F427162

General Info

Members Datasets Scaffolds Average Seq Length
375 264 371 177

Family's Representative Sequence

Representative Sequence 3300047323|Ga0495683_0006087|Ga0495683_0006087_2187_2810
Length 207
Sequence MMVTDAAGGGKSIDSLAPAYRIEARGWNMSNPYLAEIRIFGFNFAPKGWATCSGQIMSIQQNTALFSILGTTYGGNGQTTFGLPDLRGRTPIHWGNGAGLPAVSQGQLGGEENHLLLQTEMPTHNHTFAATTAAATKIPVNLGVFADDVDAQTVDFFATFNAPNSSYVNLNPLSMPPAGGSQPHNNMQPYLVLNICICLSGIFPSRN

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
4 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
5 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
6 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
145 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
146 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
147 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
150 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
151 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
152 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
156 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
157 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
158 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
182 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
204 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
205 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
206 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
207 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
208 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
209 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
210 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
211 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
212 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
219 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
220 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
221 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
222 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
223 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
224 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
225 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
226 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
227 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
228 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
229 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
230 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.53
Metatranscriptomes 10.4
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.8
Nodule 0
Rhizoplane 3.73
Rhizosphere 77.33
Stem 0
Stem Tuber 0
Unclassified 10.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_3957518 2162886012 Bacteria 1338
2 JGI24741J21665_1001183 3300001915 Bacteria 7715
3 JGI24741J21665_1001681 3300001915 Bacteria 6135
4 JGI24741J21665_1003212 3300001915 Bacteria 3976
5 JGI24740J21852_10002196 3300001979 Bacteria 8925
6 JGI24740J21852_10002768 3300001979 Bacteria 7844
7 JGI24740J21852_10023932 3300001979 Unclassified 2077
8 JGI24739J22299_10003891 3300001989 Bacteria 5707
9 JGI24737J22298_10000539 3300001990 Bacteria 13288
10 JGI24735J21928_10043241 3300002067 Bacteria 1310
11 JGI24742J22300_10000498 3300002244 Bacteria 5842
12 JGI25153J46596_10000008 3300003215 Bacteria 376808
13 rootL2_10102000 3300003322 Bacteria 2695
14 rootL2_10360991 3300003322 Bacteria 2939
15 Ga0055525_1000248 3300003759 Bacteria 54342
16 Ga0055542_1000040 3300003762 Bacteria 214035
17 Ga0055529_1000037 3300003763 Bacteria 237307
18 Ga0065717_1005196 3300005276 Bacteria 920
19 Ga0070658_10001120 3300005327 Bacteria 22867
20 Ga0070658_10413179 3300005327 Unclassified 1160
21 Ga0070683_100286958 3300005329 Bacteria 1565
22 Ga0070690_100712113 3300005330 Bacteria 772
23 Ga0070670_100731922 3300005331 Bacteria 891
24 Ga0070677_10205969 3300005333 Bacteria 952
25 Ga0068869_101322892 3300005334 Bacteria 636
26 Ga0070680_100000388 3300005336 Bacteria 29909
27 Ga0070660_100002905 3300005339 Bacteria 11793
28 Ga0070660_100106661 3300005339 Bacteria 2225
29 Ga0070661_100000114 3300005344 Bacteria 67216
30 Ga0070661_100005775 3300005344 Bacteria 8513
31 Ga0070669_100048979 3300005353 Bacteria 3085
32 Ga0070675_100205325 3300005354 Bacteria 1711
33 Ga0070675_100242010 3300005354 Bacteria 1577
34 Ga0070674_100000638 3300005356 Bacteria 17627
35 Ga0070674_100001362 3300005356 Bacteria 12897
36 Ga0070674_100205806 3300005356 Bacteria 1522
37 Ga0070673_100039256 3300005364 Bacteria 3621
38 Ga0070659_100038515 3300005366 Bacteria 3729
39 Ga0070659_100113844 3300005366 Bacteria 2185
40 Ga0070667_100651584 3300005367 Bacteria 972
41 Ga0070700_100095232 3300005441 Bacteria 1951
42 Ga0070663_100004336 3300005455 Bacteria 8319
43 Ga0070663_100008187 3300005455 Bacteria 6416
44 Ga0070663_100030426 3300005455 Unclassified 3700
45 Ga0070663_100119919 3300005455 Bacteria 1986
46 Ga0070678_100000022 3300005456 Bacteria 49544
47 Ga0070662_100111368 3300005457 Bacteria 2085
48 Ga0070681_10359715 3300005458 Bacteria 1366
49 Ga0068867_100009659 3300005459 Bacteria 6801
50 Ga0070679_100000002 3300005530 Bacteria 312066
51 Ga0070679_100027584 3300005530 Bacteria 5590
52 Ga0068853_100301341 3300005539 Bacteria 1481
53 Ga0070672_100394584 3300005543 Bacteria 1185
54 Ga0070665_100000023 3300005548 Bacteria 375278
55 Ga0070665_100000145 3300005548 Bacteria 131599
56 Ga0068855_100047788 3300005563 Bacteria 5054
57 Ga0068855_100951868 3300005563 Bacteria 904
