 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 32 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 33 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 34 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 35 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 92 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 93 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 127 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 130 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 131 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 132 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 133 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 136 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 138 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 140 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 142 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 143 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 144 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 145 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 146 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 147 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 151 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 152 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 153 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 155 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 156 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 160 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 161 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 162 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 163 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 164 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 165 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 166 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 167 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 168 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 169 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 170 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 171 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 172 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 173 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 174 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 175 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 176 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 177 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 178 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 179 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 180 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 181 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 223 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 229 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 230 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 231 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 232 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 233 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 234 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 235 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 245 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 246 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 248 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 262 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 263 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 264 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 265 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 266 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 267 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 268 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 269 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 270 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 271 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 272 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 273 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 274 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 275 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 276 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 277 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 279 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 280 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 281 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.63 |
| Metatranscriptomes | 0.8 |
| Isolates | 9.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.53 |
| Bulb | 0 |
| Endosphere | 4.52 |
| Nodule | 0 |
| Rhizoplane | 2.66 |
| Rhizosphere | 78.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10005644 | 3300003203 | Bacteria | 5789 |
| 2 | rootH2_10079573 | 3300003320 | Bacteria | 4624 |
| 3 | Ga0070683_100054265 | 3300005329 | Bacteria | 3716 |
| 4 | Ga0070690_100001897 | 3300005330 | Bacteria | 11099 |
| 5 | Ga0070690_100002660 | 3300005330 | Bacteria | 9628 |
| 6 | Ga0068869_100011210 | 3300005334 | Bacteria | 5873 |
| 7 | Ga0070666_10019259 | 3300005335 | Bacteria | 4402 |
| 8 | Ga0070682_100007558 | 3300005337 | Bacteria | 6122 |
| 9 | Ga0070660_100046734 | 3300005339 | Bacteria | 3319 |
| 10 | Ga0070689_100023063 | 3300005340 | Bacteria | 4656 |
| 11 | Ga0070661_100003282 | 3300005344 | Bacteria | 11169 |
| 12 | Ga0070692_10004130 | 3300005345 | Bacteria | 6005 |
| 13 | Ga0070675_100012661 | 3300005354 | Bacteria | 6617 |
| 14 | Ga0070671_100161062 | 3300005355 | Bacteria | 1897 |
| 15 | Ga0070659_100035917 | 3300005366 | Bacteria | 3861 |
| 16 | Ga0070709_10001288 | 3300005434 | Bacteria | 13707 |
| 17 | Ga0070714_100005719 | 3300005435 | Bacteria | 9529 |
| 18 | Ga0070714_100011426 | 3300005435 | Bacteria | 7043 |
| 19 | Ga0070714_100013938 | 3300005435 | Bacteria | 6450 |
| 20 | Ga0070713_100000541 | 3300005436 | Bacteria | 23963 |
| 21 | Ga0070713_100040455 | 3300005436 | Bacteria | 3790 |
| 22 | Ga0070662_100049200 | 3300005457 | Bacteria | 3039 |
| 23 | Ga0070698_100026244 | 3300005471 | Bacteria | 6065 |
| 24 | Ga0070679_100103880 | 3300005530 | Bacteria | 2828 |
| 25 | Ga0070684_100036893 | 3300005535 | Bacteria | 4190 |
| 26 | Ga0070665_100017867 | 3300005548 | Bacteria | 7120 |
| 27 | Ga0070665_100045224 | 3300005548 | Bacteria | 4421 |
| 28 | Ga0070665_100045260 | 3300005548 | Bacteria | 4420 |
| 29 | Ga0068855_100012008 | 3300005563 | Bacteria | 10472 |
| 30 | Ga0068855_100025480 | 3300005563 | Bacteria | 7075 |
| 31 | Ga0068857_100031404 | 3300005577 | Bacteria | 4693 |
| 32 | Ga0068854_100050692 | 3300005578 | Bacteria | 2971 |
| 33 | Ga0068856_100087732 | 3300005614 | Bacteria | 3093 |
| 34 | Ga0068852_100027013 | 3300005616 | Bacteria | 4673 |
