F427524

General Info

Members Datasets Scaffolds Average Seq Length
376 237 752 313

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_382018_c1|nmdc:mga08y16_382018_c1_147_1193
Length 348
Sequence MGERKGTLLTSFAVTGALLNLGPLSRTLICMPGTPPARYVYLGPEGTFAEQALRTLPMARKARLEPALSVPEALDAVRAGEADAALVPLENSIGGAEGVTLDEIANGAPLIITREVVLPVNFVLAARKRIAVESISTVAAHPNAARQCRGWLRDHAPGATVVEVLSNGAAAVAAASGAYDAAICAPIGAQRKKLAVLAEEIADHKDSMTRFALVGRPGPXXXXTGEDVTSLAVYISADRVGALLTVLTELAVRGVNLTRIESRPTGERLGRYVFFLDCTGHVAEVRMGEALQGLHRVCADVRFLGSYPRAVSPSEPRSARAHHAPPGTSDADFADSAAWLARLRDGTL

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
161 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
162 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
179 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
224 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
225 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
227 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
228 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
229 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
230 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
231 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
232 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
233 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
234 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
235 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
236 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
237 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.28
Metatranscriptomes 0.8
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 7.45
Rhizosphere 83.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_382018_c1 3300050511 Bacteria 1443
2 JGI25406J46586_10040977 3300003203 Bacteria 1635
3 rootH2_10037934 3300003320 Bacteria 3635
4 Ga0070676_10280918 3300005328 Bacteria 1122
5 Ga0070683_100000258 3300005329 Bacteria 36483
6 Ga0070683_100010211 3300005329 Bacteria 8063
7 Ga0070690_100090888 3300005330 Bacteria 2010
8 Ga0070670_100022346 3300005331 Bacteria 5445
9 Ga0070670_100022371 3300005331 Bacteria 5442
10 Ga0070670_100443245 3300005331 Bacteria 1150
11 Ga0068869_100006573 3300005334 Bacteria 7376
12 Ga0068869_100056725 3300005334 Bacteria 2857
13 Ga0070666_10297282 3300005335 Bacteria 1149
14 Ga0070680_100084793 3300005336 Bacteria 2617
15 Ga0070680_100293713 3300005336 Bacteria 1378
16 Ga0070680_100493528 3300005336 Bacteria 1047
17 Ga0070682_100005944 3300005337 Bacteria 6830
18 Ga0070682_100054335 3300005337 Bacteria 2512
19 Ga0068868_100002700 3300005338 Bacteria 12310
20 Ga0068868_100004298 3300005338 Bacteria 9976
21 Ga0070660_100199997 3300005339 Bacteria 1621
22 Ga0070660_100332410 3300005339 Bacteria 1249
23 Ga0070691_10049930 3300005341 Bacteria 1994
24 Ga0070661_100023981 3300005344 Bacteria 4377
25 Ga0070661_100051184 3300005344 Bacteria 3022
26 Ga0070661_100225862 3300005344 Bacteria 1437
27 Ga0070692_10024666 3300005345 Bacteria 2957
28 Ga0070668_100000635 3300005347 Bacteria 23621
29 Ga0070669_100155196 3300005353 Bacteria 1775
30 Ga0070675_100003688 3300005354 Bacteria 11642
31 Ga0070675_100006713 3300005354 Bacteria 8849
32 Ga0070671_100011595 3300005355 Bacteria 7092
33 Ga0070673_100028740 3300005364 Bacteria 4139
34 Ga0070667_100042428 3300005367 Bacteria 3817
35 Ga0070667_100067010 3300005367 Bacteria 3051
36 Ga0070667_100077989 3300005367 Bacteria 2829
37 Ga0070667_100271009 3300005367 Bacteria 1522
38 Ga0070713_100119691 3300005436 Bacteria 2307
39 Ga0070713_100131846 3300005436 Bacteria 2205
40 Ga0070700_100003603 3300005441 Bacteria 8007
41 Ga0070700_100010691 3300005441 Bacteria 5070
42 Ga0070663_100000918 3300005455 Bacteria 15995
43 Ga0070663_100007384 3300005455 Bacteria 6686
44 Ga0070678_100083009 3300005456 Bacteria 2435
45 Ga0070678_100088268 3300005456 Bacteria 2370
46 Ga0070678_100133933 3300005456 Bacteria 1973
47 Ga0070662_100023367 3300005457 Bacteria 4245
48 Ga0070662_100173384 3300005457 Bacteria 1695
49 Ga0070681_10341548 3300005458 Bacteria 1407