58 Ga0070664_100282251 3300005564 Bacteria 1498
59 Ga0068857_100090784 3300005577 Bacteria 2734
60 Ga0068857_100195017 3300005577 Bacteria 1845
61 Ga0068857_100509177 3300005577 Bacteria 1130
62 Ga0068854_100016822 3300005578 Bacteria 4882
63 Ga0068854_100051601 3300005578 Bacteria 2947
64 Ga0068856_100020848 3300005614 Bacteria 6370
65 Ga0068856_100086425 3300005614 Bacteria 3116
66 Ga0068856_100131805 3300005614 Bacteria 2504
67 Ga0068852_100012906 3300005616 Bacteria 6370
68 Ga0068852_100376681 3300005616 Bacteria 1391
69 Ga0068851_10024564 3300005834 Bacteria 2951
70 Ga0068862_100614211 3300005844 Bacteria 1045
71 Ga0075362_10162078 3300006177 Bacteria 1077
72 Ga0075366_10421991 3300006195 Bacteria 822
73 Ga0097621_100011103 3300006237 Bacteria 6625
74 Ga0097621_100576692 3300006237 Bacteria 1026
75 Ga0068871_101006336 3300006358 Bacteria 776
76 Ga0075429_100319340 3300006880 Unclassified 1359
77 Ga0099795_10257646 3300007788 Bacteria 754
78 Ga0105240_10037525 3300009093 Bacteria 6227
79 Ga0105240_10038611 3300009093 Bacteria 6123
80 Ga0105240_10064866 3300009093 Bacteria 4536
81 Ga0105240_10064885 3300009093 Bacteria 4535
82 Ga0111539_11085966 3300009094 Bacteria 930
83 Ga0111539_11191304 3300009094 Viruses 885
84 Ga0105243_10000223 3300009148 Bacteria 65335
85 Ga0105241_10009157 3300009174 Bacteria 7286
86 Ga0105237_10023632 3300009545 Bacteria 6295
87 Ga0105237_10049037 3300009545 Bacteria 4245
88 Ga0105238_10023027 3300009551 Bacteria 6351
89 Ga0105238_10029341 3300009551 Bacteria 5603
90 Ga0105238_10068416 3300009551 Bacteria 3552
91 Ga0105238_10089526 3300009551 Bacteria 3064
92 Ga0105238_10392648 3300009551 Bacteria 1380
93 Ga0105239_10187114 3300010375 Bacteria 2317
94 Ga0105246_10035703 3300011119 Bacteria 3325
95 Ga0157327_1008920 3300012512 Bacteria 911
96 Ga0157373_10011206 3300013100 Bacteria 6597
97 Ga0157373_10030117 3300013100 Bacteria 3906
98 Ga0157371_10000029 3300013102 Bacteria 252131
99 Ga0157371_10011942 3300013102 Bacteria 6660
100 Ga0157370_10005177 3300013104 Bacteria 14708
101 Ga0157370_10020683 3300013104 Bacteria 6567
102 Ga0157370_10071185 3300013104 Bacteria 3281
103 Ga0157370_10074466 3300013104 Bacteria 3203
104 Ga0157369_10002673 3300013105 Bacteria 21259
105 Ga0157369_10005527 3300013105 Bacteria 14673
106 Ga0157369_10022148 3300013105 Bacteria 7098
107 Ga0157369_10077977 3300013105 Bacteria 3550
108 Ga0157369_10322353 3300013105 Bacteria 1606
109 Ga0157374_10230198 3300013296 Bacteria 1820
110 Ga0157372_10013045 3300013307 Bacteria 8864
111 Ga0157372_10034676 3300013307 Bacteria 5550
112 Ga0157375_10029707 3300013308 Bacteria 5144
113 Ga0157380_10020043 3300014326 Bacteria 4993
114 Ga0157376_10227672 3300014969 Bacteria 1730
115 Ga0213872_10267537 3300021361 Bacteria 716
116 Ga0213876_10013145 3300021384 Bacteria 4399
117 Ga0209674_105768 3300025226 Bacteria 1777
118 Ga0209563_100066 3300025230 Bacteria 257382
119 Ga0209646_1008630 3300025246 Bacteria 1635
120 Ga0209026_1010889 3300025250 Bacteria 1669
121 Ga0209148_1000011 3300025254 Bacteria 1196503
122 Ga0209233_1013115 3300025261 Unclassified 2376
123 Ga0209233_1053883 3300025261 Unclassified 805
124 Ga0209455_1000006 3300025272 Bacteria 1196503
125 Ga0209455_1002479 3300025272 Bacteria 7095
126 Ga0209758_1000017 3300025297 Bacteria 754393
127 Ga0207426_1026038 3300025302 Bacteria 1964
128 Ga0209257_1033040 3300025304 Bacteria 1632
129 Ga0207656_10002432 3300025321 Bacteria 6269
130 Ga0207682_10216985 3300025893 Bacteria 884
131 Ga0207688_10386653 3300025901 Bacteria 866
132 Ga0207647_10074850 3300025904 Bacteria 2039
133 Ga0207645_10336712 3300025907 Bacteria 1008
134 Ga0207705_10001878 3300025909 Bacteria 16486
135 Ga0207705_10241734 3300025909 Unclassified 1375
136 Ga0207654_10001403 3300025911 Bacteria 12764
137 Ga0207695_10007731 3300025913 Bacteria 13618
138 Ga0207695_10029115 3300025913 Bacteria 6110
139 Ga0207695_10048228 3300025913 Bacteria 4500
140 Ga0207671_10002019 3300025914 Bacteria 22325
141 Ga0207671_10014725 3300025914 Bacteria 6166
142 Ga0207660_10000892 3300025917 Bacteria 19647
143 Ga0207657_10016857 3300025919 Bacteria 7031
144 Ga0207657_10025733 3300025919 Bacteria 5420
145 Ga0207657_10129064 3300025919 Bacteria 2074
146 Ga0207649_10000011 3300025920 Bacteria 266219
147 Ga0207649_10001078 3300025920 Bacteria 16645
148 Ga0207652_10000001 3300025921 Bacteria 1006643
149 Ga0207652_10000002 3300025921 Bacteria 878035
150 Ga0207652_10002385 3300025921 Bacteria 15871
151 Ga0207681_10063371 3300025923 Bacteria 2549
152 Ga0207694_10012771 3300025924 Bacteria 6327
153 Ga0207694_10017477 3300025924 Bacteria 5420
154 Ga0207694_10040707 3300025924 Bacteria 3579
155 Ga0207694_10055762 3300025924 Bacteria 3068
156 Ga0207694_10329122 3300025924 Bacteria 1262
157 Ga0207650_10284550 3300025925 Bacteria 1347
158 Ga0207659_10169741 3300025926 Bacteria 1720
159 Ga0207644_10237834 3300025931 Bacteria 1449
160 Ga0207690_10011749 3300025932 Bacteria 5237
161 Ga0207690_10486643 3300025932 Bacteria 996
162 Ga0207706_10140962 3300025933 Bacteria 2121
163 Ga0207709_10000078 3300025935 Bacteria 169141
164 Ga0207669_10000105 3300025937 Bacteria 42248
165 Ga0207669_10000393 3300025937 Bacteria 19327
166 Ga0207669_10116893 3300025937 Bacteria 1801
167 Ga0207691_10203444 3300025940 Bacteria 1722
168 Ga0207689_10864080 3300025942 Bacteria 763
169 Ga0207661_10387052 3300025944 Bacteria 1266
170 Ga0207679_10174938 3300025945 Bacteria 1771