| 35 | Ga0068852_100247142 | 3300005616 | Bacteria | 1708 |
| 36 | Ga0068859_100023946 | 3300005617 | Bacteria | 6127 |
| 37 | Ga0068863_100003147 | 3300005841 | Bacteria | 16290 |
| 38 | Ga0068858_100033940 | 3300005842 | Bacteria | 4733 |
| 39 | Ga0068858_100051874 | 3300005842 | Bacteria | 3795 |
| 40 | Ga0068860_100007014 | 3300005843 | Bacteria | 11287 |
| 41 | Ga0081455_10046100 | 3300005937 | Bacteria | 3786 |
| 42 | Ga0081539_10000846 | 3300005985 | Bacteria | 58555 |
| 43 | Ga0070717_10021469 | 3300006028 | Bacteria | 5088 |
| 44 | Ga0070717_10033897 | 3300006028 | Bacteria | 4122 |
| 45 | Ga0075365_10073683 | 3300006038 | Bacteria | 2302 |
| 46 | Ga0070712_100008797 | 3300006175 | Bacteria | 6358 |
| 47 | Ga0075434_100049836 | 3300006871 | Bacteria | 4159 |
| 48 | Ga0075429_100046892 | 3300006880 | Bacteria | 3760 |
| 49 | Ga0097620_100023951 | 3300006931 | Bacteria | 6127 |
| 50 | Ga0105251_10009073 | 3300009011 | Bacteria | 5921 |
| 51 | Ga0111539_10009078 | 3300009094 | Bacteria | 12586 |
| 52 | Ga0105245_10000114 | 3300009098 | Bacteria | 78195 |
| 53 | Ga0105245_10005849 | 3300009098 | Bacteria | 10800 |
| 54 | Ga0114129_10159845 | 3300009147 | Bacteria | 3079 |
| 55 | Ga0105241_10001107 | 3300009174 | Bacteria | 20507 |
| 56 | Ga0105242_10081061 | 3300009176 | Bacteria | 2713 |
| 57 | Ga0105248_10002021 | 3300009177 | Bacteria | 22495 |
| 58 | Ga0105238_10007120 | 3300009551 | Bacteria | 11192 |
| 59 | Ga0105238_10347286 | 3300009551 | Bacteria | 1472 |
| 60 | Ga0105239_10030303 | 3300010375 | Bacteria | 5947 |
| 61 | Ga0105246_10008511 | 3300011119 | Bacteria | 6308 |
| 62 | Ga0157371_10026713 | 3300013102 | Bacteria | 4193 |
| 63 | Ga0157369_10046375 | 3300013105 | Bacteria | 4723 |
| 64 | Ga0157374_10010668 | 3300013296 | Bacteria | 7915 |
| 65 | Ga0157374_10010881 | 3300013296 | Bacteria | 7851 |
| 66 | Ga0157372_10015051 | 3300013307 | Bacteria | 8280 |
| 67 | Ga0157372_10204493 | 3300013307 | Bacteria | 2288 |
| 68 | Ga0157377_10000534 | 3300014745 | Bacteria | 16151 |
| 69 | Ga0157379_10008756 | 3300014968 | Bacteria | 8822 |
| 70 | Ga0157376_10016113 | 3300014969 | Bacteria | 5666 |
| 71 | Ga0197907_11449058 | 3300020069 | Bacteria | 2744 |
| 72 | Ga0213876_10010514 | 3300021384 | Bacteria | 4963 |
| 73 | Ga0213875_10002068 | 3300021388 | Bacteria | 12317 |
| 74 | Ga0213875_10030719 | 3300021388 | Bacteria | 2542 |
| 75 | Ga0224712_10012425 | 3300022467 | Bacteria | 2679 |
| 76 | Ga0224712_10026661 | 3300022467 | Bacteria | 2046 |
| 77 | Ga0207713_1015766 | 3300025735 | Bacteria | 3862 |
| 78 | Ga0207688_10009983 | 3300025901 | Bacteria | 5166 |
| 79 | Ga0207699_10030302 | 3300025906 | Bacteria | 3026 |
| 80 | Ga0207707_10008896 | 3300025912 | Bacteria | 8720 |
| 81 | Ga0207695_10027241 | 3300025913 | Bacteria | 6367 |
| 82 | Ga0207695_10037369 | 3300025913 | Bacteria | 5239 |
| 83 | Ga0207695_10137068 | 3300025913 | Bacteria | 2400 |
| 84 | Ga0207671_10000313 | 3300025914 | Bacteria | 71480 |
| 85 | Ga0207693_10047764 | 3300025915 | Bacteria | 3362 |
| 86 | Ga0207663_10021086 | 3300025916 | Bacteria | 3703 |
| 87 | Ga0207660_10083144 | 3300025917 | Bacteria | 2357 |
| 88 | Ga0207657_10042526 | 3300025919 | Bacteria | 4008 |
| 89 | Ga0207694_10002137 | 3300025924 | Bacteria | 16242 |
| 90 | Ga0207659_10002633 | 3300025926 | Bacteria | 10690 |
| 91 | Ga0207687_10000051 | 3300025927 | Bacteria | 92954 |
| 92 | Ga0207700_10000785 | 3300025928 | Bacteria | 18352 |
| 93 | Ga0207700_10072586 | 3300025928 | Bacteria | 2655 |
| 94 | Ga0207700_10132668 | 3300025928 | Bacteria | 2036 |
| 95 | Ga0207664_10000404 | 3300025929 | Bacteria | 30859 |
| 96 | Ga0207664_10010749 | 3300025929 | Bacteria | 6475 |
| 97 | Ga0207664_10012413 | 3300025929 | Bacteria | 6089 |
| 98 | Ga0207706_10017394 | 3300025933 | Bacteria | 6477 |
| 99 | Ga0207706_10216935 | 3300025933 | Bacteria | 1676 |
| 100 | Ga0207686_10107416 | 3300025934 | Bacteria | 1876 |
| 101 | Ga0207670_10011478 | 3300025936 | Bacteria | 5147 |
| 102 | Ga0207711_10046148 | 3300025941 | Bacteria | 3722 |
| 103 | Ga0207689_10001441 | 3300025942 | Bacteria | 22747 |
| 104 | Ga0207689_10028975 | 3300025942 | Bacteria | 4628 |
| 105 | Ga0207661_10000490 | 3300025944 | Bacteria | 25452 |
| 106 | Ga0207679_10000314 | 3300025945 | Bacteria | 36372 |
| 107 | Ga0207667_10067025 | 3300025949 | Bacteria | 3739 |
| 108 | Ga0207667_10082367 | 3300025949 | Bacteria | 3333 |
| 109 | Ga0207668_10050403 | 3300025972 | Bacteria | 2869 |
| 110 | Ga0207640_10031313 | 3300025981 | Bacteria | 3285 |
| 111 | Ga0207703_10042975 | 3300026035 | Bacteria | 3626 |
| 112 | Ga0207708_10132877 | 3300026075 | Bacteria | 1947 |
| 113 | Ga0207702_10072391 | 3300026078 | Bacteria | 2970 |
| 114 | Ga0207641_10131211 | 3300026088 | Bacteria | 2250 |
| 115 | Ga0207676_10003858 | 3300026095 | Bacteria | 10586 |
| 116 | Ga0207674_10000656 | 3300026116 | Bacteria | 45006 |
| 117 | Ga0207674_10002764 | 3300026116 | Bacteria | 21895 |
| 118 | Ga0207698_10038720 | 3300026142 | Bacteria | 3525 |
| 119 | Ga0207698_10101984 | 3300026142 | Bacteria | 2381 |
| 120 | Ga0207428_10024979 | 3300027907 | Bacteria | 5010 |
| 121 | Ga0268266_10015033 | 3300028379 | Bacteria | 6644 |
| 122 | Ga0268266_10032081 | 3300028379 | Bacteria | 4462 |
| 123 | Ga0268264_10011659 | 3300028381 | Bacteria | 7249 |
| 124 | Ga0265319_1019264 | 3300028563 | Bacteria | 2552 |
| 125 | Ga0265318_10004559 | 3300028577 | Bacteria | 6694 |
| 126 | Ga0307517_10006962 | 3300028786 | Bacteria | 16612 |
| 127 | Ga0307517_10007273 | 3300028786 | Bacteria | 16188 |
| 128 | Ga0307517_10037385 | 3300028786 | Bacteria | 5424 |
| 129 | Ga0307515_10000541 | 3300028794 | Bacteria | 88944 |
| 130 | Ga0265338_10000073 | 3300028800 | Bacteria | 181521 |
| 131 | Ga0265338_10003474 | 3300028800 | Bacteria | 22142 |
| 132 | Ga0265332_10010797 | 3300031238 | Bacteria | 4059 |
| 133 | Ga0265325_10008103 | 3300031241 | Bacteria | 6226 |
| 134 | Ga0265325_10051474 | 3300031241 | Bacteria | 2117 |
| 135 | Ga0265339_10009068 | 3300031249 | Bacteria | 6284 |
| 136 | Ga0265331_10014773 | 3300031250 | Bacteria | 4145 |
| 137 | Ga0265316_10057053 | 3300031344 | Bacteria | 3047 |
| 138 | Ga0307509_10001164 | 3300031507 | Bacteria | 44979 |
| 139 | Ga0307509_10004629 | 3300031507 | Bacteria | 19673 |
| 140 | Ga0307509_10083937 | 3300031507 | Bacteria | 3282 |
| 141 | Ga0265313_10001810 | 3300031595 | Bacteria | 19558 |
| 142 | Ga0307508_10083619 | 3300031616 | Bacteria | 2774 |
| 143 | Ga0307508_10124049 | 3300031616 | Bacteria | 2185 |
| 144 | Ga0307514_10025423 | 3300031649 | Bacteria | 4790 |
| 145 | Ga0316579_10045112 | 3300031691 | Bacteria | 2055 |
| 146 | Ga0307516_10027943 | 3300031730 | Bacteria | 5714 |
| 147 | Ga0307415_100004912 | 3300032126 | Bacteria | 7023 |