50 Ga0070681_10458186 3300005458 Bacteria 1187
51 Ga0070685_10148014 3300005466 Bacteria 1485
52 Ga0070699_100308171 3300005518 Bacteria 1421
53 Ga0070679_100010142 3300005530 Bacteria 8932
54 Ga0070684_100070947 3300005535 Bacteria 3066
55 Ga0070684_100123276 3300005535 Bacteria 2332
56 Ga0070684_100165313 3300005535 Bacteria 2008
57 Ga0068853_100465834 3300005539 Bacteria 1190
58 Ga0070672_100257752 3300005543 Bacteria 1470
59 Ga0070686_100134432 3300005544 Bacteria 1714
60 Ga0070693_100001753 3300005547 Bacteria 9889
61 Ga0070693_100115020 3300005547 Bacteria 1661
62 Ga0070665_100001755 3300005548 Bacteria 24800
63 Ga0070665_100033360 3300005548 Bacteria 5181
64 Ga0070665_100146194 3300005548 Bacteria 2366
65 Ga0070665_100246600 3300005548 Bacteria 1786
66 Ga0070704_100114283 3300005549 Bacteria 2060
67 Ga0068855_100396103 3300005563 Bacteria 1514
68 Ga0068855_100419593 3300005563 Bacteria 1464
69 Ga0070664_100007331 3300005564 Bacteria 8891
70 Ga0070664_100173429 3300005564 Bacteria 1914
71 Ga0070664_100353930 3300005564 Bacteria 1336
72 Ga0068857_100071270 3300005577 Bacteria 3096
73 Ga0068857_100557273 3300005577 Bacteria 1080
74 Ga0068854_100221419 3300005578 Bacteria 1497
75 Ga0068856_100235474 3300005614 Bacteria 1846
76 Ga0070702_100000101 3300005615 Bacteria 25654
77 Ga0068852_100177735 3300005616 Bacteria 1999
78 Ga0068852_100269949 3300005616 Bacteria 1637
79 Ga0068859_100085931 3300005617 Bacteria 3191
80 Ga0068859_100263071 3300005617 Bacteria 1816
81 Ga0068870_10000468 3300005840 Bacteria 15376
82 Ga0068863_100003518 3300005841 Bacteria 15461
83 Ga0068863_100040670 3300005841 Bacteria 4420
84 Ga0068858_100031540 3300005842 Bacteria 4923
85 Ga0068860_100092481 3300005843 Bacteria 2882
86 Ga0068862_100183138 3300005844 Bacteria 1881
87 Ga0068862_100189956 3300005844 Bacteria 1848
88 Ga0081455_10000390 3300005937 Bacteria 58031
89 Ga0081540_1001207 3300005983 Bacteria 22645
90 Ga0081539_10001374 3300005985 Bacteria 42092
91 Ga0081539_10001984 3300005985 Bacteria 31132
92 Ga0081539_10004130 3300005985 Bacteria 16525
93 Ga0081539_10006135 3300005985 Bacteria 11702
94 Ga0081539_10087624 3300005985 Bacteria 1617
95 Ga0081539_10091252 3300005985 Bacteria 1574
96 Ga0070717_10075337 3300006028 Bacteria 2822
97 Ga0070717_10115236 3300006028 Bacteria 2297
98 Ga0075428_100001415 3300006844 Bacteria 25567
99 Ga0075430_100098416 3300006846 Bacteria 2444
100 Ga0075431_100071351 3300006847 Bacteria 3584
101 Ga0075431_100072315 3300006847 Bacteria 3559
102 Ga0075431_100234218 3300006847 Bacteria 1870
103 Ga0075431_100239094 3300006847 Bacteria 1848
104 Ga0075433_10013689 3300006852 Bacteria 6605
105 Ga0075429_100158513 3300006880 Bacteria 1982
106 Ga0075436_100006757 3300006914 Bacteria 7851
107 Ga0097620_100085929 3300006931 Bacteria 3191
108 Ga0097620_100263079 3300006931 Bacteria 1816
109 Ga0075435_100004642 3300007076 Bacteria 9467
110 Ga0105240_10517541 3300009093 Bacteria 1325
111 Ga0111539_10000821 3300009094 Bacteria 40288
112 Ga0111539_10101766 3300009094 Bacteria 3373
113 Ga0105245_10002360 3300009098 Bacteria 17063
114 Ga0105245_10061354 3300009098 Bacteria 3389
115 Ga0105245_10103088 3300009098 Bacteria 2643
116 Ga0105245_10144668 3300009098 Bacteria 2242
117 Ga0105247_10033611 3300009101 Bacteria 3120
118 Ga0105243_10202366 3300009148 Bacteria 1742
119 Ga0105241_10104598 3300009174 Bacteria 2256
120 Ga0105248_10006134 3300009177 Bacteria 13184
121 Ga0105248_10112432 3300009177 Bacteria 3071
122 Ga0105248_10183779 3300009177 Bacteria 2356
123 Ga0105248_10263770 3300009177 Bacteria 1939
124 Ga0105238_10140420 3300009551 Bacteria 2393
125 Ga0105249_10045153 3300009553 Bacteria 4006
126 Ga0105249_10072031 3300009553 Bacteria 3194
127 Ga0105239_10142502 3300010375 Bacteria 2672
128 Ga0105239_10263841 3300010375 Bacteria 1936
129 Ga0157371_10045115 3300013102 Bacteria 3138
130 Ga0157369_10254526 3300013105 Bacteria 1832
131 Ga0157374_10486692 3300013296 Bacteria 1237
132 Ga0157372_10150883 3300013307 Bacteria 2682
133 Ga0157372_10239414 3300013307 Bacteria 2105