171 Ga0207667_10000002 3300025949 Bacteria 895662
172 Ga0207667_10001502 3300025949 Bacteria 29255
173 Ga0207667_10049536 3300025949 Bacteria 4436
174 Ga0207668_10430565 3300025972 Bacteria 1122
175 Ga0207668_11222845 3300025972 Bacteria 675
176 Ga0207640_10021141 3300025981 Bacteria 3873
177 Ga0207640_10021649 3300025981 Bacteria 3835
178 Ga0207658_10094677 3300025986 Bacteria 2325
179 Ga0207639_10003251 3300026041 Bacteria 10937
180 Ga0207639_10067337 3300026041 Bacteria 2786
181 Ga0207678_10001190 3300026067 Bacteria 23844
182 Ga0207678_10016572 3300026067 Bacteria 6471
183 Ga0207678_10046380 3300026067 Bacteria 3758
184 Ga0207678_11075727 3300026067 Bacteria 712
185 Ga0207708_10112050 3300026075 Bacteria 2119
186 Ga0207702_10008661 3300026078 Bacteria 8583
187 Ga0207702_10030045 3300026078 Bacteria 4527
188 Ga0207702_10372929 3300026078 Bacteria 1371
189 Ga0207648_10053689 3300026089 Bacteria 3522
190 Ga0207674_10075613 3300026116 Bacteria 3377
191 Ga0207674_10204965 3300026116 Bacteria 1922
192 Ga0207674_10226195 3300026116 Bacteria 1819
193 Ga0207683_10000156 3300026121 Bacteria 57349
194 Ga0207683_11260115 3300026121 Bacteria 685
195 Ga0207698_10001017 3300026142 Bacteria 16352
196 Ga0207698_10001125 3300026142 Bacteria 15579
197 Ga0268266_10000002 3300028379 Bacteria 3059047
198 Ga0268266_10000173 3300028379 Bacteria 117695
199 Ga0307517_10013588 3300028786 Bacteria 11034
200 Ga0307515_10000001 3300028794 Bacteria 4259510
201 Ga0265338_10387668 3300028800 Bacteria 998
202 Ga0265320_10087691 3300031240 Unclassified 1445
203 Ga0265325_10081388 3300031241 Bacteria 1609
204 Ga0307508_10000310 3300031616 Bacteria 59124
205 Ga0307516_10208117 3300031730 Bacteria 1672
206 Ga0307405_10457454 3300031731 Bacteria 1013
207 Ga0307413_10044507 3300031824 Unclassified 2624
208 Ga0307410_10049783 3300031852 Unclassified 2814
209 Ga0307412_10052891 3300031911 Bacteria 2691
210 Ga0307409_100747018 3300031995 Bacteria 982
211 Ga0307416_100424019 3300032002 Bacteria 1375
212 Ga0307416_101730601 3300032002 Unclassified 730
213 Ga0307415_100302031 3300032126 Bacteria 1326
214 Ga0307510_10105037 3300033180 Bacteria 2595
215 Ga0316215_1001571 3300033544 Bacteria 2184
216 Ga0436365_0002673 3300039437 Bacteria 3955
217 Ga0436361_0149960 3300039447 Bacteria 914
218 Ga0451791_0458389 3300041451 Bacteria 2274
219 Ga0451797_0104964 3300041453 Bacteria 1671
220 Ga0451795_1550246 3300041456 Bacteria 1315
221 Ga0451802_1952673 3300041460 Bacteria 1390
222 Ga0451807_1421482 3300041486 Bacteria 2762
223 Ga0451833_1198506 3300041491 Bacteria 884
224 Ga0451835_0617857 3300041492 Bacteria 644
225 Ga0451837_0495251 3300041494 Bacteria 5524
226 Ga0451843_1178751 3300041509 Bacteria 1013
227 Ga0451843_1247635 3300041509 Bacteria 1218
228 Ga0439448_0022006 3300042005 Bacteria 1978
229 Ga0439455_0079980 3300042012 Bacteria 887
230 Ga0439463_125616 3300042016 Bacteria 663
231 Ga0439459_0022508 3300042438 Bacteria 1220
232 Ga0450916_035343 3300042530 Bacteria 742
233 Ga0439440_0085375 3300042993 Bacteria 840
234 Ga0466967_0154377 3300045976 Bacteria 2149
235 Ga0495650_0000116 3300046471 Bacteria 189814
236 Ga0495585_0004302 3300046492 Bacteria 9272
237 Ga0495585_0078500 3300046492 Bacteria 1791
238 Ga0495585_0234019 3300046492 Bacteria 922
239 Ga0495583_0003091 3300046506 Bacteria 13172
240 Ga0495583_0013117 3300046506 Bacteria 4643
241 Ga0495606_0000365 3300046507 Bacteria 77476
242 Ga0495606_0071391 3300046507 Bacteria 2186
243 Ga0495606_0075178 3300046507 Bacteria 2114
244 Ga0495610_0140718 3300046512 Bacteria 1039
245 Ga0495631_0006658 3300046518 Bacteria 5940
246 Ga0495643_0002379 3300046522 Bacteria 15027
247 Ga0495643_0003091 3300046522 Bacteria 12473
248 Ga0495643_0030745 3300046522 Bacteria 2995
249 Ga0495643_0057982 3300046522 Bacteria 2062
250 Ga0495648_0000501 3300046524 Bacteria 42180
251 Ga0495648_0092966 3300046524 Bacteria 1683
252 Ga0495648_0286147 3300046524 Bacteria 779
253 Ga0495663_0005755 3300046525 Bacteria 3431
254 Ga0495622_0028184 3300046557 Bacteria 2622
255 Ga0495622_0114023 3300046557 Bacteria 1236
256 Ga0495633_0000776 3300046558 Bacteria 28552
257 Ga0495633_0022567 3300046558 Bacteria 3130
258 Ga0495668_0000056 3300046616 Bacteria 197862
259 Ga0495668_0107978 3300046616 Bacteria 1522
260 Ga0495611_0080352 3300046648 Bacteria 1498
261 Ga0495625_0014456 3300046660 Bacteria 6298
262 Ga0495625_0017249 3300046660 Bacteria 5653
263 Ga0495661_0090955 3300046665 Bacteria 1736
264 Ga0495669_0000011 3300046684 Bacteria 158720
265 Ga0495670_0005553 3300046691 Bacteria 6188
266 Ga0495670_0198556 3300046691 Bacteria 1062
267 Ga0495671_0106778 3300046692 Bacteria 1367
268 Ga0495600_0001508 3300046809 Bacteria 12912
269 Ga0495683_0005583 3300047323 Bacteria 6974
270 Ga0495683_0006087 3300047323 Bacteria 6618
271 Ga0495683_0076304 3300047323 Unclassified 1640
272 Ga0495687_000077 3300047443 Bacteria 148889
273 Ga0495687_000082 3300047443 Bacteria 147137
274 Ga0495677_0032027 3300047445 Bacteria 1914
275 Ga0495677_0075263 3300047445 Bacteria 1261
276 Ga0495681_0006477 3300047470 Bacteria 7690
277 Ga0496100_0394565 3300048903 Bacteria 1053
278 Ga0496101_0144833 3300048904 Bacteria 1814
279 Ga0496102_0000316 3300048905 Bacteria 60628
280 Ga0496103_0000622 3300048906 Bacteria 27228
281 Ga0496104_0117823 3300048907 Bacteria 2549
282 Ga0496105_0000299 3300048908 Bacteria 32663
283 Ga0496113_0032517 3300048916 Bacteria 3792