| 148 | Ga0307507_10000001 | 3300033179 | Bacteria | 417520 |
| 149 | Ga0307507_10119514 | 3300033179 | Bacteria | 2114 |
| 150 | Ga0373934_0006853 | 3300035086 | Bacteria | 4229 |
| 151 | Ga0373954_0024071 | 3300035118 | Bacteria | 2774 |
| 152 | Ga0373956_0002539 | 3300035119 | Bacteria | 7419 |
| 153 | Ga0373943_0003248 | 3300035170 | Bacteria | 7378 |
| 154 | Ga0373943_0018138 | 3300035170 | Bacteria | 3230 |
| 155 | Ga0373946_0006849 | 3300035171 | Bacteria | 4147 |
| 156 | Ga0373955_0000331 | 3300035172 | Bacteria | 19705 |
| 157 | Ga0373961_0000156 | 3300035241 | Bacteria | 32884 |
| 158 | Ga0373924_0003761 | 3300035410 | Bacteria | 5244 |
| 159 | Ga0373927_0002032 | 3300035695 | Bacteria | 14898 |
| 160 | Ga0373927_0005992 | 3300035695 | Bacteria | 8324 |
| 161 | Ga0373947_0026753 | 3300035725 | Bacteria | 3373 |
| 162 | Ga0373947_0044802 | 3300035725 | Bacteria | 2646 |
| 163 | Ga0373937_0001088 | 3300036401 | Bacteria | 22904 |
| 164 | Ga0373925_0002378 | 3300037068 | Bacteria | 15091 |
| 165 | Ga0373925_0014913 | 3300037068 | Bacteria | 5616 |
| 166 | Ga0395899_0001617 | 3300037312 | Bacteria | 18830 |
| 167 | Ga0395900_0040290 | 3300037418 | Bacteria | 4814 |
| 168 | Ga0395898_0099675 | 3300037466 | Bacteria | 2790 |
| 169 | Ga0395898_0104177 | 3300037466 | Bacteria | 2721 |
| 170 | Ga0395898_0155691 | 3300037466 | Bacteria | 2186 |
| 171 | Ga0395905_0102920 | 3300037471 | Bacteria | 2681 |
| 172 | Ga0436364_0108192 | 3300037853 | Bacteria | 28498 |
| 173 | Ga0436364_1263823 | 3300037853 | Bacteria | 35965 |
| 174 | Ga0395901_0063916 | 3300038443 | Bacteria | 3830 |
| 175 | Ga0395901_0105569 | 3300038443 | Bacteria | 2956 |
| 176 | Ga0450896_001153 | 3300042133 | Bacteria | 3149 |
| 177 | Ga0450898_007468 | 3300042134 | Bacteria | 1704 |
| 178 | Ga0450906_002787 | 3300042145 | Bacteria | 3809 |
| 179 | Ga0466969_0018777 | 3300044656 | Bacteria | 3598 |
| 180 | Ga0466969_0035869 | 3300044656 | Bacteria | 2507 |
| 181 | Ga0466965_0007567 | 3300044683 | Bacteria | 4996 |
| 182 | Ga0466966_0005864 | 3300044684 | Bacteria | 8101 |
| 183 | Ga0466966_0021660 | 3300044684 | Bacteria | 4219 |
| 184 | Ga0466961_0002090 | 3300044693 | Bacteria | 12444 |
| 185 | Ga0466961_0010801 | 3300044693 | Bacteria | 5832 |
| 186 | Ga0466961_0033267 | 3300044693 | Bacteria | 3313 |
| 187 | Ga0466961_0065558 | 3300044693 | Bacteria | 2308 |
| 188 | Ga0466961_0083151 | 3300044693 | Bacteria | 2024 |
| 189 | Ga0466963_0011336 | 3300044694 | Bacteria | 5425 |
| 190 | Ga0466963_0053976 | 3300044694 | Bacteria | 2670 |
| 191 | Ga0466964_0020119 | 3300044706 | Bacteria | 2569 |
| 192 | Ga0453684_0246297 | 3300044712 | Bacteria | 2055 |
| 193 | Ga0466971_0000060 | 3300044719 | Bacteria | 42431 |
| 194 | Ga0466971_0001837 | 3300044719 | Bacteria | 9021 |
| 195 | Ga0466971_0006463 | 3300044719 | Bacteria | 5092 |
| 196 | Ga0466970_0013738 | 3300044765 | Bacteria | 4152 |
| 197 | Ga0466960_0008681 | 3300044901 | Bacteria | 4169 |
| 198 | Ga0466960_0015178 | 3300044901 | Bacteria | 3316 |
| 199 | Ga0466959_0000813 | 3300045049 | Bacteria | 18384 |
| 200 | Ga0466959_0028755 | 3300045049 | Bacteria | 4119 |
| 201 | Ga0466959_0050280 | 3300045049 | Bacteria | 3060 |
| 202 | Ga0466958_0053576 | 3300045836 | Bacteria | 2446 |
| 203 | Ga0466967_0011120 | 3300045976 | Bacteria | 6799 |
| 204 | Ga0466967_0016854 | 3300045976 | Bacteria | 5777 |
| 205 | Ga0466967_0120754 | 3300045976 | Bacteria | 2421 |
| 206 | Ga0495592_0012073 | 3300046454 | Bacteria | 6548 |
| 207 | Ga0495592_0087670 | 3300046454 | Bacteria | 2238 |
| 208 | Ga0495603_0010808 | 3300046455 | Bacteria | 5539 |
| 209 | Ga0495603_0034717 | 3300046455 | Bacteria | 3031 |
| 210 | Ga0495629_0007359 | 3300046459 | Bacteria | 8116 |
| 211 | Ga0495629_0012534 | 3300046459 | Bacteria | 6139 |
| 212 | Ga0495629_0016720 | 3300046459 | Bacteria | 5264 |
| 213 | Ga0495629_0062914 | 3300046459 | Bacteria | 2591 |
| 214 | Ga0495629_0118287 | 3300046459 | Bacteria | 1846 |
| 215 | Ga0495651_0000746 | 3300046462 | Bacteria | 25159 |
| 216 | Ga0495651_0004099 | 3300046462 | Bacteria | 11147 |
| 217 | Ga0495651_0005034 | 3300046462 | Bacteria | 10094 |
| 218 | Ga0495651_0011792 | 3300046462 | Bacteria | 6718 |
| 219 | Ga0495653_0037978 | 3300046463 | Bacteria | 3780 |
| 220 | Ga0495580_0001689 | 3300046472 | Bacteria | 19379 |
| 221 | Ga0495582_0001587 | 3300046473 | Bacteria | 12827 |
| 222 | Ga0495639_0003187 | 3300046475 | Bacteria | 7124 |
| 223 | Ga0495608_0005863 | 3300046511 | Bacteria | 8743 |
| 224 | Ga0495618_0016281 | 3300046514 | Bacteria | 4547 |
| 225 | Ga0495618_0063523 | 3300046514 | Bacteria | 2344 |
| 226 | Ga0495628_0031001 | 3300046516 | Bacteria | 4325 |
| 227 | Ga0495628_0173261 | 3300046516 | Bacteria | 1635 |
| 228 | Ga0495630_0001821 | 3300046517 | Bacteria | 14872 |
| 229 | Ga0495630_0033547 | 3300046517 | Bacteria | 3829 |
| 230 | Ga0495643_0001114 | 3300046522 | Bacteria | 26618 |
| 231 | Ga0495652_0000965 | 3300046529 | Bacteria | 32930 |
| 232 | Ga0495652_0002668 | 3300046529 | Bacteria | 18144 |
| 233 | Ga0495652_0005365 | 3300046529 | Bacteria | 12084 |
| 234 | Ga0495652_0062143 | 3300046529 | Bacteria | 3150 |
| 235 | Ga0495665_0001407 | 3300046531 | Bacteria | 12888 |
| 236 | Ga0495645_0007885 | 3300046543 | Bacteria | 7408 |
| 237 | Ga0495645_0021208 | 3300046543 | Bacteria | 4695 |
| 238 | Ga0495645_0039062 | 3300046543 | Bacteria | 3461 |
| 239 | Ga0495667_0027178 | 3300046559 | Bacteria | 3857 |
| 240 | Ga0495625_0039498 | 3300046660 | Bacteria | 3445 |
| 241 | Ga0495635_0014829 | 3300046663 | Bacteria | 5451 |
| 242 | Ga0495635_0027228 | 3300046663 | Bacteria | 3976 |
| 243 | Ga0495588_0000462 | 3300046674 | Bacteria | 20373 |
| 244 | Ga0495588_0009541 | 3300046674 | Bacteria | 4490 |
| 245 | Ga0495599_0019579 | 3300046678 | Bacteria | 4219 |
| 246 | Ga0495646_0001102 | 3300046680 | Bacteria | 15721 |
| 247 | Ga0495658_0000812 | 3300046683 | Bacteria | 16764 |
| 248 | Ga0495613_0006807 | 3300046689 | Bacteria | 8536 |
| 249 | Ga0495670_0009064 | 3300046691 | Bacteria | 4895 |
| 250 | Ga0495671_0034357 | 3300046692 | Bacteria | 2578 |
| 251 | Ga0495600_0005058 | 3300046809 | Bacteria | 7921 |
| 252 | Ga0495600_0031149 | 3300046809 | Bacteria | 3454 |
| 253 | Ga0495660_0016992 | 3300046810 | Bacteria | 4190 |
| 254 | Ga0495581_0004758 | 3300047315 | Bacteria | 7839 |
| 255 | Ga0495604_0043468 | 3300047317 | Bacteria | 3517 |
| 256 | Ga0495604_0069032 | 3300047317 | Bacteria | 2680 |
| 257 | Ga0495604_0083067 | 3300047317 | Bacteria | 2394 |
| 258 | Ga0495674_0030281 | 3300047319 | Bacteria | 4922 |
| 259 | Ga0495687_001148 | 3300047443 | Bacteria | 25640 |
| 260 | Ga0495675_0008928 | 3300047444 | Bacteria | 6230 |
| 261 | Ga0495675_0018943 | 3300047444 | Bacteria | 4372 |
| 262 | Ga0495685_002731 | 3300047447 | Bacteria | 5562 |