134 Ga0157375_10109511 3300013308 Bacteria 2858
135 Ga0163163_10004164 3300014325 Bacteria 12326
136 Ga0163163_10076891 3300014325 Bacteria 3334
137 Ga0163163_10140606 3300014325 Bacteria 2456
138 Ga0163163_10191294 3300014325 Bacteria 2095
139 Ga0163163_10335159 3300014325 Bacteria 1568
140 Ga0163163_10436087 3300014325 Bacteria 1369
141 Ga0157380_10333135 3300014326 Bacteria 1412
142 Ga0157377_10001890 3300014745 Bacteria 9177
143 Ga0157379_10001706 3300014968 Bacteria 18176
144 Ga0157379_10050216 3300014968 Bacteria 3723
145 Ga0157379_10061340 3300014968 Bacteria 3362
146 Ga0206356_10937565 3300020070 Bacteria 2560
147 Ga0206354_10325508 3300020081 Bacteria 3109
148 Ga0206353_10919798 3300020082 Bacteria 4559
149 Ga0207710_10119125 3300025900 Bacteria 1259
150 Ga0207688_10011801 3300025901 Bacteria 4753
151 Ga0207688_10026567 3300025901 Bacteria 3184
152 Ga0207688_10031875 3300025901 Bacteria 2911
153 Ga0207680_10273616 3300025903 Bacteria 1172
154 Ga0207645_10051177 3300025907 Bacteria 2639
155 Ga0207643_10000088 3300025908 Bacteria 61029
156 Ga0207643_10004441 3300025908 Bacteria 7543
157 Ga0207705_10047683 3300025909 Bacteria 3081
158 Ga0207654_10098244 3300025911 Bacteria 1799
159 Ga0207707_10012441 3300025912 Bacteria 7399
160 Ga0207693_10227880 3300025915 Bacteria 1463
161 Ga0207662_10084527 3300025918 Bacteria 1942
162 Ga0207657_10160126 3300025919 Bacteria 1829
163 Ga0207657_10221977 3300025919 Bacteria 1514
164 Ga0207649_10006184 3300025920 Bacteria 6498
165 Ga0207649_10132079 3300025920 Bacteria 1697
166 Ga0207652_10039847 3300025921 Bacteria 3988
167 Ga0207652_10104839 3300025921 Bacteria 2501
168 Ga0207652_10158175 3300025921 Bacteria 2030
169 Ga0207681_10089383 3300025923 Bacteria 2196
170 Ga0207694_10057033 3300025924 Bacteria 3035
171 Ga0207650_10000708 3300025925 Bacteria 26071
172 Ga0207659_10008124 3300025926 Bacteria 6494
173 Ga0207659_10017378 3300025926 Bacteria 4699
174 Ga0207687_10090527 3300025927 Bacteria 2230
175 Ga0207700_10397493 3300025928 Bacteria 1207
176 Ga0207664_10016389 3300025929 Bacteria 5406
177 Ga0207644_10018093 3300025931 Bacteria 4764
178 Ga0207690_10091349 3300025932 Bacteria 2152
179 Ga0207706_10033126 3300025933 Bacteria 4600
180 Ga0207706_10038653 3300025933 Bacteria 4233
181 Ga0207669_10290957 3300025937 Bacteria 1237
182 Ga0207665_10137253 3300025939 Bacteria 1741
183 Ga0207665_10172507 3300025939 Bacteria 1563
184 Ga0207691_10127875 3300025940 Bacteria 2247
185 Ga0207691_10127973 3300025940 Bacteria 2246
186 Ga0207691_10486109 3300025940 Bacteria 1049
187 Ga0207711_10221676 3300025941 Bacteria 1730
188 Ga0207689_10006723 3300025942 Bacteria 10140
189 Ga0207689_10014864 3300025942 Bacteria 6606
190 Ga0207689_10040289 3300025942 Bacteria 3867
191 Ga0207661_10001406 3300025944 Bacteria 16205
192 Ga0207661_10007035 3300025944 Bacteria 7983
193 Ga0207661_10043485 3300025944 Bacteria 3545
194 Ga0207661_10263335 3300025944 Bacteria 1536
195 Ga0207661_10278009 3300025944 Bacteria 1496
196 Ga0207679_10016606 3300025945 Bacteria 4892
197 Ga0207679_10120198 3300025945 Bacteria 2090
198 Ga0207679_10229915 3300025945 Bacteria 1565
199 Ga0207667_10196169 3300025949 Bacteria 2071
200 Ga0207651_10092581 3300025960 Bacteria 2217
201 Ga0207668_10003078 3300025972 Bacteria 9779
202 Ga0207668_10021611 3300025972 Bacteria 4107
203 Ga0207668_10180009 3300025972 Bacteria 1666
204 Ga0207668_10370019 3300025972 Bacteria 1203
205 Ga0207640_10157030 3300025981 Bacteria 1678
206 Ga0207658_10307012 3300025986 Bacteria 1369
207 Ga0207658_10409597 3300025986 Bacteria 1193
208 Ga0207677_10001042 3300026023 Bacteria 15242
209 Ga0207703_10041831 3300026035 Bacteria 3674
210 Ga0207703_10128790 3300026035 Bacteria 2183
211 Ga0207703_10362754 3300026035 Bacteria 1336
212 Ga0207678_10000838 3300026067 Bacteria 28212
213 Ga0207678_10003608 3300026067 Bacteria 13908
214 Ga0207708_10007584 3300026075 Bacteria 8028
215 Ga0207708_10009409 3300026075 Bacteria 7235
216 Ga0207708_10010818 3300026075 Bacteria 6785
217 Ga0207708_10266281 3300026075 Bacteria 1384