284 Ga0496114_0008747 3300048917 Bacteria 8021
285 Ga0496115_0000030 3300048918 Bacteria 138328
286 Ga0496116_0000030 3300048919 Bacteria 420761
287 Ga0496116_0001039 3300048919 Bacteria 33915
288 Ga0496117_0000142 3300048920 Bacteria 157953
289 Ga0496117_0036721 3300048920 Bacteria 3662
290 Ga0496118_0000115 3300048921 Bacteria 146533
291 Ga0496118_0041654 3300048921 Bacteria 3632
292 Ga0496119_0001943 3300048922 Bacteria 23549
293 Ga0496120_0011694 3300048923 Bacteria 6021
294 Ga0496121_0000193 3300048924 Bacteria 136526
295 Ga0496121_0050328 3300048924 Bacteria 3521
296 Ga0496122_0008895 3300048925 Bacteria 10702
297 Ga0496123_0041176 3300048926 Bacteria 3206
298 Ga0496124_0000146 3300048927 Bacteria 146468
299 Ga0496124_0008742 3300048927 Bacteria 10520
300 Ga0496125_0000035 3300048928 Bacteria 339737
301 Ga0496125_0000463 3300048928 Bacteria 72745
302 Ga0496126_0000174 3300048929 Bacteria 146468
303 Ga0496126_0009169 3300048929 Bacteria 10555
304 Ga0501206_018828 3300049653 Bacteria 975
305 Ga0501207_075678 3300049654 Bacteria 640
306 Ga0501209_219134 3300049656 Bacteria 589
307 Ga0501217_049013 3300049661 Bacteria 1099
308 Ga0501223_030518 3300049663 Bacteria 1049
309 Ga0501233_017416 3300049668 Bacteria 1500
310 Ga0501235_021021 3300049669 Bacteria 1450
311 Ga0501221_074517 3300049704 Bacteria 807
312 Ga0501241_001112 3300049758 Bacteria 5648
313 Ga0501241_012383 3300049758 Bacteria 1550
314 Ga0501204_024772 3300049850 Bacteria 804
315 nmdc:mga03n38_122553_c1 3300050490 Bacteria 1279
316 nmdc:mga0k408_204387_c1 3300050493 Bacteria 1179
317 nmdc:mga0k408_344308_c1 3300050493 Bacteria 889
318 nmdc:mga07m45_303074_c1 3300050496 Bacteria 929
319 nmdc:mga09592_397592_c1 3300050508 Unclassified 1191
320 nmdc:mga0sz30_9213_c1 3300050516 Bacteria 3748
321 Ga0500610_0000028 3300053079 Bacteria 52793
322 Ga0500566_0001786 3300053094 Bacteria 12625
323 Ga0500641_0003158 3300053096 Bacteria 5839
324 Ga0500595_003745 3300053119 Bacteria 7007
325 Ga0500607_054595 3300053121 Bacteria 2115
326 Ga0500642_0004433 3300053130 Bacteria 4394
327 Ga0500652_041246 3300053131 Bacteria 1858
328 Ga0500658_0049858 3300053134 Bacteria 1707
329 Ga0500619_022148 3300053154 Bacteria 1841
330 Ga0500636_0000549 3300053177 Bacteria 20436
331 Ga0500645_000001 3300053730 Bacteria 455558
332 Ga0500596_000233 3300053735 Bacteria 9521
333 Ga0587084_001159 3300059477 Bacteria 2422
334 Ga0587093_007972 3300059478 Viruses 1194
335 Ga0587066_001141 3300059490 Bacteria 2568
336 Ga0587070_002749 3300059491 Bacteria 2036
337 Ga0587077_001755 3300059493 Bacteria 2411
338 Ga0587080_001505 3300059503 Bacteria 2546
339 Ga0587082_003336 3300059504 Bacteria 1920
340 Ga0587083_0002357 3300059505 Bacteria 2338
341 Ga0587085_001960 3300059506 Bacteria 2027
342 Ga0587085_036041 3300059506 Bacteria 839
343 Ga0587086_001639 3300059507 Bacteria 1975
344 Ga0587088_001415 3300059508 Bacteria 2486
345 Ga0587089_000998 3300059509 Bacteria 2475
346 Ga0587091_002696 3300059511 Bacteria 2141
347 Ga0587092_002511 3300059512 Bacteria 1972
348 Ga0587094_000850 3300059513 Bacteria 2639
349 Ga0587106_010590 3300059605 Viruses 1198
350 Ga0587101_001625 3300059623 Bacteria 1981
351 Ga0587109_036751 3300059624 Unclassified 955
352 Ga0587115_001776 3300059626 Bacteria 2048
353 Ga0587128_002090 3300059630 Bacteria 2026
354 Ga0587128_056565 3300059630 Bacteria 730
355 Ga0587130_029134 3300059631 Unclassified 630
356 Ga0587062_014015 3300059639 Viruses 1052
357 Ga0587067_086636 3300059640 Unclassified 703
358 Ga0587068_002832 3300059641 Bacteria 2152
359 Ga0587069_001337 3300059642 Bacteria 2231
360 Ga0587076_117145 3300059645 Unclassified 613
361 Ga0587078_001119 3300059646 Bacteria 2297
362 Ga0587079_003874 3300059647 Bacteria 1991
363 Ga0587079_119713 3300059647 Bacteria 650
364 Ga0587100_000576 3300059648 Bacteria 1820
365 Ga0587102_000562 3300059649 Bacteria 2192
366 Ga0587105_001707 3300059651 Viruses 1177
367 Ga0587107_013250 3300059652 Viruses 1042
368 Ga0587119_007581 3300059658 Viruses 1174
369 Ga0587071_004529 3300060344 Bacteria 2078
370 Ga0587111_0004809 3300060346 Bacteria 2042
371 Ga0587111_0120634 3300060346 Unclassified 675

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049654 Ga0501207_075678 Ga0501207_075678_17_448 139
2 3300049656 Ga0501209_219134 Ga0501209_219134_24_455 139
3 3300049850 Ga0501204_024772 Ga0501204_024772_49_480 139
4 3300013102 Ga0157371_10011942 Ga0157371_100119423 147
5 3300013104 Ga0157370_10005177 Ga0157370_1000517711 147
6 3300013105 Ga0157369_10002673 Ga0157369_100026732 147
7 3300048919 Ga0496116_0000030 Ga0496116_0000030_113823_114362 147
8 3300048920 Ga0496117_0036721 Ga0496117_0036721_1340_1879 147
9 3300048921 Ga0496118_0041654 Ga0496118_0041654_1306_1845 147
10 3300048924 Ga0496121_0050328 Ga0496121_0050328_1841_2380 147
11 3300048927 Ga0496124_0008742 Ga0496124_0008742_2833_3372 147
12 3300048928 Ga0496125_0000035 Ga0496125_0000035_308219_308758 147
13 3300041509 Ga0451843_1178751 Ga0451843_1178751_14_481 151
14 3300006237 Ga0097621_100576692 Ga0097621_1005766922 153
15 3300013308 Ga0157375_10029707 Ga0157375_100297075 157
16 3300041456 Ga0451795_1550246 Ga0451795_1550246_593_1132 159
17 3300046524 Ga0495648_0286147 Ga0495648_0286147_258_767 159
18 3300041491 Ga0451833_1198506 Ga0451833_1198506_98_598 161
19 3300050490 nmdc:mga03n38_122553_c1 nmdc:mga03n38_122553_c1_241_741 161
20 3300031241 Ga0265325_10081388 Ga0265325_100813882 162