| 263 | Ga0495685_041331 | 3300047447 | Bacteria | 1576 |
| 264 | Ga0495681_0001712 | 3300047470 | Bacteria | 16221 |
| 265 | Ga0495681_0001954 | 3300047470 | Bacteria | 15086 |
| 266 | Ga0495684_0003777 | 3300047471 | Bacteria | 11824 |
| 267 | Ga0495686_0026169 | 3300047472 | Bacteria | 3818 |
| 268 | Ga0495593_0007945 | 3300047673 | Bacteria | 6179 |
| 269 | Ga0495602_0011279 | 3300048088 | Bacteria | 9244 |
| 270 | Ga0495614_0005368 | 3300048089 | Bacteria | 5781 |
| 271 | Ga0496101_0001210 | 3300048904 | Bacteria | 15447 |
| 272 | Ga0496101_0074699 | 3300048904 | Bacteria | 2494 |
| 273 | Ga0496105_0032658 | 3300048908 | Bacteria | 4273 |
| 274 | Ga0496107_0070315 | 3300048910 | Bacteria | 2541 |
| 275 | Ga0496109_0004390 | 3300048912 | Bacteria | 11780 |
| 276 | Ga0496109_0100776 | 3300048912 | Bacteria | 2680 |
| 277 | Ga0496110_0032098 | 3300048913 | Bacteria | 4533 |
| 278 | Ga0496114_0025379 | 3300048917 | Bacteria | 4843 |
| 279 | Ga0496114_0102309 | 3300048917 | Bacteria | 2447 |
| 280 | Ga0496115_0009224 | 3300048918 | Bacteria | 7325 |
| 281 | Ga0496117_0008510 | 3300048920 | Bacteria | 9730 |
| 282 | Ga0496118_0000360 | 3300048921 | Bacteria | 77010 |
| 283 | Ga0496119_0044992 | 3300048922 | Bacteria | 2772 |
| 284 | Ga0496121_0042132 | 3300048924 | Bacteria | 3978 |
| 285 | Ga0496122_0083232 | 3300048925 | Bacteria | 2219 |
| 286 | Ga0496124_0000173 | 3300048927 | Bacteria | 129688 |
| 287 | Ga0496126_0000003 | 3300048929 | Bacteria | 961576 |
| 288 | Ga0496126_0124408 | 3300048929 | Bacteria | 2233 |
| 289 | Ga0501031_0060209 | 3300049568 | Bacteria | 2475 |
| 290 | Ga0501033_0014121 | 3300049570 | Bacteria | 6071 |
| 291 | Ga0501033_0093981 | 3300049570 | Bacteria | 2193 |
| 292 | Ga0501034_0010750 | 3300049571 | Bacteria | 9506 |
| 293 | Ga0501036_0005584 | 3300049572 | Bacteria | 10201 |
| 294 | Ga0501036_0027965 | 3300049572 | Bacteria | 4767 |
| 295 | Ga0501039_0143915 | 3300049575 | Bacteria | 1873 |
| 296 | Ga0501043_0085578 | 3300049579 | Bacteria | 2477 |
| 297 | Ga0501046_0027505 | 3300049580 | Bacteria | 4638 |
| 298 | Ga0501067_0040733 | 3300049583 | Bacteria | 2579 |
| 299 | Ga0501070_0007529 | 3300049586 | Bacteria | 9252 |
| 300 | Ga0501070_0128660 | 3300049586 | Bacteria | 2092 |
| 301 | Ga0501216_000700 | 3300049660 | Bacteria | 4135 |
| 302 | Ga0501217_001118 | 3300049661 | Bacteria | 4902 |
| 303 | Ga0501227_001402 | 3300049665 | Bacteria | 5394 |
| 304 | Ga0501225_0006877 | 3300049705 | Bacteria | 3317 |
| 305 | Ga0501080_0110545 | 3300049742 | Bacteria | 2547 |
| 306 | Ga0501081_0123124 | 3300049743 | Bacteria | 1849 |
| 307 | Ga0501083_0000016 | 3300049744 | Bacteria | 156309 |
| 308 | Ga0501083_0026183 | 3300049744 | Bacteria | 4033 |
| 309 | Ga0501035_0006134 | 3300049822 | Bacteria | 11317 |
| 310 | Ga0501044_0094612 | 3300049823 | Bacteria | 3012 |
| 311 | Ga0501045_0014034 | 3300049824 | Bacteria | 5670 |
| 312 | nmdc:mga09592_16663_c1 | 3300050508 | Bacteria | 6013 |
| 313 | nmdc:mga08y16_14406_c1 | 3300050511 | Bacteria | 8320 |
| 314 | nmdc:mga0n895_188279_c1 | 3300050512 | Bacteria | 2095 |
| 315 | Ga0495601_0014672 | 3300053077 | Bacteria | 4725 |
| 316 | Ga0495612_0007843 | 3300053078 | Bacteria | 4353 |
| 317 | Ga0495612_0034244 | 3300053078 | Bacteria | 2056 |
| 318 | Ga0495595_0058377 | 3300053084 | Bacteria | 1802 |
| 319 | Ga0495619_0020883 | 3300053085 | Bacteria | 4176 |
| 320 | Ga0495619_0064376 | 3300053085 | Bacteria | 2444 |
| 321 | Ga0500578_0048214 | 3300053086 | Bacteria | 2733 |
| 322 | Ga0500566_0009775 | 3300053094 | Bacteria | 5664 |
| 323 | Ga0500640_008614 | 3300053095 | Bacteria | 4041 |
| 324 | Ga0500554_001102 | 3300053102 | Bacteria | 5225 |
| 325 | Ga0500560_011274 | 3300053107 | Bacteria | 2274 |
| 326 | Ga0500595_000822 | 3300053119 | Bacteria | 17876 |
| 327 | Ga0500621_051385 | 3300053126 | Bacteria | 1668 |
| 328 | Ga0500628_002706 | 3300053129 | Bacteria | 2918 |
| 329 | Ga0500658_0003443 | 3300053134 | Bacteria | 5973 |
| 330 | Ga0500559_0000584 | 3300053136 | Bacteria | 25005 |
| 331 | Ga0500568_0014198 | 3300053139 | Bacteria | 3605 |
| 332 | Ga0500573_0073773 | 3300053140 | Bacteria | 1944 |
| 333 | Ga0500600_0018549 | 3300053149 | Bacteria | 4192 |
| 334 | Ga0500616_0088369 | 3300053153 | Bacteria | 1540 |
| 335 | Ga0500633_0002180 | 3300053160 | Bacteria | 3964 |
| 336 | Ga0500634_0010312 | 3300053161 | Bacteria | 4768 |
| 337 | Ga0501082_0015412 | 3300060353 | Bacteria | 6579 |
| 338 | Ga0466962_0004724 | 3300061719 | Bacteria | 6546 |
| 339 | Ga0466962_0005401 | 3300061719 | Bacteria | 6146 |
| 340 | Ga0466962_0006959 | 3300061719 | Bacteria | 5422 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046516 | Ga0495628_0173261 | Ga0495628_0173261_37_1329 | 397 |
| 2 | 3300045976 | Ga0466967_0120754 | Ga0466967_0120754_1090_2376 | 408 |
| 3 | 3300035725 | Ga0373947_0044802 | Ga0373947_0044802_24_1316 | 409 |
| 4 | 3300046514 | Ga0495618_0063523 | Ga0495618_0063523_26_1318 | 409 |
| 5 | 3300049583 | Ga0501067_0040733 | Ga0501067_0040733_66_1358 | 409 |
| 6 | 3300049824 | Ga0501045_0014034 | Ga0501045_0014034_4360_5652 | 410 |
| 7 | 3300026116 | Ga0207674_10002764 | Ga0207674_1000276417 | 416 |
| 8 | 3300050512 | nmdc:mga0n895_188279_c1 | nmdc:mga0n895_188279_c1_24_1523 | 416 |
| 9 | iso_pu_bacteria | 2880495981 | 2880502613 | 417 |
| 10 | 3300025933 | Ga0207706_10216935 | Ga0207706_102169352 | 431 |
| 11 | 3300048929 | Ga0496126_0124408 | Ga0496126_0124408_822_2186 | 431 |
| 12 | 3300035170 | Ga0373943_0018138 | Ga0373943_0018138_1308_2807 | 435 |
| 13 | 3300025901 | Ga0207688_10009983 | Ga0207688_100099833 | 436 |
| 14 | 3300006871 | Ga0075434_100049836 | Ga0075434_1000498361 | 443 |
| 15 | 3300053126 | Ga0500621_051385 | Ga0500621_051385_11_1408 | 443 |
| 16 | 3300053153 | Ga0500616_0088369 | Ga0500616_0088369_12_1409 | 443 |
| 17 | 3300005436 | Ga0070713_100040455 | Ga0070713_1000404553 | 446 |
| 18 | 3300025928 | Ga0207700_10072586 | Ga0207700_100725862 | 446 |
| 19 | 3300044693 | Ga0466961_0010801 | Ga0466961_0010801_2941_4431 | 447 |
| 20 | 3300044694 | Ga0466963_0011336 | Ga0466963_0011336_357_1847 | 447 |
| 21 | 3300005434 | Ga0070709_10001288 | Ga0070709_100012888 | 448 |
| 22 | 3300005435 | Ga0070714_100005719 | Ga0070714_1000057194 | 448 |
| 23 | 3300005436 | Ga0070713_100000541 | Ga0070713_1000005411 | 448 |
| 24 | 3300006028 | Ga0070717_10021469 | Ga0070717_100214694 | 448 |
| 25 | 3300006175 | Ga0070712_100008797 | Ga0070712_1000087976 | 448 |
| 26 | 3300025906 | Ga0207699_10030302 | Ga0207699_100303022 | 448 |
| 27 | 3300025915 | Ga0207693_10047764 | Ga0207693_100477643 | 448 |
| 28 | 3300025916 | Ga0207663_10021086 | Ga0207663_100210863 | 448 |
| 29 | 3300025928 | Ga0207700_10000785 | Ga0207700_100007851 | 448 |