218 Ga0207708_10292435 3300026075 Bacteria 1323
219 Ga0207702_10000327 3300026078 Bacteria 54556
220 Ga0207641_10002078 3300026088 Bacteria 18981
221 Ga0207641_10027300 3300026088 Bacteria 4714
222 Ga0207641_10129075 3300026088 Bacteria 2267
223 Ga0207676_10015441 3300026095 Bacteria 5508
224 Ga0207676_10173788 3300026095 Bacteria 1879
225 Ga0207676_10468767 3300026095 Bacteria 1190
226 Ga0207674_10252919 3300026116 Bacteria 1709
227 Ga0207675_100098278 3300026118 Bacteria 2757
228 Ga0207675_100136288 3300026118 Bacteria 2329
229 Ga0207683_10001750 3300026121 Bacteria 19214
230 Ga0207683_10105458 3300026121 Bacteria 2519
231 Ga0207683_10170004 3300026121 Bacteria 1974
232 Ga0207698_10065090 3300026142 Bacteria 2861
233 Ga0207698_10089776 3300026142 Bacteria 2511
234 Ga0207428_10080668 3300027907 Bacteria 2542
235 Ga0268266_10005330 3300028379 Bacteria 12042
236 Ga0268266_10015010 3300028379 Bacteria 6650
237 Ga0268266_10131981 3300028379 Bacteria 2235
238 Ga0268265_10013814 3300028380 Bacteria 5496
239 Ga0268265_10151188 3300028380 Bacteria 1958
240 Ga0268264_10057192 3300028381 Bacteria 3262
241 Ga0307517_10025830 3300028786 Bacteria 7155
242 Ga0307515_10000454 3300028794 Bacteria 97728
243 Ga0307515_10004739 3300028794 Bacteria 27867
244 Ga0307515_10007075 3300028794 Bacteria 22286
245 Ga0307512_10012496 3300030522 Bacteria 8015
246 Ga0307512_10089426 3300030522 Bacteria 2154
247 Ga0307513_10002908 3300031456 Bacteria 23416
248 Ga0307513_10022685 3300031456 Bacteria 7366
249 Ga0307509_10004955 3300031507 Bacteria 18846
250 Ga0307509_10137222 3300031507 Bacteria 2389
251 Ga0307508_10005441 3300031616 Bacteria 12103
252 Ga0307516_10000528 3300031730 Bacteria 51172
253 Ga0307516_10081237 3300031730 Bacteria 3084
254 Ga0307516_10278203 3300031730 Bacteria 1356
255 Ga0307405_10022075 3300031731 Bacteria 3592
256 Ga0307413_10248561 3300031824 Bacteria 1318
257 Ga0307413_10266356 3300031824 Bacteria 1280
258 Ga0307518_10000400 3300031838 Bacteria 33364
259 Ga0307410_10099246 3300031852 Bacteria 2084
260 Ga0326468_10000565 3300031889 Bacteria 3857
261 Ga0307406_10040447 3300031901 Bacteria 2899
262 Ga0307406_10247693 3300031901 Bacteria 1340
263 Ga0307407_10114960 3300031903 Bacteria 1696
264 Ga0307416_100553586 3300032002 Bacteria 1224
265 Ga0307415_100029157 3300032126 Bacteria 3523
266 Ga0307415_100507933 3300032126 Bacteria 1055
267 Ga0307507_10086597 3300033179 Bacteria 2715
268 Ga0373932_0027246 3300035112 Bacteria 1562
269 Ga0373956_0000218 3300035119 Bacteria 22632
270 Ga0373942_0001030 3300035207 Bacteria 7573
271 Ga0373962_0002273 3300035242 Bacteria 4588
272 Ga0373935_0007029 3300035692 Bacteria 6719
273 Ga0395900_0108010 3300037418 Bacteria 2859
274 Ga0395901_0021866 3300038443 Bacteria 6555
275 Ga0439448_0074162 3300042005 Bacteria 1136
276 Ga0439463_008195 3300042016 Bacteria 2575
277 Ga0439459_0001016 3300042438 Bacteria 3994
278 Ga0466972_0004087 3300044658 Bacteria 7285
279 Ga0466965_0003756 3300044683 Bacteria 6702
280 Ga0466963_0077862 3300044694 Bacteria 2241
281 Ga0466964_0013804 3300044706 Bacteria 3067
282 Ga0466970_0013774 3300044765 Bacteria 4148
283 Ga0466957_0150986 3300044842 Bacteria 1502
284 Ga0466960_0000147 3300044901 Bacteria 24150
285 Ga0466967_0043390 3300045976 Bacteria 3893
286 Ga0466967_0203341 3300045976 Bacteria 1876
287 Ga0495629_0173681 3300046459 Bacteria 1495
288 Ga0495582_0064968 3300046473 Bacteria 2016
289 Ga0495594_0007980 3300046499 Bacteria 5443
290 Ga0495594_0023619 3300046499 Bacteria 3296
291 Ga0495594_0134653 3300046499 Bacteria 1400
292 Ga0495606_0000395 3300046507 Bacteria 73500
293 Ga0495632_0050637 3300046519 Bacteria 2047
294 Ga0495668_0000199 3300046616 Bacteria 88656
295 Ga0495625_0000403 3300046660 Bacteria 66113
296 Ga0495683_0079767 3300047323 Bacteria 1598
297 Ga0495626_0000059 3300048091 Bacteria 146814
298 Ga0496100_0020654 3300048903 Bacteria 3952
299 Ga0496101_0013623 3300048904 Bacteria 5453
300 Ga0496102_0000080 3300048905 Bacteria 140541
301 Ga0496102_0046355 3300048905 Bacteria 3948
302 Ga0496103_0000214 3300048906 Bacteria 57509