21 3300031616 Ga0307508_10000310 Ga0307508_1000031034 162
22 3300045976 Ga0466967_0154377 Ga0466967_0154377_1102_1608 162
23 3300047443 Ga0495687_000082 Ga0495687_000082_56293_56832 162
24 3300005327 Ga0070658_10413179 Ga0070658_104131792 163
25 3300025909 Ga0207705_10241734 Ga0207705_102417342 163
26 3300025302 Ga0207426_1026038 Ga0207426_10260383 165
27 3300033544 Ga0316215_1001571 Ga0316215_10015714 165
28 3300047445 Ga0495677_0075263 Ga0495677_0075263_87_626 165
29 iso_pu_bacteria 2513020052 2513234667 165
30 3300005330 Ga0070690_100712113 Ga0070690_1007121131 166
31 3300013105 Ga0157369_10005527 Ga0157369_1000552715 166
32 3300028794 Ga0307515_10000001 Ga0307515_10000001481 166
33 3300031731 Ga0307405_10457454 Ga0307405_104574542 166
34 3300031824 Ga0307413_10044507 Ga0307413_100445074 166
35 3300031852 Ga0307410_10049783 Ga0307410_100497834 166
36 3300031911 Ga0307412_10052891 Ga0307412_100528913 166
37 3300032002 Ga0307416_100424019 Ga0307416_1004240192 166
38 3300032126 Ga0307415_100302031 Ga0307415_1003020312 166
39 3300048929 Ga0496126_0009169 Ga0496126_0009169_8874_9413 166
40 3300049653 Ga0501206_018828 Ga0501206_018828_399_914 166
41 3300049661 Ga0501217_049013 Ga0501217_049013_390_905 166
42 3300049663 Ga0501223_030518 Ga0501223_030518_224_739 166
43 3300049668 Ga0501233_017416 Ga0501233_017416_534_1049 166
44 3300049669 Ga0501235_021021 Ga0501235_021021_387_902 166
45 3300049704 Ga0501221_074517 Ga0501221_074517_148_663 166
46 iso_pu_bacteria 2844315083 2844317899 166
47 iso_pu_bacteria 2903727486 2903729765 166
48 iso_pu_bacteria 2906602504 2906608621 166
49 3300005367 Ga0070667_100651584 Ga0070667_1006515842 167
50 3300007788 Ga0099795_10257646 Ga0099795_102576461 167
51 3300021361 Ga0213872_10267537 Ga0213872_102675371 167
52 3300025304 Ga0209257_1033040 Ga0209257_10330403 167
53 3300028800 Ga0265338_10387668 Ga0265338_103876682 167
54 3300039447 Ga0436361_0149960 Ga0436361_0149960_263_781 167
55 3300053094 Ga0500566_0001786 Ga0500566_0001786_750_1268 167
56 3300053134 Ga0500658_0049858 Ga0500658_0049858_495_1013 167
57 3300005276 Ga0065717_1005196 Ga0065717_10051961 168
58 3300006177 Ga0075362_10162078 Ga0075362_101620782 168
59 3300006880 Ga0075429_100319340 Ga0075429_1003193402 168
60 3300009094 Ga0111539_11191304 Ga0111539_111913041 168
61 3300009551 Ga0105238_10029341 Ga0105238_100293414 168
62 3300012512 Ga0157327_1008920 Ga0157327_10089201 168
63 3300025924 Ga0207694_10017477 Ga0207694_100174776 168
64 3300031240 Ga0265320_10087691 Ga0265320_100876913 168
65 3300041451 Ga0451791_0458389 Ga0451791_0458389_1353_1871 168
66 3300041453 Ga0451797_0104964 Ga0451797_0104964_370_888 168
67 3300041460 Ga0451802_1952673 Ga0451802_1952673_397_915 168
68 3300041486 Ga0451807_1421482 Ga0451807_1421482_1727_2245 168
69 3300041492 Ga0451835_0617857 Ga0451835_0617857_94_612 168
70 3300041494 Ga0451837_0495251 Ga0451837_0495251_3834_4352 168
71 3300041509 Ga0451843_1247635 Ga0451843_1247635_62_580 168
72 3300046507 Ga0495606_0000365 Ga0495606_0000365_8282_8818 168
73 3300046522 Ga0495643_0030745 Ga0495643_0030745_1494_2030 168
74 3300049758 Ga0501241_001112 Ga0501241_001112_2875_3396 168
75 3300049758 Ga0501241_012383 Ga0501241_012383_544_1065 168
76 3300050496 nmdc:mga07m45_303074_c1 nmdc:mga07m45_303074_c1_304_840 168
77 3300050508 nmdc:mga09592_397592_c1 nmdc:mga09592_397592_c1_502_1047 168
78 3300053131 Ga0500652_041246 Ga0500652_041246_100_636 168
79 3300059647 Ga0587079_119713 Ga0587079_119713_33_572 168
80 3300001915 JGI24741J21665_1001183 JGI24741J21665_10011837 169
81 3300001915 JGI24741J21665_1001681 JGI24741J21665_10016816 169
82 3300001915 JGI24741J21665_1003212 JGI24741J21665_10032123 169
83 3300001979 JGI24740J21852_10002196 JGI24740J21852_100021967 169
84 3300001979 JGI24740J21852_10002768 JGI24740J21852_100027687 169
85 3300001979 JGI24740J21852_10023932 JGI24740J21852_100239322 169
86 3300001989 JGI24739J22299_10003891 JGI24739J22299_100038915 169
87 3300001990 JGI24737J22298_10000539 JGI24737J22298_100005395 169
88 3300002067 JGI24735J21928_10043241 JGI24735J21928_100432412 169
89 3300002244 JGI24742J22300_10000498 JGI24742J22300_100004983 169
90 3300003215 JGI25153J46596_10000008 JGI25153J46596_10000008220 169
91 3300003322 rootL2_10102000 rootL2_101020002 169
92 3300003322 rootL2_10360991 rootL2_103609913 169
93 3300003759 Ga0055525_1000248 Ga0055525_100024814 169
94 3300003762 Ga0055542_1000040 Ga0055542_100004046 169
95 3300003763 Ga0055529_1000037 Ga0055529_1000037175 169
96 3300005327 Ga0070658_10001120 Ga0070658_1000112016 169
97 3300005331 Ga0070670_100731922 Ga0070670_1007319221 169
98 3300005333 Ga0070677_10205969 Ga0070677_102059692 169
99 3300005334 Ga0068869_101322892 Ga0068869_1013228921 169
100 3300005339 Ga0070660_100106661 Ga0070660_1001066613 169
101 3300005344 Ga0070661_100005775 Ga0070661_1000057753 169
102 3300005353 Ga0070669_100048979 Ga0070669_1000489793 169
103 3300005354 Ga0070675_100205325 Ga0070675_1002053253 169
104 3300005354 Ga0070675_100242010 Ga0070675_1002420102 169
105 3300005356 Ga0070674_100000638 Ga0070674_10000063812 169
106 3300005356 Ga0070674_100001362 Ga0070674_1000013623 169
107 3300005356 Ga0070674_100205806 Ga0070674_1002058062 169
108 3300005364 Ga0070673_100039256 Ga0070673_1000392563 169
109 3300005366 Ga0070659_100038515 Ga0070659_1000385156 169
110 3300005366 Ga0070659_100113844 Ga0070659_1001138443 169
111 3300005441 Ga0070700_100095232 Ga0070700_1000952322 169