| 30 | 3300025929 | Ga0207664_10010749 | Ga0207664_100107496 | 448 |
| 31 | 3300025917 | Ga0207660_10083144 | Ga0207660_100831442 | 449 |
| 32 | 3300038443 | Ga0395901_0063916 | Ga0395901_0063916_1716_3215 | 449 |
| 33 | 3300044901 | Ga0466960_0015178 | Ga0466960_0015178_484_2016 | 450 |
| 34 | 3300049568 | Ga0501031_0060209 | Ga0501031_0060209_191_1612 | 450 |
| 35 | 3300044719 | Ga0466971_0006463 | Ga0466971_0006463_419_1909 | 452 |
| 36 | 3300045049 | Ga0466959_0028755 | Ga0466959_0028755_440_1930 | 452 |
| 37 | 3300042133 | Ga0450896_001153 | Ga0450896_001153_1409_2911 | 454 |
| 38 | 3300042134 | Ga0450898_007468 | Ga0450898_007468_188_1690 | 454 |
| 39 | 3300042145 | Ga0450906_002787 | Ga0450906_002787_1829_3331 | 454 |
| 40 | 3300053084 | Ga0495595_0058377 | Ga0495595_0058377_29_1453 | 454 |
| 41 | 3300009551 | Ga0105238_10347286 | Ga0105238_103472861 | 455 |
| 42 | 3300037466 | Ga0395898_0155691 | Ga0395898_0155691_426_1925 | 458 |
| 43 | 3300005329 | Ga0070683_100054265 | Ga0070683_1000542652 | 459 |
| 44 | 3300005330 | Ga0070690_100001897 | Ga0070690_1000018976 | 459 |
| 45 | 3300005334 | Ga0068869_100011210 | Ga0068869_1000112102 | 459 |
| 46 | 3300005337 | Ga0070682_100007558 | Ga0070682_1000075581 | 459 |
| 47 | 3300005339 | Ga0070660_100046734 | Ga0070660_1000467342 | 459 |
| 48 | 3300005340 | Ga0070689_100023063 | Ga0070689_1000230632 | 459 |
| 49 | 3300005344 | Ga0070661_100003282 | Ga0070661_1000032826 | 459 |
| 50 | 3300005345 | Ga0070692_10004130 | Ga0070692_100041301 | 459 |
| 51 | 3300005354 | Ga0070675_100012661 | Ga0070675_1000126611 | 459 |
| 52 | 3300005355 | Ga0070671_100161062 | Ga0070671_1001610621 | 459 |
| 53 | 3300005366 | Ga0070659_100035917 | Ga0070659_1000359172 | 459 |
| 54 | 3300005457 | Ga0070662_100049200 | Ga0070662_1000492001 | 459 |
| 55 | 3300005535 | Ga0070684_100036893 | Ga0070684_1000368932 | 459 |
| 56 | 3300005563 | Ga0068855_100025480 | Ga0068855_1000254802 | 459 |
| 57 | 3300005577 | Ga0068857_100031404 | Ga0068857_1000314043 | 459 |
| 58 | 3300005614 | Ga0068856_100087732 | Ga0068856_1000877322 | 459 |
| 59 | 3300005616 | Ga0068852_100247142 | Ga0068852_1002471421 | 459 |
| 60 | 3300005617 | Ga0068859_100023946 | Ga0068859_1000239461 | 459 |
| 61 | 3300005841 | Ga0068863_100003147 | Ga0068863_1000031476 | 459 |
| 62 | 3300005842 | Ga0068858_100051874 | Ga0068858_1000518742 | 459 |
| 63 | 3300005843 | Ga0068860_100007014 | Ga0068860_1000070147 | 459 |
| 64 | 3300006931 | Ga0097620_100023951 | Ga0097620_1000239514 | 459 |
| 65 | 3300009098 | Ga0105245_10005849 | Ga0105245_100058494 | 459 |
| 66 | 3300009177 | Ga0105248_10002021 | Ga0105248_1000202111 | 459 |
| 67 | 3300010375 | Ga0105239_10030303 | Ga0105239_100303031 | 459 |
| 68 | 3300011119 | Ga0105246_10008511 | Ga0105246_100085114 | 459 |
| 69 | 3300013102 | Ga0157371_10026713 | Ga0157371_100267132 | 459 |
| 70 | 3300013105 | Ga0157369_10046375 | Ga0157369_100463753 | 459 |
| 71 | 3300013296 | Ga0157374_10010881 | Ga0157374_100108815 | 459 |
| 72 | 3300013307 | Ga0157372_10015051 | Ga0157372_100150511 | 459 |
| 73 | 3300014745 | Ga0157377_10000534 | Ga0157377_1000053412 | 459 |
| 74 | 3300014969 | Ga0157376_10016113 | Ga0157376_100161132 | 459 |
| 75 | 3300025912 | Ga0207707_10008896 | Ga0207707_100088965 | 459 |
| 76 | 3300025919 | Ga0207657_10042526 | Ga0207657_100425262 | 459 |
| 77 | 3300025926 | Ga0207659_10002633 | Ga0207659_100026332 | 459 |
| 78 | 3300025933 | Ga0207706_10017394 | Ga0207706_100173944 | 459 |
| 79 | 3300025941 | Ga0207711_10046148 | Ga0207711_100461482 | 459 |
| 80 | 3300025942 | Ga0207689_10001441 | Ga0207689_1000144119 | 459 |
| 81 | 3300025944 | Ga0207661_10000490 | Ga0207661_100004908 | 459 |
| 82 | 3300025945 | Ga0207679_10000314 | Ga0207679_100003147 | 459 |
| 83 | 3300025949 | Ga0207667_10082367 | Ga0207667_100823671 | 459 |
| 84 | 3300026088 | Ga0207641_10131211 | Ga0207641_101312112 | 459 |
| 85 | 3300026095 | Ga0207676_10003858 | Ga0207676_100038582 | 459 |
| 86 | 3300026116 | Ga0207674_10000656 | Ga0207674_1000065611 | 459 |
| 87 | 3300026142 | Ga0207698_10101984 | Ga0207698_101019841 | 459 |
| 88 | 3300028381 | Ga0268264_10011659 | Ga0268264_100116596 | 459 |
| 89 | 3300044706 | Ga0466964_0020119 | Ga0466964_0020119_499_1986 | 459 |
| 90 | 3300037418 | Ga0395900_0040290 | Ga0395900_0040290_2607_4097 | 460 |
| 91 | 3300037466 | Ga0395898_0104177 | Ga0395898_0104177_186_1676 | 460 |
| 92 | 3300005435 | Ga0070714_100011426 | Ga0070714_1000114262 | 462 |
| 93 | 3300009176 | Ga0105242_10081061 | Ga0105242_100810611 | 462 |
| 94 | 3300025934 | Ga0207686_10107416 | Ga0207686_101074161 | 462 |
| 95 | 3300044656 | Ga0466969_0035869 | Ga0466969_0035869_326_1834 | 463 |
| 96 | 3300048929 | Ga0496126_0000003 | Ga0496126_0000003_629083_630579 | 463 |
| 97 | 3300009011 | Ga0105251_10009073 | Ga0105251_100090732 | 464 |
| 98 | 3300025735 | Ga0207713_1015766 | Ga0207713_10157662 | 464 |
| 99 | 3300028786 | Ga0307517_10007273 | Ga0307517_100072734 | 464 |
| 100 | 3300028794 | Ga0307515_10000541 | Ga0307515_100005416 | 464 |
| 101 | 3300031616 | Ga0307508_10083619 | Ga0307508_100836192 | 464 |
| 102 | 3300031616 | Ga0307508_10124049 | Ga0307508_101240491 | 464 |
| 103 | 3300037466 | Ga0395898_0099675 | Ga0395898_0099675_1001_2503 | 464 |
| 104 | 3300044694 | Ga0466963_0053976 | Ga0466963_0053976_1128_2630 | 464 |
| 105 | 3300044765 | Ga0466970_0013738 | Ga0466970_0013738_801_2321 | 464 |
| 106 | 3300045976 | Ga0466967_0016854 | Ga0466967_0016854_3219_4721 | 464 |
| 107 | 3300046455 | Ga0495603_0010808 | Ga0495603_0010808_2727_4256 | 464 |
| 108 | 3300046459 | Ga0495629_0007359 | Ga0495629_0007359_5521_7050 | 464 |
| 109 | 3300046459 | Ga0495629_0118287 | Ga0495629_0118287_84_1604 | 464 |
| 110 | 3300046660 | Ga0495625_0039498 | Ga0495625_0039498_909_2429 | 464 |
| 111 | 3300046674 | Ga0495588_0009541 | Ga0495588_0009541_600_2120 | 464 |
| 112 | 3300046692 | Ga0495671_0034357 | Ga0495671_0034357_556_2076 | 464 |
| 113 | 3300047443 | Ga0495687_001148 | Ga0495687_001148_10269_11789 | 464 |
| 114 | 3300047470 | Ga0495681_0001712 | Ga0495681_0001712_3543_5063 | 464 |
| 115 | 3300048089 | Ga0495614_0005368 | Ga0495614_0005368_4091_5611 | 464 |
| 116 | 3300048912 | Ga0496109_0004390 | Ga0496109_0004390_7122_8630 | 464 |
| 117 | 3300049570 | Ga0501033_0014121 | Ga0501033_0014121_1181_2683 | 464 |
| 118 | 3300049571 | Ga0501034_0010750 | Ga0501034_0010750_5590_7092 | 464 |
| 119 | 3300049572 | Ga0501036_0005584 | Ga0501036_0005584_5597_7099 | 464 |
| 120 | 3300049572 | Ga0501036_0027965 | Ga0501036_0027965_192_1694 | 464 |
| 121 | 3300049575 | Ga0501039_0143915 | Ga0501039_0143915_290_1792 | 464 |
| 122 | 3300049579 | Ga0501043_0085578 | Ga0501043_0085578_923_2425 | 464 |
| 123 | 3300049586 | Ga0501070_0007529 | Ga0501070_0007529_5262_6764 | 464 |