303 Ga0496104_0001631 3300048907 Bacteria 19370
304 Ga0496104_0263753 3300048907 Bacteria 1635
305 Ga0496104_0347125 3300048907 Bacteria 1397
306 Ga0496105_0010491 3300048908 Bacteria 7286
307 Ga0496105_0014169 3300048908 Bacteria 6345
308 Ga0496106_0008393 3300048909 Bacteria 7644
309 Ga0496106_0336939 3300048909 Bacteria 1211
310 Ga0496107_0223686 3300048910 Bacteria 1400
311 Ga0496108_0000247 3300048911 Bacteria 48233
312 Ga0496108_0017503 3300048911 Bacteria 5863
313 Ga0496108_0063790 3300048911 Bacteria 3103
314 Ga0496109_0035977 3300048912 Bacteria 4469
315 Ga0496109_0261434 3300048912 Bacteria 1630
316 Ga0496109_0268448 3300048912 Bacteria 1607
317 Ga0496109_0300527 3300048912 Bacteria 1513
318 Ga0496110_0066457 3300048913 Bacteria 3189
319 Ga0496110_0175208 3300048913 Bacteria 1946
320 Ga0496111_0134643 3300048914 Bacteria 1830
321 Ga0496112_0029744 3300048915 Bacteria 5284
322 Ga0496112_0073845 3300048915 Bacteria 3371
323 Ga0496112_0104699 3300048915 Bacteria 2800
324 Ga0496113_0008255 3300048916 Bacteria 6770
325 Ga0496113_0097818 3300048916 Bacteria 2271
326 Ga0496116_0000241 3300048919 Bacteria 100186
327 Ga0496117_0000287 3300048920 Bacteria 91621
328 Ga0496118_0000266 3300048921 Bacteria 91632
329 Ga0496119_0001079 3300048922 Bacteria 34469
330 Ga0496121_0007887 3300048924 Bacteria 12739
331 Ga0496124_0013626 3300048927 Bacteria 7926
332 Ga0496126_0000383 3300048929 Bacteria 91602
333 Ga0501031_0070142 3300049568 Bacteria 2283
334 Ga0501032_0142662 3300049569 Bacteria 1577
335 Ga0501034_0338185 3300049571 Bacteria 1436
336 Ga0501037_0229359 3300049573 Bacteria 1304
337 Ga0501038_0109580 3300049574 Bacteria 2288
338 Ga0501039_0096339 3300049575 Bacteria 2307
339 Ga0501042_0365120 3300049578 Bacteria 1045
340 Ga0501047_0011862 3300049581 Bacteria 8242
341 Ga0501047_0194497 3300049581 Bacteria 1891
342 Ga0501069_0002803 3300049585 Bacteria 8917
343 Ga0501071_0250021 3300049587 Bacteria 1338
344 Ga0501072_0168455 3300049588 Bacteria 1748
345 Ga0501074_0079563 3300049590 Bacteria 2352
346 Ga0501080_0010770 3300049742 Bacteria 8367
347 Ga0501035_0110117 3300049822 Bacteria 2414
348 Ga0501044_0035164 3300049823 Bacteria 5248
349 Ga0501044_0124675 3300049823 Bacteria 2574
350 Ga0501045_0363747 3300049824 Bacteria 1077
351 nmdc:mga0yw44_55061_c1 3300050492 Bacteria 2419
352 nmdc:mga05p37_745352_c1 3300050507 Bacteria 1080
353 nmdc:mga09592_112432_c1 3300050508 Bacteria 2336
354 nmdc:mga0qj67_54545_c1 3300050509 Bacteria 3165
355 nmdc:mga06r32_141363_c1 3300050510 Bacteria 1634
356 nmdc:mga06r32_20746_c1 3300050510 Bacteria 6052
357 nmdc:mga06r32_43865_c1 3300050510 Bacteria 4256
358 nmdc:mga08y16_15731_c1 3300050511 Bacteria 7958
359 nmdc:mga08y16_376532_c1 3300050511 Bacteria 1455
360 nmdc:mga0a205_73196_c1 3300050515 Bacteria 3311
361 Ga0500583_0008685 3300053092 Bacteria 3664
362 Ga0500583_0068041 3300053092 Bacteria 1698
363 Ga0500660_043885 3300053100 Bacteria 2258
364 Ga0500588_0002970 3300053146 Bacteria 3529
365 Ga0530510_0350881 3300061734 Bacteria 1108
366 2516084264 2515154202 Bacteria 5471270
367 2558910328 2558860112 Bacteria 9931328
368 2644640001 2643221715 Bacteria 6671032
369 2676482930 2675903059 Bacteria 8644972
370 2753269670 2751185782 Bacteria 11227053
371 2799183348 2799112218 Bacteria 4315149
372 2816506413 2816332139 Bacteria 9138787
373 2870787785 2870782633 Bacteria 9624083
374 2887484514 2887478801 Bacteria 8972725
375 8001789593 8001781756 Bacteria 9586736
376 8054476104 8054472261 Bacteria 7464355
377 nmdc:mga08y16_382018_c1
378 JGI25406J46586_10040977
379 rootH2_10037934
380 Ga0070676_10280918
381 Ga0070683_100000258
382 Ga0070683_100010211
383 Ga0070690_100090888
384 Ga0070670_100022346
385 Ga0070670_100022371
386 Ga0070670_100443245
387 Ga0068869_100006573
388 Ga0068869_100056725
389 Ga0070666_10297282
390 Ga0070680_100084793
391 Ga0070680_100293713
392 Ga0070680_100493528
393 Ga0070682_100005944
394 Ga0070682_100054335
395 Ga0068868_100002700
396 Ga0068868_100004298
397 Ga0070660_100199997
398 Ga0070660_100332410