112 3300005455 Ga0070663_100008187 Ga0070663_1000081875 169
113 3300005455 Ga0070663_100030426 Ga0070663_1000304264 169
114 3300005455 Ga0070663_100119919 Ga0070663_1001199193 169
115 3300005456 Ga0070678_100000022 Ga0070678_10000002245 169
116 3300005457 Ga0070662_100111368 Ga0070662_1001113684 169
117 3300005459 Ga0068867_100009659 Ga0068867_1000096592 169
118 3300005539 Ga0068853_100301341 Ga0068853_1003013411 169
119 3300005543 Ga0070672_100394584 Ga0070672_1003945842 169
120 3300005548 Ga0070665_100000023 Ga0070665_100000023188 169
121 3300005563 Ga0068855_100047788 Ga0068855_1000477887 169
122 3300005563 Ga0068855_100951868 Ga0068855_1009518681 169
123 3300005564 Ga0070664_100282251 Ga0070664_1002822512 169
124 3300005577 Ga0068857_100090784 Ga0068857_1000907843 169
125 3300005577 Ga0068857_100195017 Ga0068857_1001950173 169
126 3300005577 Ga0068857_100509177 Ga0068857_1005091772 169
127 3300005578 Ga0068854_100016822 Ga0068854_1000168223 169
128 3300005578 Ga0068854_100051601 Ga0068854_1000516013 169
129 3300005614 Ga0068856_100020848 Ga0068856_1000208487 169
130 3300005614 Ga0068856_100086425 Ga0068856_1000864255 169
131 3300005614 Ga0068856_100131805 Ga0068856_1001318053 169
132 3300005616 Ga0068852_100012906 Ga0068852_1000129067 169
133 3300005616 Ga0068852_100376681 Ga0068852_1003766811 169
134 3300005834 Ga0068851_10024564 Ga0068851_100245643 169
135 3300005844 Ga0068862_100614211 Ga0068862_1006142111 169
136 3300006195 Ga0075366_10421991 Ga0075366_104219911 169
137 3300006237 Ga0097621_100011103 Ga0097621_1000111037 169
138 3300006358 Ga0068871_101006336 Ga0068871_1010063361 169
139 3300009093 Ga0105240_10037525 Ga0105240_100375255 169
140 3300009093 Ga0105240_10038611 Ga0105240_100386115 169
141 3300009093 Ga0105240_10064866 Ga0105240_100648663 169
142 3300009093 Ga0105240_10064885 Ga0105240_100648853 169
143 3300009094 Ga0111539_11085966 Ga0111539_110859662 169
144 3300009148 Ga0105243_10000223 Ga0105243_1000022363 169
145 3300009174 Ga0105241_10009157 Ga0105241_100091577 169
146 3300009545 Ga0105237_10023632 Ga0105237_100236326 169
147 3300009545 Ga0105237_10049037 Ga0105237_100490373 169
148 3300009551 Ga0105238_10023027 Ga0105238_100230275 169
149 3300009551 Ga0105238_10068416 Ga0105238_100684166 169
150 3300009551 Ga0105238_10089526 Ga0105238_100895266 169
151 3300009551 Ga0105238_10392648 Ga0105238_103926483 169
152 3300010375 Ga0105239_10187114 Ga0105239_101871143 169
153 3300011119 Ga0105246_10035703 Ga0105246_100357037 169
154 3300013100 Ga0157373_10011206 Ga0157373_100112065 169
155 3300013100 Ga0157373_10030117 Ga0157373_100301176 169
156 3300013102 Ga0157371_10000029 Ga0157371_10000029230 169
157 3300013104 Ga0157370_10020683 Ga0157370_100206836 169
158 3300013104 Ga0157370_10071185 Ga0157370_100711852 169
159 3300013104 Ga0157370_10074466 Ga0157370_100744666 169
160 3300013105 Ga0157369_10022148 Ga0157369_100221486 169
161 3300013105 Ga0157369_10077977 Ga0157369_100779773 169
162 3300013105 Ga0157369_10322353 Ga0157369_103223533 169
163 3300013296 Ga0157374_10230198 Ga0157374_102301983 169
164 3300013307 Ga0157372_10013045 Ga0157372_100130456 169
165 3300013307 Ga0157372_10034676 Ga0157372_100346766 169
166 3300014326 Ga0157380_10020043 Ga0157380_100200432 169
167 3300014969 Ga0157376_10227672 Ga0157376_102276721 169
168 3300025226 Ga0209674_105768 Ga0209674_1057683 169
169 3300025230 Ga0209563_100066 Ga0209563_10006653 169
170 3300025246 Ga0209646_1008630 Ga0209646_10086303 169
171 3300025250 Ga0209026_1010889 Ga0209026_10108892 169
172 3300025254 Ga0209148_1000011 Ga0209148_1000011943 169
173 3300025261 Ga0209233_1013115 Ga0209233_10131152 169
174 3300025261 Ga0209233_1053883 Ga0209233_10538832 169
175 3300025272 Ga0209455_1000006 Ga0209455_1000006249 169
176 3300025272 Ga0209455_1002479 Ga0209455_10024795 169
177 3300025297 Ga0209758_1000017 Ga0209758_1000017578 169
178 3300025321 Ga0207656_10002432 Ga0207656_100024327 169
179 3300025893 Ga0207682_10216985 Ga0207682_102169851 169
180 3300025901 Ga0207688_10386653 Ga0207688_103866531 169
181 3300025904 Ga0207647_10074850 Ga0207647_100748503 169
182 3300025907 Ga0207645_10336712 Ga0207645_103367122 169
183 3300025909 Ga0207705_10001878 Ga0207705_1000187810 169
184 3300025911 Ga0207654_10001403 Ga0207654_100014039 169
185 3300025913 Ga0207695_10007731 Ga0207695_100077316 169
186 3300025913 Ga0207695_10029115 Ga0207695_100291155 169
187 3300025913 Ga0207695_10048228 Ga0207695_100482286 169
188 3300025914 Ga0207671_10002019 Ga0207671_1000201922 169
189 3300025914 Ga0207671_10014725 Ga0207671_100147255 169
190 3300025919 Ga0207657_10025733 Ga0207657_100257337 169
191 3300025919 Ga0207657_10129064 Ga0207657_101290642 169
192 3300025920 Ga0207649_10001078 Ga0207649_100010789 169
193 3300025923 Ga0207681_10063371 Ga0207681_100633714 169
194 3300025924 Ga0207694_10012771 Ga0207694_100127715 169
195 3300025924 Ga0207694_10040707 Ga0207694_100407073 169
196 3300025924 Ga0207694_10055762 Ga0207694_100557622 169
197 3300025924 Ga0207694_10329122 Ga0207694_103291221 169
198 3300025925 Ga0207650_10284550 Ga0207650_102845503 169
199 3300025926 Ga0207659_10169741 Ga0207659_101697412 169
200 3300025931 Ga0207644_10237834 Ga0207644_102378343 169
201 3300025932 Ga0207690_10011749 Ga0207690_100117497 169
202 3300025932 Ga0207690_10486643 Ga0207690_104866432 169
203 3300025933 Ga0207706_10140962 Ga0207706_101409622 169
204 3300025935 Ga0207709_10000078 Ga0207709_1000007863 169
205 3300025937 Ga0207669_10000105 Ga0207669_1000010532 169
206 3300025937 Ga0207669_10000393 Ga0207669_1000039315 169
207 3300025937 Ga0207669_10116893 Ga0207669_101168932 169
208 3300025940 Ga0207691_10203444 Ga0207691_102034442 169
209 3300025942 Ga0207689_10864080 Ga0207689_108640802 169
210 3300025945 Ga0207679_10174938 Ga0207679_101749383 169
211 3300025949 Ga0207667_10000002 Ga0207667_10000002663 169
212 3300025949 Ga0207667_10001502 Ga0207667_1000150220 169
213 3300025949 Ga0207667_10049536 Ga0207667_100495366 169
214 3300025972 Ga0207668_10430565 Ga0207668_104305651 169
215 3300025972 Ga0207668_11222845 Ga0207668_112228451 169
216 3300025981 Ga0207640_10021141 Ga0207640_100211416 169
217 3300025981 Ga0207640_10021649 Ga0207640_100216496 169
218 3300025986 Ga0207658_10094677 Ga0207658_100946772 169
219 3300026041 Ga0207639_10003251 Ga0207639_100032517 169
220 3300026041 Ga0207639_10067337 Ga0207639_100673373 169
221 3300026067 Ga0207678_10016572 Ga0207678_100165725 169
222 3300026067 Ga0207678_10046380 Ga0207678_100463803 169
223 3300026067 Ga0207678_11075727 Ga0207678_110757272 169
224 3300026075 Ga0207708_10112050 Ga0207708_101120503 169
225 3300026078 Ga0207702_10008661 Ga0207702_100086615 169
226 3300026078 Ga0207702_10030045 Ga0207702_100300456 169
227 3300026078 Ga0207702_10372929 Ga0207702_103729293 169
228 3300026089 Ga0207648_10053689 Ga0207648_100536894 169
229 3300026116 Ga0207674_10075613 Ga0207674_100756133 169
230 3300026116 Ga0207674_10204965 Ga0207674_102049653 169
231 3300026116 Ga0207674_10226195 Ga0207674_102261952 169
232 3300026121 Ga0207683_10000156 Ga0207683_1000015616 169
233 3300026121 Ga0207683_11260115 Ga0207683_112601151 169
234 3300026142 Ga0207698_10001017 Ga0207698_100010173 169
235 3300026142 Ga0207698_10001125 Ga0207698_100011257 169
236 3300028379 Ga0268266_10000002 Ga0268266_100000021290 169
237 3300028786 Ga0307517_10013588 Ga0307517_100135888 169
238 3300031730 Ga0307516_10208117 Ga0307516_102081172 169
239 3300033180 Ga0307510_10105037 Ga0307510_101050373 169
240 3300042005 Ga0439448_0022006 Ga0439448_0022006_615_1139 169
241 3300042012 Ga0439455_0079980 Ga0439455_0079980_204_728 169
242 3300042016 Ga0439463_125616 Ga0439463_125616_26_550 169
243 3300042438 Ga0439459_0022508 Ga0439459_0022508_79_603 169
244 3300042530 Ga0450916_035343 Ga0450916_035343_135_659 169
245 3300042993 Ga0439440_0085375 Ga0439440_0085375_189_713 169
246 3300046471 Ga0495650_0000116 Ga0495650_0000116_8345_8884 169
247 3300046492 Ga0495585_0004302 Ga0495585_0004302_1165_1704 169
248 3300046492 Ga0495585_0078500 Ga0495585_0078500_186_725 169
249 3300046492 Ga0495585_0234019 Ga0495585_0234019_261_800 169
250 3300046506 Ga0495583_0003091 Ga0495583_0003091_4255_4794 169
251 3300046506 Ga0495583_0013117 Ga0495583_0013117_1999_2538 169
252 3300046507 Ga0495606_0071391 Ga0495606_0071391_719_1258 169
253 3300046507 Ga0495606_0075178 Ga0495606_0075178_224_763 169
254 3300046512 Ga0495610_0140718 Ga0495610_0140718_225_764 169
255 3300046518 Ga0495631_0006658 Ga0495631_0006658_2784_3323 169
256 3300046522 Ga0495643_0002379 Ga0495643_0002379_6355_6894 169
257 3300046522 Ga0495643_0003091 Ga0495643_0003091_2879_3418 169
258 3300046522 Ga0495643_0057982 Ga0495643_0057982_1071_1610 169
259 3300046524 Ga0495648_0000501 Ga0495648_0000501_23833_24372 169
260 3300046524 Ga0495648_0092966 Ga0495648_0092966_705_1244 169
261 3300046525 Ga0495663_0005755 Ga0495663_0005755_790_1329 169
262 3300046557 Ga0495622_0028184 Ga0495622_0028184_1559_2098 169
263 3300046557 Ga0495622_0114023 Ga0495622_0114023_213_761 169
264 3300046558 Ga0495633_0000776 Ga0495633_0000776_7741_8280 169
265 3300046558 Ga0495633_0022567 Ga0495633_0022567_2012_2551 169
266 3300046616 Ga0495668_0000056 Ga0495668_0000056_10768_11307 169
267 3300046616 Ga0495668_0107978 Ga0495668_0107978_827_1366 169
268 3300046648 Ga0495611_0080352 Ga0495611_0080352_36_575 169
269 3300046660 Ga0495625_0014456 Ga0495625_0014456_5065_5604 169
270 3300046660 Ga0495625_0017249 Ga0495625_0017249_1910_2449 169
271 3300046665 Ga0495661_0090955 Ga0495661_0090955_570_1109 169
272 3300046684 Ga0495669_0000011 Ga0495669_0000011_57115_57654 169
273 3300046691 Ga0495670_0198556 Ga0495670_0198556_48_587 169
274 3300046692 Ga0495671_0106778 Ga0495671_0106778_140_679 169
275 3300046809 Ga0495600_0001508 Ga0495600_0001508_5724_6263 169
276 3300047323 Ga0495683_0005583 Ga0495683_0005583_3914_4453 169
277 3300047323 Ga0495683_0006087 Ga0495683_0006087_2187_2810 169
278 3300047323 Ga0495683_0076304 Ga0495683_0076304_447_986 169
279 3300047443 Ga0495687_000077 Ga0495687_000077_93654_94193 169
280 3300047445 Ga0495677_0032027 Ga0495677_0032027_782_1321 169
281 3300047470 Ga0495681_0006477 Ga0495681_0006477_3714_4253 169
282 3300048903 Ga0496100_0394565 Ga0496100_0394565_293_832 169
283 3300048904 Ga0496101_0144833 Ga0496101_0144833_329_868 169
284 3300048905 Ga0496102_0000316 Ga0496102_0000316_18062_18601 169
285 3300048906 Ga0496103_0000622 Ga0496103_0000622_22084_22623 169
286 3300048907 Ga0496104_0117823 Ga0496104_0117823_543_1082 169
287 3300048908 Ga0496105_0000299 Ga0496105_0000299_23935_24474 169
288 3300048916 Ga0496113_0032517 Ga0496113_0032517_973_1512 169
289 3300048917 Ga0496114_0008747 Ga0496114_0008747_4361_4900 169
290 3300048918 Ga0496115_0000030 Ga0496115_0000030_20604_21143 169
291 3300048919 Ga0496116_0001039 Ga0496116_0001039_5709_6248 169
292 3300048920 Ga0496117_0000142 Ga0496117_0000142_71677_72216 169
293 3300048921 Ga0496118_0000115 Ga0496118_0000115_72245_72784 169
294 3300048922 Ga0496119_0001943 Ga0496119_0001943_10957_11496 169
295 3300048923 Ga0496120_0011694 Ga0496120_0011694_1250_1789 169
296 3300048924 Ga0496121_0000193 Ga0496121_0000193_72918_73457 169
297 3300048925 Ga0496122_0008895 Ga0496122_0008895_7799_8338 169
298 3300048926 Ga0496123_0041176 Ga0496123_0041176_1480_2019 169
299 3300048927 Ga0496124_0000146 Ga0496124_0000146_73685_74224 169
300 3300048928 Ga0496125_0000463 Ga0496125_0000463_29644_30183 169
301 3300048929 Ga0496126_0000174 Ga0496126_0000174_72245_72784 169
302 3300050493 nmdc:mga0k408_204387_c1 nmdc:mga0k408_204387_c1_618_1157 169
303 3300050493 nmdc:mga0k408_344308_c1 nmdc:mga0k408_344308_c1_256_795 169
304 3300050516 nmdc:mga0sz30_9213_c1 nmdc:mga0sz30_9213_c1_2653_3192 169
305 3300053079 Ga0500610_0000028 Ga0500610_0000028_1853_2392 169
306 3300053119 Ga0500595_003745 Ga0500595_003745_2255_2794 169
307 3300053121 Ga0500607_054595 Ga0500607_054595_435_974 169
308 3300053130 Ga0500642_0004433 Ga0500642_0004433_1480_2019 169
309 3300053154 Ga0500619_022148 Ga0500619_022148_652_1191 169
310 3300053177 Ga0500636_0000549 Ga0500636_0000549_17225_17764 169
311 3300053730 Ga0500645_000001 Ga0500645_000001_164918_165457 169
312 3300053735 Ga0500596_000233 Ga0500596_000233_7803_8342 169
313 3300059477 Ga0587084_001159 Ga0587084_001159_1828_2367 169
314 3300059478 Ga0587093_007972 Ga0587093_007972_63_602 169
315 3300059490 Ga0587066_001141 Ga0587066_001141_1966_2505 169
316 3300059491 Ga0587070_002749 Ga0587070_002749_1443_1982 169
317 3300059493 Ga0587077_001755 Ga0587077_001755_1817_2356 169
318 3300059503 Ga0587080_001505 Ga0587080_001505_1784_2323 169
319 3300059504 Ga0587082_003336 Ga0587082_003336_60_599 169
320 3300059505 Ga0587083_0002357 Ga0587083_0002357_1739_2278 169
321 3300059506 Ga0587085_001960 Ga0587085_001960_63_602 169
322 3300059506 Ga0587085_036041 Ga0587085_036041_43_582 169
323 3300059507 Ga0587086_001639 Ga0587086_001639_1373_1912 169
324 3300059508 Ga0587088_001415 Ga0587088_001415_1884_2423 169
325 3300059509 Ga0587089_000998 Ga0587089_000998_1881_2420 169
326 3300059511 Ga0587091_002696 Ga0587091_002696_64_603 169
327 3300059512 Ga0587092_002511 Ga0587092_002511_1378_1917 169
328 3300059513 Ga0587094_000850 Ga0587094_000850_146_685 169
329 3300059605 Ga0587106_010590 Ga0587106_010590_604_1143 169
330 3300059623 Ga0587101_001625 Ga0587101_001625_64_603 169
331 3300059624 Ga0587109_036751 Ga0587109_036751_60_599 169
332 3300059626 Ga0587115_001776 Ga0587115_001776_1434_1973 169
333 3300059630 Ga0587128_002090 Ga0587128_002090_1429_1968 169
334 3300059630 Ga0587128_056565 Ga0587128_056565_134_673 169
335 3300059631 Ga0587130_029134 Ga0587130_029134_32_571 169
336 3300059639 Ga0587062_014015 Ga0587062_014015_439_978 169
337 3300059640 Ga0587067_086636 Ga0587067_086636_139_678 169
338 3300059641 Ga0587068_002832 Ga0587068_002832_1550_2089 169
339 3300059642 Ga0587069_001337 Ga0587069_001337_209_748 169
340 3300059645 Ga0587076_117145 Ga0587076_117145_12_551 169
341 3300059646 Ga0587078_001119 Ga0587078_001119_1699_2238 169
342 3300059647 Ga0587079_003874 Ga0587079_003874_1392_1931 169
343 3300059648 Ga0587100_000576 Ga0587100_000576_60_599 169
344 3300059649 Ga0587102_000562 Ga0587102_000562_1571_2110 169
345 3300059651 Ga0587105_001707 Ga0587105_001707_584_1123 169
346 3300059652 Ga0587107_013250 Ga0587107_013250_444_983 169
347 3300059658 Ga0587119_007581 Ga0587119_007581_580_1119 169
348 3300060344 Ga0587071_004529 Ga0587071_004529_56_595 169
349 3300060346 Ga0587111_0004809 Ga0587111_0004809_1441_1980 169
350 3300060346 Ga0587111_0120634 Ga0587111_0120634_86_637 169
351 3300005329 Ga0070683_100286958 Ga0070683_1002869582 170
352 3300005336 Ga0070680_100000388 Ga0070680_1000003885 170
353 3300005339 Ga0070660_100002905 Ga0070660_1000029059 170
354 3300005344 Ga0070661_100000114 Ga0070661_10000011453 170
355 3300005455 Ga0070663_100004336 Ga0070663_1000043364 170
356 3300005458 Ga0070681_10359715 Ga0070681_103597153 170
357 3300005530 Ga0070679_100000002 Ga0070679_1000000027 170
358 3300005530 Ga0070679_100027584 Ga0070679_1000275846 170
359 3300005548 Ga0070665_100000145 Ga0070665_100000145145 170
360 3300021384 Ga0213876_10013145 Ga0213876_100131452 170
361 3300025917 Ga0207660_10000892 Ga0207660_1000089219 170
362 3300025919 Ga0207657_10016857 Ga0207657_100168576 170
363 3300025920 Ga0207649_10000011 Ga0207649_100000119 170
364 3300025921 Ga0207652_10000001 Ga0207652_10000001489 170
365 3300025921 Ga0207652_10000002 Ga0207652_10000002239 170
366 3300025921 Ga0207652_10002385 Ga0207652_100023854 170
367 3300025944 Ga0207661_10387052 Ga0207661_103870523 170
368 3300026067 Ga0207678_10001190 Ga0207678_1000119020 170
369 3300028379 Ga0268266_10000173 Ga0268266_100001734 170
370 3300031995 Ga0307409_100747018 Ga0307409_1007470181 170
371 3300032002 Ga0307416_101730601 Ga0307416_1017306012 170
372 3300039437 Ga0436365_0002673 Ga0436365_0002673_1831_2358 170
373 3300046691 Ga0495670_0005553 Ga0495670_0005553_3436_3975 170
374 3300053096 Ga0500641_0003158 Ga0500641_0003158_5161_5685 170
375 2162886012 MBSR1b_contig_3957518 MBSR1b_0095.00005180 173

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

35

91

0.98

Feature Viewer

pLDDT pTM Quality
60.41 0.33 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map