| 124 | 3300049822 | Ga0501035_0006134 | Ga0501035_0006134_5574_7076 | 464 |
| 125 | 3300053107 | Ga0500560_011274 | Ga0500560_011274_230_1750 | 464 |
| 126 | 3300021384 | Ga0213876_10010514 | Ga0213876_100105143 | 465 |
| 127 | 3300046462 | Ga0495651_0000746 | Ga0495651_0000746_12164_13678 | 465 |
| 128 | 3300046529 | Ga0495652_0002668 | Ga0495652_0002668_2588_4102 | 465 |
| 129 | 3300046543 | Ga0495645_0039062 | Ga0495645_0039062_667_2181 | 465 |
| 130 | 3300026075 | Ga0207708_10132877 | Ga0207708_101328772 | 466 |
| 131 | 3300047317 | Ga0495604_0083067 | Ga0495604_0083067_151_1665 | 466 |
| 132 | 3300047447 | Ga0495685_041331 | Ga0495685_041331_14_1498 | 466 |
| 133 | 3300009147 | Ga0114129_10159845 | Ga0114129_101598452 | 467 |
| 134 | 3300044712 | Ga0453684_0246297 | Ga0453684_0246297_300_1799 | 467 |
| 135 | 3300049580 | Ga0501046_0027505 | Ga0501046_0027505_2084_3601 | 467 |
| 136 | 3300031691 | Ga0316579_10045112 | Ga0316579_100451122 | 468 |
| 137 | 3300038443 | Ga0395901_0105569 | Ga0395901_0105569_1035_2528 | 468 |
| 138 | 3300048904 | Ga0496101_0074699 | Ga0496101_0074699_720_2213 | 468 |
| 139 | 3300048924 | Ga0496121_0042132 | Ga0496121_0042132_799_2292 | 468 |
| 140 | 3300013307 | Ga0157372_10204493 | Ga0157372_102044932 | 469 |
| 141 | 3300049744 | Ga0501083_0000016 | Ga0501083_0000016_138106_139644 | 469 |
| 142 | iso_pu_bacteria | 2558860280 | 2559425325 | 471 |
| 143 | iso_pu_bacteria | 2856741275 | 2856745794 | 471 |
| 144 | iso_pu_bacteria | 2870782633 | 2870786315 | 471 |
| 145 | iso_pu_bacteria | 2891562705 | 2891569121 | 471 |
| 146 | 3300025928 | Ga0207700_10132668 | Ga0207700_101326681 | 472 |
| 147 | iso_pu_bacteria | 2643221635 | 2644198219 | 472 |
| 148 | iso_pu_bacteria | 2884693830 | 2884695895 | 472 |
| 149 | iso_pu_bacteria | 2895442618 | 2895447785 | 472 |
| 150 | iso_pu_bacteria | 2974315732 | 2974316980 | 472 |
| 151 | iso_pu_bacteria | 2984523437 | 2984525187 | 472 |
| 152 | 3300005548 | Ga0070665_100017867 | Ga0070665_1000178677 | 473 |
| 153 | 3300005563 | Ga0068855_100012008 | Ga0068855_1000120083 | 473 |
| 154 | 3300005578 | Ga0068854_100050692 | Ga0068854_1000506923 | 473 |
| 155 | 3300005616 | Ga0068852_100027013 | Ga0068852_1000270132 | 473 |
| 156 | 3300009174 | Ga0105241_10001107 | Ga0105241_100011074 | 473 |
| 157 | 3300009551 | Ga0105238_10007120 | Ga0105238_100071209 | 473 |
| 158 | 3300025913 | Ga0207695_10027241 | Ga0207695_100272411 | 473 |
| 159 | 3300025914 | Ga0207671_10000313 | Ga0207671_1000031346 | 473 |
| 160 | 3300025924 | Ga0207694_10002137 | Ga0207694_1000213716 | 473 |
| 161 | 3300025949 | Ga0207667_10067025 | Ga0207667_100670253 | 473 |
| 162 | 3300025981 | Ga0207640_10031313 | Ga0207640_100313132 | 473 |
| 163 | 3300026142 | Ga0207698_10038720 | Ga0207698_100387203 | 473 |
| 164 | 3300035086 | Ga0373934_0006853 | Ga0373934_0006853_1514_2995 | 473 |
| 165 | 3300035118 | Ga0373954_0024071 | Ga0373954_0024071_40_1521 | 473 |
| 166 | 3300035119 | Ga0373956_0002539 | Ga0373956_0002539_1209_2690 | 473 |
| 167 | 3300035172 | Ga0373955_0000331 | Ga0373955_0000331_313_1794 | 473 |
| 168 | 3300035410 | Ga0373924_0003761 | Ga0373924_0003761_3420_4901 | 473 |
| 169 | 3300036401 | Ga0373937_0001088 | Ga0373937_0001088_16999_18480 | 473 |
| 170 | 3300044693 | Ga0466961_0002090 | Ga0466961_0002090_10249_11763 | 473 |
| 171 | 3300046462 | Ga0495651_0004099 | Ga0495651_0004099_6180_7661 | 473 |
| 172 | 3300046463 | Ga0495653_0037978 | Ga0495653_0037978_1254_2735 | 473 |
| 173 | 3300046511 | Ga0495608_0005863 | Ga0495608_0005863_2814_4295 | 473 |
| 174 | 3300046517 | Ga0495630_0033547 | Ga0495630_0033547_1720_3201 | 473 |
| 175 | 3300046529 | Ga0495652_0005365 | Ga0495652_0005365_6180_7661 | 473 |
| 176 | 3300046543 | Ga0495645_0007885 | Ga0495645_0007885_4474_5955 | 473 |
| 177 | 3300046559 | Ga0495667_0027178 | Ga0495667_0027178_1331_2812 | 473 |
| 178 | 3300046663 | Ga0495635_0027228 | Ga0495635_0027228_1454_2935 | 473 |
| 179 | 3300046680 | Ga0495646_0001102 | Ga0495646_0001102_5430_6911 | 473 |
| 180 | 3300046809 | Ga0495600_0005058 | Ga0495600_0005058_3112_4593 | 473 |
| 181 | 3300047319 | Ga0495674_0030281 | Ga0495674_0030281_557_2038 | 473 |
| 182 | 3300047444 | Ga0495675_0018943 | Ga0495675_0018943_1638_3119 | 473 |
| 183 | 3300047471 | Ga0495684_0003777 | Ga0495684_0003777_5746_7227 | 473 |
| 184 | 3300048088 | Ga0495602_0011279 | Ga0495602_0011279_4477_5958 | 473 |
| 185 | 3300053077 | Ga0495601_0014672 | Ga0495601_0014672_3025_4506 | 473 |
| 186 | 3300053078 | Ga0495612_0034244 | Ga0495612_0034244_276_1757 | 473 |
| 187 | 3300053085 | Ga0495619_0020883 | Ga0495619_0020883_2364_3845 | 473 |
| 188 | iso_pu_bacteria | 2643221679 | 2644446533 | 473 |
| 189 | iso_pu_bacteria | 2675903060 | 2676495728 | 473 |
| 190 | iso_pu_bacteria | 2895427314 | 2895430396 | 473 |
| 191 | iso_pu_bacteria | 8055172936 | 8055173513 | 473 |
| 192 | 3300049586 | Ga0501070_0128660 | Ga0501070_0128660_319_1803 | 474 |
| 193 | 3300049742 | Ga0501080_0110545 | Ga0501080_0110545_979_2463 | 474 |
| 194 | 3300049743 | Ga0501081_0123124 | Ga0501081_0123124_223_1707 | 474 |
| 195 | 3300049744 | Ga0501083_0026183 | Ga0501083_0026183_666_2150 | 474 |
| 196 | 3300060353 | Ga0501082_0015412 | Ga0501082_0015412_1916_3400 | 474 |
| 197 | iso_pu_bacteria | 2643221601 | 2644015856 | 474 |
| 198 | iso_pu_bacteria | 2643221631 | 2644176463 | 474 |
| 199 | iso_pu_bacteria | 2643221678 | 2644436515 | 474 |
| 200 | iso_pu_bacteria | 2808606359 | 2808841404 | 474 |
| 201 | iso_pu_bacteria | 2863404153 | 2863405419 | 474 |
| 202 | iso_pu_bacteria | 2919468124 | 2919468797 | 474 |
| 203 | iso_pu_bacteria | 2995463766 | 2995469104 | 474 |
| 204 | 3300009094 | Ga0111539_10009078 | Ga0111539_100090784 | 475 |
| 205 | 3300027907 | Ga0207428_10024979 | Ga0207428_100249793 | 475 |
| 206 | 3300035170 | Ga0373943_0003248 | Ga0373943_0003248_1984_3471 | 475 |
| 207 | 3300035171 | Ga0373946_0006849 | Ga0373946_0006849_2060_3547 | 475 |
| 208 | 3300035695 | Ga0373927_0005992 | Ga0373927_0005992_4865_6352 | 475 |
| 209 | 3300035725 | Ga0373947_0026753 | Ga0373947_0026753_1276_2763 | 475 |
| 210 | 3300037068 | Ga0373925_0002378 | Ga0373925_0002378_8125_9612 | 475 |
| 211 | 3300046455 | Ga0495603_0034717 | Ga0495603_0034717_368_1855 | 475 |
| 212 | 3300046459 | Ga0495629_0016720 | Ga0495629_0016720_1942_3429 | 475 |
| 213 | 3300046472 | Ga0495580_0001689 | Ga0495580_0001689_13055_14542 | 475 |
| 214 | 3300046473 | Ga0495582_0001587 | Ga0495582_0001587_6475_7962 | 475 |
| 215 | 3300046475 | Ga0495639_0003187 | Ga0495639_0003187_996_2483 | 475 |
| 216 | 3300046517 | Ga0495630_0001821 | Ga0495630_0001821_1842_3329 | 475 |
| 217 | 3300046531 | Ga0495665_0001407 | Ga0495665_0001407_1889_3376 | 475 |
| 218 | 3300046674 | Ga0495588_0000462 | Ga0495588_0000462_17024_18511 | 475 |