399 Ga0070691_10049930
400 Ga0070661_100023981
401 Ga0070661_100051184
402 Ga0070661_100225862
403 Ga0070692_10024666
404 Ga0070668_100000635
405 Ga0070669_100155196
406 Ga0070675_100003688
407 Ga0070675_100006713
408 Ga0070671_100011595
409 Ga0070673_100028740
410 Ga0070667_100042428
411 Ga0070667_100067010
412 Ga0070667_100077989
413 Ga0070667_100271009
414 Ga0070713_100119691
415 Ga0070713_100131846
416 Ga0070700_100003603
417 Ga0070700_100010691
418 Ga0070663_100000918
419 Ga0070663_100007384
420 Ga0070678_100083009
421 Ga0070678_100088268
422 Ga0070678_100133933
423 Ga0070662_100023367
424 Ga0070662_100173384
425 Ga0070681_10341548
426 Ga0070681_10458186
427 Ga0070685_10148014
428 Ga0070699_100308171
429 Ga0070679_100010142
430 Ga0070684_100070947
431 Ga0070684_100123276
432 Ga0070684_100165313
433 Ga0068853_100465834
434 Ga0070672_100257752
435 Ga0070686_100134432
436 Ga0070693_100001753
437 Ga0070693_100115020
438 Ga0070665_100001755
439 Ga0070665_100033360
440 Ga0070665_100146194
441 Ga0070665_100246600
442 Ga0070704_100114283
443 Ga0068855_100396103
444 Ga0068855_100419593
445 Ga0070664_100007331
446 Ga0070664_100173429
447 Ga0070664_100353930
448 Ga0068857_100071270
449 Ga0068857_100557273
450 Ga0068854_100221419
451 Ga0068856_100235474
452 Ga0070702_100000101
453 Ga0068852_100177735
454 Ga0068852_100269949
455 Ga0068859_100085931
456 Ga0068859_100263071
457 Ga0068870_10000468
458 Ga0068863_100003518
459 Ga0068863_100040670
460 Ga0068858_100031540
461 Ga0068860_100092481
462 Ga0068862_100183138
463 Ga0068862_100189956
464 Ga0081455_10000390
465 Ga0081540_1001207
466 Ga0081539_10001374
467 Ga0081539_10001984
468 Ga0081539_10004130
469 Ga0081539_10006135
470 Ga0081539_10087624
471 Ga0081539_10091252
472 Ga0070717_10075337
473 Ga0070717_10115236
474 Ga0075428_100001415
475 Ga0075430_100098416
476 Ga0075431_100071351
477 Ga0075431_100072315
478 Ga0075431_100234218
479 Ga0075431_100239094
480 Ga0075433_10013689
481 Ga0075429_100158513
482 Ga0075436_100006757
483 Ga0097620_100085929
484 Ga0097620_100263079
485 Ga0075435_100004642
486 Ga0105240_10517541
487 Ga0111539_10000821
488 Ga0111539_10101766
489 Ga0105245_10002360
490 Ga0105245_10061354
491 Ga0105245_10103088
492 Ga0105245_10144668
493 Ga0105247_10033611
494 Ga0105243_10202366
495 Ga0105241_10104598
496 Ga0105248_10006134
497 Ga0105248_10112432
498 Ga0105248_10183779
499 Ga0105248_10263770
500 Ga0105238_10140420
501 Ga0105249_10045153
502 Ga0105249_10072031
503 Ga0105239_10142502
504 Ga0105239_10263841
505 Ga0157371_10045115
506 Ga0157369_10254526
507 Ga0157374_10486692
508 Ga0157372_10150883
509 Ga0157372_10239414
510 Ga0157375_10109511
511 Ga0163163_10004164
512 Ga0163163_10076891
513 Ga0163163_10140606
514 Ga0163163_10191294
515 Ga0163163_10335159
516 Ga0163163_10436087
517 Ga0157380_10333135
518 Ga0157377_10001890
519 Ga0157379_10001706
520 Ga0157379_10050216
521 Ga0157379_10061340
522 Ga0206356_10937565
523 Ga0206354_10325508
524 Ga0206353_10919798
525 Ga0207710_10119125
526 Ga0207688_10011801
527 Ga0207688_10026567
528 Ga0207688_10031875
529 Ga0207680_10273616
530 Ga0207645_10051177
531 Ga0207643_10000088
532 Ga0207643_10004441
533 Ga0207705_10047683
534 Ga0207654_10098244
535 Ga0207707_10012441
536 Ga0207693_10227880
537 Ga0207662_10084527
538 Ga0207657_10160126
539 Ga0207657_10221977
540 Ga0207649_10006184
541 Ga0207649_10132079
542 Ga0207652_10039847
543 Ga0207652_10104839
544 Ga0207652_10158175
545 Ga0207681_10089383
546 Ga0207694_10057033
547 Ga0207650_10000708
548 Ga0207659_10008124
549 Ga0207659_10017378
550 Ga0207687_10090527
551 Ga0207700_10397493
552 Ga0207664_10016389
553 Ga0207644_10018093
554 Ga0207690_10091349
555 Ga0207706_10033126
556 Ga0207706_10038653
557 Ga0207669_10290957
558 Ga0207665_10137253
559 Ga0207665_10172507
560 Ga0207691_10127875
561 Ga0207691_10127973
562 Ga0207691_10486109
563 Ga0207711_10221676
564 Ga0207689_10006723
565 Ga0207689_10014864
566 Ga0207689_10040289
567 Ga0207661_10001406
568 Ga0207661_10007035
569 Ga0207661_10043485
570 Ga0207661_10263335
571 Ga0207661_10278009
572 Ga0207679_10016606
573 Ga0207679_10120198
574 Ga0207679_10229915
575 Ga0207667_10196169
576 Ga0207651_10092581
577 Ga0207668_10003078
578 Ga0207668_10021611
579 Ga0207668_10180009
580 Ga0207668_10370019
581 Ga0207640_10157030
582 Ga0207658_10307012
583 Ga0207658_10409597
584 Ga0207677_10001042
585 Ga0207703_10041831
586 Ga0207703_10128790
587 Ga0207703_10362754
588 Ga0207678_10000838
589 Ga0207678_10003608
590 Ga0207708_10007584
591 Ga0207708_10009409
592 Ga0207708_10010818
593 Ga0207708_10266281
594 Ga0207708_10292435
595 Ga0207702_10000327
596 Ga0207641_10002078
597 Ga0207641_10027300
598 Ga0207641_10129075
599 Ga0207676_10015441
600 Ga0207676_10173788
601 Ga0207676_10468767
602 Ga0207674_10252919
603 Ga0207675_100098278
604 Ga0207675_100136288
605 Ga0207683_10001750
606 Ga0207683_10105458
607 Ga0207683_10170004
608 Ga0207698_10065090
609 Ga0207698_10089776
610 Ga0207428_10080668
611 Ga0268266_10005330
612 Ga0268266_10015010
613 Ga0268266_10131981
614 Ga0268265_10013814
615 Ga0268265_10151188
616 Ga0268264_10057192
617 Ga0307517_10025830
618 Ga0307515_10000454
619 Ga0307515_10004739
620 Ga0307515_10007075
621 Ga0307512_10012496
622 Ga0307512_10089426
623 Ga0307513_10002908
624 Ga0307513_10022685
625 Ga0307509_10004955
626 Ga0307509_10137222
627 Ga0307508_10005441
628 Ga0307516_10000528
629 Ga0307516_10081237
630 Ga0307516_10278203
631 Ga0307405_10022075
632 Ga0307413_10248561
633 Ga0307413_10266356
634 Ga0307518_10000400
635 Ga0307410_10099246
636 Ga0326468_10000565
637 Ga0307406_10040447
638 Ga0307406_10247693
639 Ga0307407_10114960
640 Ga0307416_100553586
641 Ga0307415_100029157
642 Ga0307415_100507933
643 Ga0307507_10086597
644 Ga0373932_0027246
645 Ga0373956_0000218
646 Ga0373942_0001030
647 Ga0373962_0002273
648 Ga0373935_0007029
649 Ga0395900_0108010
650 Ga0395901_0021866
651 Ga0439448_0074162
652 Ga0439463_008195
653 Ga0439459_0001016
654 Ga0466972_0004087
655 Ga0466965_0003756
656 Ga0466963_0077862
657 Ga0466964_0013804
658 Ga0466970_0013774
659 Ga0466957_0150986
660 Ga0466960_0000147
661 Ga0466967_0043390
662 Ga0466967_0203341
663 Ga0495629_0173681
664 Ga0495582_0064968
665 Ga0495594_0007980
666 Ga0495594_0023619
667 Ga0495594_0134653
668 Ga0495606_0000395
669 Ga0495632_0050637
670 Ga0495668_0000199
671 Ga0495625_0000403
672 Ga0495683_0079767
673 Ga0495626_0000059
674 Ga0496100_0020654
675 Ga0496101_0013623
676 Ga0496102_0000080
677 Ga0496102_0046355
678 Ga0496103_0000214
679 Ga0496104_0001631
680 Ga0496104_0263753
681 Ga0496104_0347125
682 Ga0496105_0010491
683 Ga0496105_0014169
684 Ga0496106_0008393
685 Ga0496106_0336939
686 Ga0496107_0223686
687 Ga0496108_0000247
688 Ga0496108_0017503
689 Ga0496108_0063790
690 Ga0496109_0035977
691 Ga0496109_0261434
692 Ga0496109_0268448
693 Ga0496109_0300527
694 Ga0496110_0066457
695 Ga0496110_0175208
696 Ga0496111_0134643
697 Ga0496112_0029744
698 Ga0496112_0073845
699 Ga0496112_0104699
700 Ga0496113_0008255
701 Ga0496113_0097818
702 Ga0496116_0000241
703 Ga0496117_0000287
704 Ga0496118_0000266
705 Ga0496119_0001079
706 Ga0496121_0007887
707 Ga0496124_0013626
708 Ga0496126_0000383
709 Ga0501031_0070142
710 Ga0501032_0142662
711 Ga0501034_0338185
712 Ga0501037_0229359
713 Ga0501038_0109580
714 Ga0501039_0096339
715 Ga0501042_0365120
716 Ga0501047_0011862
717 Ga0501047_0194497
718 Ga0501069_0002803
719 Ga0501071_0250021
720 Ga0501072_0168455
721 Ga0501074_0079563
722 Ga0501080_0010770
723 Ga0501035_0110117
724 Ga0501044_0035164
725 Ga0501044_0124675
726 Ga0501045_0363747
727 nmdc:mga0yw44_55061_c1
728 nmdc:mga05p37_745352_c1
729 nmdc:mga09592_112432_c1
730 nmdc:mga0qj67_54545_c1
731 nmdc:mga06r32_141363_c1
732 nmdc:mga06r32_20746_c1
733 nmdc:mga06r32_43865_c1
734 nmdc:mga08y16_15731_c1
735 nmdc:mga08y16_376532_c1
736 nmdc:mga0a205_73196_c1
737 Ga0500583_0008685
738 Ga0500583_0068041
739 Ga0500660_043885
740 Ga0500588_0002970
741 Ga0530510_0350881
742 2516084264
743 2558910328
744 2644640001
745 2676482930
746 2753269670
747 2799183348
748 2816506413
749 2870787785
750 2887484514
751 8001789593
752 8054476104

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00800

PDT

Prephenate dehydratase

39

219

0.97

PF01842

ACT

ACT domain

229

296

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mwb-assembly1.cif.gz_B the crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a 0.9266 9 309
3mwb-assembly1.cif.gz_A the crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a 0.9218 9 309
3mwb-assembly1.cif.gz_B the crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a 0.9089 9 309
3mwb-assembly1.cif.gz_A the crystal structure of prephenate dehydratase in complex with l-phe from arthrobacter aurescens to 2.0a 0.9045 9 309
2qmw-assembly1.cif.gz_A-2 the crystal structure of the prephenate dehydratase (pdt) from staphylococcus aureus subsp. aureus mu50 0.8857 8 277
ID Description Score Start End Superfamily
af_P9WIC3_99_178_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.974 100 175 3.40.190.10
af_P9WIC3_193_284_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9672 190 278 3.30.70.260
af_P0A9J8_291_383_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9383 196 285 3.30.70.260
3mwbB03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9294 189 279 3.30.70.260
af_P9WIC3_193_284_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9167 190 278 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A1E7HCY5-F1-model_v4 Bifunctional chorismate mutase/prephenate dehydratase (EC 4.2.1.51) (Chorismate mutase-prephenate dehydratase) (p-protein) 0.9686 6 281 GO:0004106
GO:0004664
GO:0005737
GO:0009094
GO:0046417
AF-A0A7W7CZG4-F1-model_v4 Prephenate dehydratase (PDT) (EC 4.2.1.51) 0.9679 1 315 GO:0004106
GO:0004664
GO:0005737
GO:0009094
AF-A0A7K0TC31-F1-model_v4 Prephenate dehydratase (EC 4.2.1.51) 0.9673 127 284 GO:0004664
GO:0005737
GO:0009094
AF-A0A660WML9-F1-model_v4 Bifunctional chorismate mutase/prephenate dehydratase (EC 4.2.1.51) (Chorismate mutase-prephenate dehydratase) (p-protein) 0.9672 9 279 GO:0004106
GO:0004664
GO:0005737
GO:0009094
GO:0046417
AF-A0A5C7MCL0-F1-model_v4 prephenate dehydratase (EC 4.2.1.51) 0.9671 7 178 GO:0004664
GO:0005737
GO:0009094

Map