| 219 | 3300046683 | Ga0495658_0000812 | Ga0495658_0000812_8923_10410 | 475 |
| 220 | 3300046689 | Ga0495613_0006807 | Ga0495613_0006807_1909_3396 | 475 |
| 221 | 3300047315 | Ga0495581_0004758 | Ga0495581_0004758_4328_5815 | 475 |
| 222 | 3300047673 | Ga0495593_0007945 | Ga0495593_0007945_1887_3374 | 475 |
| 223 | 3300050511 | nmdc:mga08y16_14406_c1 | nmdc:mga08y16_14406_c1_5089_6576 | 475 |
| 224 | iso_pu_bacteria | 2643221613 | 2644082827 | 475 |
| 225 | iso_pu_bacteria | 2643221721 | 2644665783 | 475 |
| 226 | iso_pu_bacteria | 2935890801 | 2935893255 | 475 |
| 227 | 3300005335 | Ga0070666_10019259 | Ga0070666_100192594 | 476 |
| 228 | 3300005530 | Ga0070679_100103880 | Ga0070679_1001038802 | 476 |
| 229 | 3300005842 | Ga0068858_100033940 | Ga0068858_1000339402 | 476 |
| 230 | 3300009098 | Ga0105245_10000114 | Ga0105245_1000011467 | 476 |
| 231 | 3300014968 | Ga0157379_10008756 | Ga0157379_100087563 | 476 |
| 232 | 3300025927 | Ga0207687_10000051 | Ga0207687_1000005135 | 476 |
| 233 | 3300025972 | Ga0207668_10050403 | Ga0207668_100504032 | 476 |
| 234 | 3300026035 | Ga0207703_10042975 | Ga0207703_100429754 | 476 |
| 235 | 3300026078 | Ga0207702_10072391 | Ga0207702_100723913 | 476 |
| 236 | 3300028800 | Ga0265338_10000073 | Ga0265338_100000733 | 476 |
| 237 | 3300031241 | Ga0265325_10008103 | Ga0265325_100081033 | 476 |
| 238 | 3300031249 | Ga0265339_10009068 | Ga0265339_100090683 | 476 |
| 239 | 3300031250 | Ga0265331_10014773 | Ga0265331_100147733 | 476 |
| 240 | 3300031344 | Ga0265316_10057053 | Ga0265316_100570532 | 476 |
| 241 | 3300031507 | Ga0307509_10004629 | Ga0307509_100046296 | 476 |
| 242 | 3300031595 | Ga0265313_10001810 | Ga0265313_100018105 | 476 |
| 243 | 3300046462 | Ga0495651_0005034 | Ga0495651_0005034_3174_4679 | 476 |
| 244 | 3300053136 | Ga0500559_0000584 | Ga0500559_0000584_1551_3041 | 476 |
| 245 | iso_pu_bacteria | 2654587600 | 2655033557 | 476 |
| 246 | 3300005435 | Ga0070714_100013938 | Ga0070714_1000139385 | 477 |
| 247 | 3300005471 | Ga0070698_100026244 | Ga0070698_1000262442 | 477 |
| 248 | 3300005548 | Ga0070665_100045224 | Ga0070665_1000452243 | 477 |
| 249 | 3300020069 | Ga0197907_11449058 | Ga0197907_114490582 | 477 |
| 250 | 3300025929 | Ga0207664_10000404 | Ga0207664_100004048 | 477 |
| 251 | 3300025929 | Ga0207664_10012413 | Ga0207664_100124134 | 477 |
| 252 | 3300025936 | Ga0207670_10011478 | Ga0207670_100114782 | 477 |
| 253 | 3300028379 | Ga0268266_10015033 | Ga0268266_100150335 | 477 |
| 254 | 3300033179 | Ga0307507_10000001 | Ga0307507_10000001187 | 477 |
| 255 | 3300037471 | Ga0395905_0102920 | Ga0395905_0102920_1064_2557 | 477 |
| 256 | 3300044656 | Ga0466969_0018777 | Ga0466969_0018777_1395_2912 | 477 |
| 257 | 3300044683 | Ga0466965_0007567 | Ga0466965_0007567_526_2022 | 477 |
| 258 | 3300044684 | Ga0466966_0005864 | Ga0466966_0005864_886_2403 | 477 |
| 259 | 3300044693 | Ga0466961_0033267 | Ga0466961_0033267_234_1751 | 477 |
| 260 | 3300044693 | Ga0466961_0065558 | Ga0466961_0065558_315_1832 | 477 |
| 261 | 3300044901 | Ga0466960_0008681 | Ga0466960_0008681_2454_3947 | 477 |
| 262 | 3300045836 | Ga0466958_0053576 | Ga0466958_0053576_714_2231 | 477 |
| 263 | 3300045976 | Ga0466967_0011120 | Ga0466967_0011120_2529_4022 | 477 |
| 264 | 3300049570 | Ga0501033_0093981 | Ga0501033_0093981_680_2173 | 477 |
| 265 | 3300061719 | Ga0466962_0004724 | Ga0466962_0004724_4490_6022 | 477 |
| 266 | 3300006880 | Ga0075429_100046892 | Ga0075429_1000468921 | 478 |
| 267 | 3300022467 | Ga0224712_10012425 | Ga0224712_100124252 | 478 |
| 268 | 3300031507 | Ga0307509_10083937 | Ga0307509_100839373 | 478 |
| 269 | 3300044684 | Ga0466966_0021660 | Ga0466966_0021660_199_1722 | 478 |
| 270 | 3300044693 | Ga0466961_0083151 | Ga0466961_0083151_157_1680 | 478 |
| 271 | 3300044719 | Ga0466971_0000060 | Ga0466971_0000060_12234_13751 | 478 |
| 272 | 3300044719 | Ga0466971_0001837 | Ga0466971_0001837_308_1831 | 478 |
| 273 | 3300045049 | Ga0466959_0000813 | Ga0466959_0000813_5356_6873 | 478 |
| 274 | 3300045049 | Ga0466959_0050280 | Ga0466959_0050280_1316_2839 | 478 |
| 275 | 3300046454 | Ga0495592_0012073 | Ga0495592_0012073_401_1924 | 478 |
| 276 | 3300046454 | Ga0495592_0087670 | Ga0495592_0087670_72_1589 | 478 |
| 277 | 3300046459 | Ga0495629_0062914 | Ga0495629_0062914_84_1613 | 478 |
| 278 | 3300046462 | Ga0495651_0011792 | Ga0495651_0011792_256_1773 | 478 |
| 279 | 3300046514 | Ga0495618_0016281 | Ga0495618_0016281_334_1851 | 478 |
| 280 | 3300046516 | Ga0495628_0031001 | Ga0495628_0031001_2719_4236 | 478 |
| 281 | 3300046529 | Ga0495652_0000965 | Ga0495652_0000965_27817_29334 | 478 |
| 282 | 3300046529 | Ga0495652_0062143 | Ga0495652_0062143_1539_3053 | 478 |
| 283 | 3300046543 | Ga0495645_0021208 | Ga0495645_0021208_2484_4007 | 478 |
| 284 | 3300046663 | Ga0495635_0014829 | Ga0495635_0014829_922_2439 | 478 |
| 285 | 3300046678 | Ga0495599_0019579 | Ga0495599_0019579_2170_3687 | 478 |
| 286 | 3300046809 | Ga0495600_0031149 | Ga0495600_0031149_479_1996 | 478 |
| 287 | 3300047317 | Ga0495604_0069032 | Ga0495604_0069032_1123_2637 | 478 |
| 288 | 3300047444 | Ga0495675_0008928 | Ga0495675_0008928_138_1661 | 478 |
| 289 | 3300053078 | Ga0495612_0007843 | Ga0495612_0007843_1110_2627 | 478 |
| 290 | 3300053085 | Ga0495619_0064376 | Ga0495619_0064376_313_1827 | 478 |
| 291 | 3300053140 | Ga0500573_0073773 | Ga0500573_0073773_328_1842 | 478 |
| 292 | 3300061719 | Ga0466962_0005401 | Ga0466962_0005401_4287_5810 | 478 |
| 293 | 3300061719 | Ga0466962_0006959 | Ga0466962_0006959_1525_3042 | 478 |
| 294 | iso_pu_bacteria | 2751185788 | 2753301079 | 478 |
| 295 | iso_pu_bacteria | 2818991472 | 2819740445 | 478 |
| 296 | iso_pu_bacteria | 2919042368 | 2919045897 | 478 |
| 297 | iso_pu_bacteria | 2928104781 | 2928107127 | 478 |
| 298 | iso_pu_bacteria | 2984551494 | 2984553252 | 478 |
| 299 | 3300005330 | Ga0070690_100002660 | Ga0070690_1000026607 | 479 |
| 300 | 3300005937 | Ga0081455_10046100 | Ga0081455_100461003 | 479 |
| 301 | 3300006028 | Ga0070717_10033897 | Ga0070717_100338972 | 479 |
| 302 | 3300013296 | Ga0157374_10010668 | Ga0157374_100106688 | 479 |
| 303 | 3300021388 | Ga0213875_10030719 | Ga0213875_100307192 | 479 |
| 304 | 3300022467 | Ga0224712_10026661 | Ga0224712_100266611 | 479 |
| 305 | 3300025913 | Ga0207695_10137068 | Ga0207695_101370682 | 479 |
| 306 | 3300025942 | Ga0207689_10028975 | Ga0207689_100289752 | 479 |
| 307 | 3300028786 | Ga0307517_10006962 | Ga0307517_100069628 | 479 |
| 308 | 3300028786 | Ga0307517_10037385 | Ga0307517_100373852 | 479 |
| 309 | 3300028800 | Ga0265338_10003474 | Ga0265338_1000347418 | 479 |
| 310 | 3300031507 | Ga0307509_10001164 | Ga0307509_1000116420 | 479 |
| 311 | 3300031649 | Ga0307514_10025423 | Ga0307514_100254234 | 479 |
| 312 | 3300031730 | Ga0307516_10027943 | Ga0307516_100279435 | 479 |
| 313 | 3300032126 | Ga0307415_100004912 | Ga0307415_1000049124 | 479 |
| 314 | 3300033179 | Ga0307507_10119514 | Ga0307507_101195142 | 479 |
| 315 | 3300035241 | Ga0373961_0000156 | Ga0373961_0000156_1429_2928 | 479 |
| 316 | 3300037853 | Ga0436364_1263823 | Ga0436364_1263823_23743_25248 | 479 |
| 317 | 3300046459 | Ga0495629_0012534 | Ga0495629_0012534_3959_5464 | 479 |
| 318 | 3300046522 | Ga0495643_0001114 | Ga0495643_0001114_10072_11577 | 479 |
| 319 | 3300046691 | Ga0495670_0009064 | Ga0495670_0009064_2178_3683 | 479 |
| 320 | 3300046810 | Ga0495660_0016992 | Ga0495660_0016992_2655_4160 | 479 |
| 321 | 3300047447 | Ga0495685_002731 | Ga0495685_002731_3164_4669 | 479 |
| 322 | 3300047470 | Ga0495681_0001954 | Ga0495681_0001954_5628_7133 | 479 |
| 323 | 3300047472 | Ga0495686_0026169 | Ga0495686_0026169_574_2091 | 479 |
| 324 | 3300049660 | Ga0501216_000700 | Ga0501216_000700_2439_3941 | 479 |
| 325 | 3300049661 | Ga0501217_001118 | Ga0501217_001118_695_2197 | 479 |
| 326 | 3300049665 | Ga0501227_001402 | Ga0501227_001402_3237_4739 | 479 |
| 327 | 3300049705 | Ga0501225_0006877 | Ga0501225_0006877_1143_2645 | 479 |
| 328 | 3300050508 | nmdc:mga09592_16663_c1 | nmdc:mga09592_16663_c1_4199_5698 | 479 |
| 329 | 3300053086 | Ga0500578_0048214 | Ga0500578_0048214_274_1779 | 479 |
| 330 | 3300053094 | Ga0500566_0009775 | Ga0500566_0009775_711_2210 | 479 |
| 331 | 3300053095 | Ga0500640_008614 | Ga0500640_008614_1180_2679 | 479 |
| 332 | 3300053102 | Ga0500554_001102 | Ga0500554_001102_3473_4972 | 479 |
| 333 | 3300053119 | Ga0500595_000822 | Ga0500595_000822_3013_4512 | 479 |
| 334 | 3300053129 | Ga0500628_002706 | Ga0500628_002706_989_2494 | 479 |
| 335 | 3300053134 | Ga0500658_0003443 | Ga0500658_0003443_2655_4160 | 479 |
| 336 | 3300053139 | Ga0500568_0014198 | Ga0500568_0014198_719_2221 | 479 |
| 337 | 3300053149 | Ga0500600_0018549 | Ga0500600_0018549_2271_3776 | 479 |
| 338 | 3300053160 | Ga0500633_0002180 | Ga0500633_0002180_547_2052 | 479 |
| 339 | 3300053161 | Ga0500634_0010312 | Ga0500634_0010312_1160_2665 | 479 |
| 340 | iso_pu_bacteria | 2751185734 | 2753074592 | 479 |
| 341 | iso_pu_bacteria | 8055066027 | 8055072883 | 479 |
| 342 | 3300049823 | Ga0501044_0094612 | Ga0501044_0094612_815_2329 | 480 |
| 343 | iso_pu_bacteria | 2731639228 | 2731908473 | 480 |
| 344 | 3300006038 | Ga0075365_10073683 | Ga0075365_100736832 | 481 |
| 345 | 3300035695 | Ga0373927_0002032 | Ga0373927_0002032_9996_11507 | 481 |
| 346 | 3300037068 | Ga0373925_0014913 | Ga0373925_0014913_3072_4580 | 481 |
| 347 | 3300048904 | Ga0496101_0001210 | Ga0496101_0001210_6177_7682 | 481 |
| 348 | 3300048908 | Ga0496105_0032658 | Ga0496105_0032658_1291_2796 | 481 |
| 349 | 3300048910 | Ga0496107_0070315 | Ga0496107_0070315_543_2048 | 481 |
| 350 | 3300048912 | Ga0496109_0100776 | Ga0496109_0100776_665_2179 | 481 |
| 351 | 3300048913 | Ga0496110_0032098 | Ga0496110_0032098_565_2079 | 481 |
| 352 | 3300048917 | Ga0496114_0025379 | Ga0496114_0025379_1035_2540 | 481 |
| 353 | 3300048918 | Ga0496115_0009224 | Ga0496115_0009224_5255_6760 | 481 |
| 354 | 3300003320 | rootH2_10079573 | rootH2_100795733 | 482 |
| 355 | 3300005548 | Ga0070665_100045260 | Ga0070665_1000452602 | 482 |
| 356 | 3300021388 | Ga0213875_10002068 | Ga0213875_100020688 | 482 |
| 357 | 3300025913 | Ga0207695_10037369 | Ga0207695_100373692 | 482 |
| 358 | 3300028379 | Ga0268266_10032081 | Ga0268266_100320812 | 482 |
| 359 | 3300037853 | Ga0436364_0108192 | Ga0436364_0108192_17175_18686 | 482 |
| 360 | 3300048920 | Ga0496117_0008510 | Ga0496117_0008510_5465_6976 | 482 |
| 361 | 3300048921 | Ga0496118_0000360 | Ga0496118_0000360_21188_22699 | 482 |
| 362 | 3300048922 | Ga0496119_0044992 | Ga0496119_0044992_531_2042 | 482 |
| 363 | 3300048925 | Ga0496122_0083232 | Ga0496122_0083232_276_1787 | 482 |
| 364 | 3300048927 | Ga0496124_0000173 | Ga0496124_0000173_106896_108407 | 482 |
| 365 | 3300047317 | Ga0495604_0043468 | Ga0495604_0043468_1430_2968 | 483 |
| 366 | iso_pu_bacteria | 2856858025 | 2856858363 | 483 |
| 367 | 3300028563 | Ga0265319_1019264 | Ga0265319_10192643 | 486 |
| 368 | 3300037312 | Ga0395899_0001617 | Ga0395899_0001617_16329_17876 | 486 |
| 369 | 3300048917 | Ga0496114_0102309 | Ga0496114_0102309_21_1553 | 486 |
| 370 | 3300028577 | Ga0265318_10004559 | Ga0265318_100045596 | 487 |
| 371 | 3300031238 | Ga0265332_10010797 | Ga0265332_100107974 | 487 |
| 372 | 3300031241 | Ga0265325_10051474 | Ga0265325_100514741 | 487 |
| 373 | iso_pu_bacteria | 2501939600 | 2501939734 | 487 |
| 374 | iso_pu_bacteria | 649633069 | 649813400 | 487 |
| 375 | 3300003203 | JGI25406J46586_10005644 | JGI25406J46586_100056442 | 491 |
| 376 | 3300005985 | Ga0081539_10000846 | Ga0081539_1000084616 | 491 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1t90-assembly1.cif.gz_D | crystal structure of methylmalonate semialdehyde dehydrogenase from bacillus subtilis | 0.9391 | 11 | 477 |
| 4zz7-assembly2.cif.gz_G | crystal structure of methylmalonate-semialdehyde dehydrogenase (dddc) from oceanimonas doudoroffii | 0.9369 | 12 | 480 |
| 4iym-assembly1.cif.gz_C | crystal structure of putative methylmalonate-semialdehyde dehydrogenase from sinorhizobium meliloti 1021 complexed with nad, target 011934 | 0.9289 | 10 | 482 |
| 4go4-assembly4.cif.gz_G | crystal structure of pnpe in complex with nicotinamide adenine dinucleotide | 0.9259 | 15 | 474 |
| 6wsa-assembly1.cif.gz_A | crystal structure of a betaine aldehyde dehydrogenase from burkholderia pseudomallei without cofactor | 0.9254 | 12 | 474 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1t90B01 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9861 | 11 | 257 | 3.40.605.10 |
| af_O53816_3_249_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9852 | 14 | 254 | 3.40.605.10 |
| af_Q54I10_27_272_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.982 | 12 | 256 | 3.40.605.10 |
| af_A0A1D8PM94_38_281_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9756 | 14 | 256 | 3.40.605.10 |
| af_Q54I10_27_272_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.9741 | 12 | 256 | 3.40.605.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G8MPF3-F1-model_v4 | deleted | 0.9856 | 12 | 221 |
|
| AF-A0A506XM08-F1-model_v4 | Aldehyde dehydrogenase family protein | 0.9821 | 151 | 270 |
GO:0004491
GO:0006210 GO:0006574 |
| AF-A0A357A2F5-F1-model_v4 | Malonate-semialdehyde dehydrogenase | 0.9816 | 12 | 197 |
GO:0004491
GO:0006210 GO:0006574 |
| AF-A0A382P791-F1-model_v4 | Aldehyde dehydrogenase domain-containing protein | 0.9795 | 12 | 240 |
GO:0004491
GO:0006210 GO:0006574 |
| AF-A0A7K2APV5-F1-model_v4 | methylmalonate-semialdehyde dehydrogenase (CoA acylating) (EC 1.2.1.27) | 0.9794 | 12 | 307 |
GO:0004491
GO:0006210 GO:0006574 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar