F427082

General Info

Members Datasets Scaffolds Average Seq Length
375 202 750 106

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10257753|Ga0307513_102577532
Length 109
Sequence MALAPTRIAMPAEAKKGDIVEIKALIRHPMETGYRSDARGQSIPRDIITNFVVTYAGEEVFRMELNPGISANPYVIFSTVATESGELVFTWTDQKGAVTVDRKQLTVTA

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
196 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
197 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
198 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.33
Nodule 0
Rhizoplane 0
Rhizosphere 92.8
Stem 0
Stem Tuber 0
Unclassified 6.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10257753 3300031456 Unclassified 1535
2 JGI25406J46586_10007678 3300003203 Bacteria 4905
3 rootH2_10069731 3300003320 Bacteria 1706
4 Ga0065707_10554245 3300005295 Bacteria 719
5 Ga0070660_101061460 3300005339 Bacteria 685
6 Ga0070689_100601884 3300005340 Bacteria 952
7 Ga0070689_102232566 3300005340 Bacteria 502
8 Ga0070669_100004697 3300005353 Bacteria 9855
9 Ga0070669_101476947 3300005353 Bacteria 591
10 Ga0070714_100017333 3300005435 Bacteria 5833
11 Ga0070714_100242795 3300005435 Bacteria 1663
12 Ga0070714_102364290 3300005435 Bacteria 516
13 Ga0070713_100542131 3300005436 Bacteria 1101
14 Ga0070710_10102231 3300005437 Bacteria 1709
15 Ga0070711_101426112 3300005439 Bacteria 603
16 Ga0070705_100085254 3300005440 Bacteria 1952
17 Ga0070694_100714822 3300005444 Bacteria 816
18 Ga0070708_100026042 3300005445 Bacteria 5003
19 Ga0070708_100029298 3300005445 Bacteria 4746
20 Ga0070708_100271342 3300005445 Bacteria 1596
21 Ga0070708_100329898 3300005445 Bacteria 1437
22 Ga0070662_100270302 3300005457 Bacteria 1372
23 Ga0070681_10655189 3300005458 Bacteria 965
24 Ga0070706_100184340 3300005467 Bacteria 1950
25 Ga0070706_101618149 3300005467 Bacteria 591
26 Ga0070707_100020877 3300005468 Bacteria 6182
27 Ga0070707_100022473 3300005468 Bacteria 5963
28 Ga0070707_100106248 3300005468 Bacteria 2723
29 Ga0070707_100180513 3300005468 Bacteria 2058
30 Ga0070707_100238802 3300005468 Bacteria 1769
31 Ga0070707_101571575 3300005468 Bacteria 625
32 Ga0070698_100154178 3300005471 Bacteria 2243
33 Ga0070698_100379326 3300005471 Bacteria 1346
34 Ga0070698_101769065 3300005471 Unclassified 571
35 Ga0070698_101774071 3300005471 Bacteria 570
36 Ga0070699_100017181 3300005518 Bacteria 6212
37 Ga0070699_100043018 3300005518 Bacteria 3910
38 Ga0070699_100632363 3300005518 Bacteria 977
39 Ga0070679_100164151 3300005530 Bacteria 2195
40 Ga0070697_100019427 3300005536 Bacteria 5368
41 Ga0070697_100526125 3300005536 Bacteria 1035
42 Ga0070696_100081366 3300005546 Bacteria 2295
43 Ga0070696_100150322 3300005546 Bacteria 1709
44 Ga0070696_100630346 3300005546 Unclassified 867
45 Ga0070696_100781519 3300005546 Bacteria 785
46 Ga0070704_100014154 3300005549 Bacteria 4976
47 Ga0068857_101033648 3300005577 Bacteria 792
48 Ga0068854_100561669 3300005578 Bacteria 969
49 Ga0070702_100092365 3300005615 Bacteria 1838
50 Ga0068859_100056517 3300005617 Bacteria 3950
51 Ga0068859_100181865 3300005617 Bacteria 2185
52 Ga0068859_102768587 3300005617 Bacteria 538
53 Ga0068861_101432420 3300005719 Bacteria 676
54 Ga0068858_100922207 3300005842 Unclassified 854
55 Ga0068858_101821211 3300005842 Unclassified 601
56 Ga0068860_100025523 3300005843 Bacteria 5701
57 Ga0068860_100068353 3300005843 Bacteria 3375
58 Ga0068862_100036767 3300005844 Bacteria 4150
59 Ga0068862_102782453 3300005844 Bacteria 501
60 Ga0081455_10213336 3300005937 Bacteria 1437
61 Ga0081539_10000180 3300005985 Bacteria 148269
62 Ga0070717_10874781 3300006028 Bacteria 818
63 Ga0075365_10462736 3300006038 Bacteria 896
64 Ga0075368_10016774 3300006042 Bacteria 2732
65 Ga0075363_100016975 3300006048 Bacteria 3604
66 Ga0075364_10102410 3300006051 Bacteria 1906
67 Ga0070715_10024843 3300006163 Bacteria 2366
68 Ga0070716_100093089 3300006173 Bacteria 1829
69 Ga0070712_100442380 3300006175 Bacteria 1081
70 Ga0075367_10019745 3300006178 Bacteria 3741
71 Ga0075367_11108373 3300006178 Bacteria 506
72 Ga0075366_10168743 3300006195 Bacteria 1328
73 Ga0097621_102389408 3300006237 Unclassified 506
74 Ga0075428_100021666 3300006844 Bacteria 7116
75 Ga0075428_100028376 3300006844 Bacteria 6191
76 Ga0075428_100030120 3300006844 Bacteria 6002
77 Ga0075428_102051902 3300006844 Unclassified 592
78 Ga0075428_102657782 3300006844 Bacteria 511
79 Ga0075430_100085632 3300006846 Bacteria 2639
80 Ga0075430_100204283 3300006846 Bacteria 1640
81 Ga0075430_101398372 3300006846 Bacteria 575
82 Ga0075430_101596422 3300006846 Bacteria 536
83 Ga0075430_101658222 3300006846 Unclassified 525
84 Ga0075431_100002664 3300006847 Bacteria 17292
85 Ga0075431_100052377 3300006847 Bacteria 4209
86 Ga0075431_100056458 3300006847 Bacteria 4050
87 Ga0075431_100067638 3300006847 Bacteria 3688
88 Ga0075431_100199071 3300006847 Bacteria 2050
89 Ga0075431_100652344 3300006847 Bacteria 1033
90 Ga0075431_101388989 3300006847 Bacteria 662
91 Ga0075433_10043141 3300006852 Bacteria 3915
92 Ga0075433_10057426 3300006852 Bacteria 3401
93 Ga0075433_10089545 3300006852 Bacteria 2720
94 Ga0075434_100001946 3300006871 Bacteria 17909
95 Ga0075434_100332071 3300006871 Bacteria 1541
96 Ga0075434_101797402 3300006871 Bacteria 620
97 Ga0075434_102044348 3300006871 Bacteria 578
98 Ga0075429_100012545 3300006880 Bacteria 7352
99 Ga0075429_100020900 3300006880 Bacteria 5679
100 Ga0075429_100049105 3300006880 Bacteria 3670
101 Ga0075429_100059712 3300006880 Bacteria 3322
102 Ga0075429_100078900 3300006880 Bacteria 2870
103 Ga0075429_100218469 3300006880 Bacteria 1670
104 Ga0075429_101433231 3300006880 Bacteria 601
105 Ga0068865_100552644 3300006881 Bacteria 967
106 Ga0068865_102088961 3300006881 Bacteria 515
107 Ga0075436_100038336 3300006914 Bacteria 3308
108 Ga0097620_100056516 3300006931 Bacteria 3950
109 Ga0097620_100181863 3300006931 Bacteria 2185
110 Ga0097620_102768651 3300006931 Bacteria 538
111 Ga0075435_100011949 3300007076 Bacteria 6415
112 Ga0075435_100093167 3300007076 Bacteria 2489
113 Ga0075435_100638544 3300007076 Bacteria 924
114 Ga0075435_101463072 3300007076 Unclassified 599
115 Ga0099794_10099409 3300007265 Bacteria 1451
116 Ga0099794_10462153 3300007265 Bacteria 666
117 Ga0111539_10008515 3300009094 Bacteria 13033
118 Ga0105245_10547482 3300009098 Bacteria 1179
119 Ga0105247_11109318 3300009101 Bacteria 625
120 Ga0114129_10000694 3300009147 Bacteria 42478
121 Ga0114129_10002963 3300009147 Bacteria 23761
122 Ga0114129_10007257 3300009147 Bacteria 15778
123 Ga0114129_10021318 3300009147 Bacteria 9199
124 Ga0114129_10106466 3300009147 Bacteria 3874
125 Ga0114129_10302854 3300009147 Bacteria 2130
126 Ga0114129_10309336 3300009147 Bacteria 2104
127 Ga0114129_10423547 3300009147 Bacteria 1750
128 Ga0114129_10477950 3300009147 Bacteria 1631
129 Ga0114129_10993757 3300009147 Bacteria 1057
130 Ga0105243_10094767 3300009148 Bacteria 2466
131 Ga0105241_10198493 3300009174 Bacteria 1674
132 Ga0105241_10304558 3300009174 Bacteria 1369
133 Ga0105242_10053686 3300009176 Bacteria 3292
134 Ga0105242_10938123 3300009176 Bacteria 868
135 Ga0105248_10465097 3300009177 Bacteria 1426
136 Ga0105249_10035557 3300009553 Bacteria 4518
137 Ga0105249_10085104 3300009553 Bacteria 2945
138 Ga0105249_10399531 3300009553 Bacteria 1404
139 Ga0105249_10522316 3300009553 Bacteria 1235
140 Ga0105246_10683991 3300011119 Bacteria 897
141 Ga0157373_11168177 3300013100 Bacteria 579
142 Ga0157378_10056442 3300013297 Bacteria 3499
143 Ga0157378_11305314 3300013297 Bacteria 767
144 Ga0163162_10240754 3300013306 Bacteria 1940
145 Ga0163162_11768211 3300013306 Bacteria 706
146 Ga0157375_10150570 3300013308 Bacteria 2462
147 Ga0157377_10648880 3300014745 Bacteria 759
148 Ga0163161_10917842 3300017792 Bacteria 743
149 Ga0213872_10066851 3300021361 Bacteria 1623
150 Ga0207692_10108271 3300025898 Bacteria 1537
151 Ga0207710_10548648 3300025900 Bacteria 602
152 Ga0207685_10235775 3300025905 Bacteria 878
153 Ga0207684_10003339 3300025910 Bacteria 15735
154 Ga0207684_10292014 3300025910 Bacteria 1406
155 Ga0207684_10452742 3300025910 Bacteria 1102
156 Ga0207654_10105713 3300025911 Bacteria 1742
157 Ga0207654_10413541 3300025911 Bacteria 940
158 Ga0207707_11190895 3300025912 Bacteria 617
159 Ga0207693_10175867 3300025915 Bacteria 1684
160 Ga0207660_11358309 3300025917 Bacteria 576
161 Ga0207657_11028505 3300025919 Bacteria 631
162 Ga0207652_10611628 3300025921 Bacteria 977
163 Ga0207646_10002996 3300025922 Bacteria 19501
164 Ga0207646_10078172 3300025922 Bacteria 2957
165 Ga0207646_10349363 3300025922 Bacteria 1336
166 Ga0207646_10361304 3300025922 Bacteria 1312
167 Ga0207681_10398006 3300025923 Bacteria 1112
168 Ga0207681_11132097 3300025923 Bacteria 657
169 Ga0207700_10586535 3300025928 Bacteria 991
170 Ga0207664_10002586 3300025929 Bacteria 11979
171 Ga0207664_11814974 3300025929 Bacteria 532
172 Ga0207644_10582544 3300025931 Bacteria 928
173 Ga0207706_10115355 3300025933 Bacteria 2362
174 Ga0207686_10165502 3300025934 Bacteria 1554
175 Ga0207709_10060565 3300025935 Bacteria 2361
176 Ga0207670_11102241 3300025936 Bacteria 670
177 Ga0207665_10177523 3300025939 Bacteria 1541
178 Ga0207691_10020088 3300025940 Bacteria 6318
179 Ga0207711_10369363 3300025941 Bacteria 1330
180 Ga0207712_10096162 3300025961 Bacteria 2192
181 Ga0207712_10101521 3300025961 Bacteria 2140
182 Ga0207712_10461970 3300025961 Bacteria 1078
183 Ga0207668_11758804 3300025972 Bacteria 559
184 Ga0207640_10291535 3300025981 Bacteria 1287
185 Ga0207658_11315249 3300025986 Bacteria 661
186 Ga0207703_11036438 3300026035 Bacteria 787
187 Ga0207703_12180504 3300026035 Bacteria 530
188 Ga0207708_10165928 3300026075 Bacteria 1746
189 Ga0207648_11912825 3300026089 Bacteria 555
190 Ga0207676_10596036 3300026095 Bacteria 1061
191 Ga0207674_10859472 3300026116 Unclassified 875
192 Ga0207675_100071143 3300026118 Bacteria 3252
193 Ga0207675_100076212 3300026118 Bacteria 3140
194 Ga0207675_100592802 3300026118 Bacteria 1111
195 Ga0209588_1044912 3300027671 Bacteria 1429
196 Ga0209966_1070549 3300027695 Bacteria 765
197 Ga0209813_10014415 3300027866 Bacteria 2128
198 Ga0207428_10090976 3300027907 Bacteria 2369
199 Ga0268265_10067739 3300028380 Bacteria 2764
200 Ga0268264_10163515 3300028381 Bacteria 2007
201 Ga0268264_10761425 3300028381 Bacteria 965
202 Ga0268264_12660418 3300028381 Bacteria 504
203 Ga0307515_10000096 3300028794 Bacteria 206366
204 Ga0307408_101627612 3300031548 Bacteria 614
205 Ga0307516_10047984 3300031730 Bacteria 4204
206 Ga0307413_10650930 3300031824 Bacteria 869
207 Ga0307409_102017003 3300031995 Unclassified 607
208 Ga0307416_101550008 3300032002 Bacteria 768
209 Ga0307416_102156630 3300032002 Bacteria 659
210 Ga0307414_11448267 3300032004 Bacteria 639
211 Ga0307411_11404553 3300032005 Bacteria 639
212 Ga0307415_100725014 3300032126 Bacteria 900
213 Ga0307415_102395523 3300032126 Bacteria 519
214 Ga0373934_0000117 3300035086 Bacteria 28415
215 Ga0373923_0481083 3300035111 Bacteria 604
216 Ga0373932_0245797 3300035112 Bacteria 651
217 Ga0373954_0190715 3300035118 Bacteria 1006
218 Ga0373956_0001705 3300035119 Bacteria 9058
219 Ga0373957_0000425 3300035120 Bacteria 10670
220 Ga0373955_0027594 3300035172 Bacteria 2937
221 Ga0373933_0000538 3300035724 Bacteria 23511
222 Ga0373937_0006010 3300036401 Bacteria 10448
223 Ga0373925_0867037 3300037068 Bacteria 744
224 Ga0395899_0559586 3300037312 Bacteria 734
225 Ga0395905_0674659 3300037471 Bacteria 936
226 Ga0436364_1247853 3300037853 Bacteria 1734
227 Ga0395901_0088394 3300038443 Bacteria 3241
228 Ga0436365_0663430 3300039437 Bacteria 1873
229 Ga0436361_0272782 3300039447 Bacteria 1627
230 Ga0436361_0427960 3300039447 Bacteria 587
231 Ga0436363_1708901 3300039450 Bacteria 749
232 Ga0439459_0143352 3300042438 Bacteria 619
233 Ga0451577_0269772 3300042876 Bacteria 1541
234 Ga0451577_1749286 3300042876 Unclassified 546
235 Ga0453683_0469886 3300044673 Bacteria 815
236 Ga0466966_0740842 3300044684 Bacteria 592
237 Ga0451576_1306616 3300045051 Unclassified 756
238 Ga0451576_2167913 3300045051 Bacteria 571
239 Ga0495603_0103795 3300046455 Bacteria 1659
240 Ga0495591_179621 3300046458 Bacteria 504
241 Ga0495651_0013266 3300046462 Bacteria 6372
242 Ga0495650_0022546 3300046471 Bacteria 3017
243 Ga0495584_0077866 3300046491 Bacteria 1668
244 Ga0495594_0005474 3300046499 Bacteria 6528
245 Ga0495608_0173023 3300046511 Bacteria 1369
246 Ga0495642_0016357 3300046528 Bacteria 2891
247 Ga0495656_0825011 3300046615 Bacteria 501
248 Ga0495611_0508147 3300046648 Bacteria 547
249 Ga0495659_0167401 3300046664 Bacteria 890
250 Ga0495588_0182111 3300046674 Bacteria 1110
251 Ga0495657_0368379 3300046675 Bacteria 848
252 Ga0495670_0711906 3300046691 Bacteria 548
253 Ga0495680_0098167 3300047322 Bacteria 2186
254 Ga0495677_0188792 3300047445 Bacteria 800
255 Ga0501033_0985542 3300049570 Bacteria 564
256 Ga0501036_0382319 3300049572 Unclassified 1175
257 Ga0501037_0566948 3300049573 Bacteria 765
258 Ga0501038_0218012 3300049574 Bacteria 1524
259 Ga0501039_0107775 3300049575 Bacteria 2177
260 Ga0501039_0930233 3300049575 Bacteria 676
261 Ga0501040_0002193 3300049576 Bacteria 12584
262 Ga0501040_0132961 3300049576 Bacteria 1750
263 Ga0501040_0550412 3300049576 Bacteria 833
264 Ga0501040_0947885 3300049576 Unclassified 624
265 Ga0501040_1212422 3300049576 Bacteria 548
266 Ga0501041_0076362 3300049577 Bacteria 2061
267 Ga0501041_0292699 3300049577 Bacteria 1026
268 Ga0501042_0262530 3300049578 Bacteria 1247
269 Ga0501043_0474122 3300049579 Bacteria 938
270 Ga0501046_0030631 3300049580 Bacteria 4366
271 Ga0501046_0166489 3300049580 Bacteria 1656
272 Ga0501048_0027950 3300049582 Bacteria 4097
273 Ga0501048_0274575 3300049582 Bacteria 1198
274 Ga0501048_1236252 3300049582 Bacteria 537
275 Ga0501068_0770879 3300049584 Bacteria 630
276 Ga0501072_0032344 3300049588 Bacteria 4097
277 Ga0501072_0384037 3300049588 Bacteria 1114
278 Ga0501072_0500607 3300049588 Bacteria 961
279 Ga0501072_0951263 3300049588 Bacteria 670
280 Ga0501075_0069873 3300049591 Bacteria 2654
281 Ga0501075_0144914 3300049591 Bacteria 1810
282 Ga0501075_0152753 3300049591 Bacteria 1760
283 Ga0501075_0236379 3300049591 Bacteria 1393
284 Ga0501075_0264696 3300049591 Bacteria 1310
285 Ga0501075_0366515 3300049591 Bacteria 1098
286 Ga0501075_0607401 3300049591 Bacteria 834
287 Ga0501076_0007558 3300049592 Bacteria 7912
288 Ga0501076_0312146 3300049592 Bacteria 1290
289 Ga0501076_0439829 3300049592 Unclassified 1073
290 Ga0501076_1507558 3300049592 Bacteria 552
291 Ga0501077_0043434 3300049593 Bacteria 2857
292 Ga0501077_0236117 3300049593 Bacteria 1162
293 Ga0501077_0357865 3300049593 Bacteria 932
294 Ga0501079_0202221 3300049741 Bacteria 1552
295 Ga0501079_0211497 3300049741 Bacteria 1515
296 Ga0501079_0782767 3300049741 Bacteria 751
297 Ga0501079_1556154 3300049741 Unclassified 520
298 Ga0501080_0998052 3300049742 Bacteria 726
299 Ga0501080_1368288 3300049742 Bacteria 605
300 Ga0501081_0013648 3300049743 Bacteria 5341
301 Ga0501081_0125662 3300049743 Bacteria 1829
302 Ga0501081_0190826 3300049743 Bacteria 1484
303 Ga0501081_0217442 3300049743 Bacteria 1389
304 Ga0501081_0303617 3300049743 Unclassified 1171
305 Ga0501081_0516525 3300049743 Bacteria 891
306 Ga0501045_0121209 3300049824 Bacteria 1942
307 nmdc:mga03n38_148986_c1 3300050490 Bacteria 1176
308 nmdc:mga00v17_406454_c1 3300050491 Unclassified 885
309 nmdc:mga0yw44_1017736_c1 3300050492 Bacteria 561
310 nmdc:mga0k408_133248_c1 3300050493 Bacteria 1475
311 nmdc:mga06z11_144397_c1 3300050494 Bacteria 1348
312 nmdc:mga04h51_19060_c1 3300050495 Bacteria 2030
313 nmdc:mga07m45_500784_c1 3300050496 Bacteria 703
314 nmdc:mga05p37_132671_c1 3300050507 Bacteria 3056
315 nmdc:mga05p37_21053_c1 3300050507 Bacteria 7893
316 nmdc:mga05p37_266690_c1 3300050507 Bacteria 2047
317 nmdc:mga05p37_490970_c1 3300050507 Bacteria 1412
318 nmdc:mga05p37_49620_c1 3300050507 Bacteria 5163
319 nmdc:mga05p37_517_c1 3300050507 Bacteria 42690
320 nmdc:mga05p37_5801_c1 3300050507 Bacteria 14514
321 nmdc:mga05p37_6051_c1 3300050507 Bacteria 14242
322 nmdc:mga05p37_959264_c1 3300050507 Bacteria 914
323 nmdc:mga09592_10506_c1 3300050508 Bacteria 7532
324 nmdc:mga09592_1051246_c1 3300050508 Unclassified 679
325 nmdc:mga09592_1165649_c1 3300050508 Bacteria 638
326 nmdc:mga09592_17481_c1 3300050508 Bacteria 5875
327 nmdc:mga09592_311862_c1 3300050508 Bacteria 1363
328 nmdc:mga09592_501178_c1 3300050508 Bacteria 1045
329 nmdc:mga09592_57527_c1 3300050508 Bacteria 3287
330 nmdc:mga09592_696745_c1 3300050508 Bacteria 865
331 nmdc:mga0qj67_1095589_c1 3300050509 Bacteria 622
332 nmdc:mga0qj67_1340185_c1 3300050509 Bacteria 554
333 nmdc:mga0qj67_1506571_c1 3300050509 Bacteria 517
334 nmdc:mga0qj67_192710_c1 3300050509 Bacteria 1656
335 nmdc:mga0qj67_481200_c1 3300050509 Bacteria 999
336 nmdc:mga0qj67_552015_c1 3300050509 Bacteria 924
337 nmdc:mga0qj67_874803_c1 3300050509 Bacteria 709
338 nmdc:mga06r32_14717_c1 3300050510 Bacteria 7100
339 nmdc:mga06r32_373855_c1 3300050510 Bacteria 1408
340 nmdc:mga06r32_470028_c1 3300050510 Bacteria 1236
341 nmdc:mga06r32_532614_c1 3300050510 Bacteria 1150
342 nmdc:mga06r32_585471_c1 3300050510 Bacteria 1088
343 nmdc:mga08y16_12280_c1 3300050511 Bacteria 9004
344 nmdc:mga0n895_1040345_c1 3300050512 Bacteria 798
345 nmdc:mga0n895_21177_c1 3300050512 Bacteria 6076
346 nmdc:mga0n895_70002_c1 3300050512 Bacteria 3476
347 nmdc:mga0n895_894927_c1 3300050512 Bacteria 873
348 nmdc:mga0rr50_12121_c1 3300050513 Bacteria 5556
349 nmdc:mga0rr50_286940_c1 3300050513 Bacteria 1374
350 nmdc:mga0rr50_417623_c1 3300050513 Bacteria 1134
351 nmdc:mga0rr50_64489_c1 3300050513 Bacteria 2771
352 nmdc:mga08x19_56673_c1 3300050514 Bacteria 2530
353 nmdc:mga08x19_60073_c1 3300050514 Bacteria 2462
354 nmdc:mga0a205_5452_c1 3300050515 Bacteria 11461
355 nmdc:mga0a205_56669_c1 3300050515 Bacteria 3783
356 Ga0500583_0221781 3300053092 Unclassified 937
357 Ga0500651_0220251 3300053093 Bacteria 1113
358 Ga0500642_0001303 3300053130 Bacteria 7129
359 Ga0500622_0003132 3300053156 Bacteria 11352
360 Ga0500622_0005573 3300053156 Bacteria 7516
361 Ga0501084_0130679 3300054114 Bacteria 2114
362 Ga0501084_0196867 3300054114 Bacteria 1700
363 Ga0501084_1397237 3300054114 Bacteria 586
364 Ga0590075_140641 3300059424 Unclassified 635
365 Ga0501082_0066276 3300060353 Bacteria 3110
366 Ga0501082_0116078 3300060353 Bacteria 2319
367 Ga0501082_0216424 3300060353 Bacteria 1667
368 Ga0501082_1258610 3300060353 Bacteria 646
369 Ga0501082_1394342 3300060353 Unclassified 612
370 Ga0501082_1984176 3300060353 Bacteria 507
371 Ga0530510_0012323 3300061734 Bacteria 6004
372 Ga0530510_0122758 3300061734 Bacteria 1908
373 Ga0530510_0603090 3300061734 Bacteria 835
374 Ga0530510_0729270 3300061734 Bacteria 756
375 Ga0530510_1292403 3300061734 Bacteria 559
376 Ga0307513_10257753
377 JGI25406J46586_10007678
378 rootH2_10069731
379 Ga0065707_10554245
380 Ga0070660_101061460
381 Ga0070689_100601884
382 Ga0070689_102232566
383 Ga0070669_100004697
384 Ga0070669_101476947
385 Ga0070714_100017333
386 Ga0070714_100242795
387 Ga0070714_102364290
388 Ga0070713_100542131
389 Ga0070710_10102231
390 Ga0070711_101426112
391 Ga0070705_100085254
392 Ga0070694_100714822
393 Ga0070708_100026042
394 Ga0070708_100029298
395 Ga0070708_100271342
396 Ga0070708_100329898
397 Ga0070662_100270302
398 Ga0070681_10655189
399 Ga0070706_100184340
400 Ga0070706_101618149
401 Ga0070707_100020877
402 Ga0070707_100022473
403 Ga0070707_100106248
404 Ga0070707_100180513
405 Ga0070707_100238802
406 Ga0070707_101571575
407 Ga0070698_100154178
408 Ga0070698_100379326
409 Ga0070698_101769065
410 Ga0070698_101774071
411 Ga0070699_100017181
412 Ga0070699_100043018
413 Ga0070699_100632363
414 Ga0070679_100164151
415 Ga0070697_100019427
416 Ga0070697_100526125
417 Ga0070696_100081366
418 Ga0070696_100150322
419 Ga0070696_100630346
420 Ga0070696_100781519
421 Ga0070704_100014154
422 Ga0068857_101033648
423 Ga0068854_100561669
424 Ga0070702_100092365
425 Ga0068859_100056517
426 Ga0068859_100181865
427 Ga0068859_102768587
428 Ga0068861_101432420
429 Ga0068858_100922207
430 Ga0068858_101821211
431 Ga0068860_100025523
432 Ga0068860_100068353
433 Ga0068862_100036767
434 Ga0068862_102782453
435 Ga0081455_10213336
436 Ga0081539_10000180
437 Ga0070717_10874781
438 Ga0075365_10462736
439 Ga0075368_10016774
440 Ga0075363_100016975
441 Ga0075364_10102410
442 Ga0070715_10024843
443 Ga0070716_100093089
444 Ga0070712_100442380
445 Ga0075367_10019745
446 Ga0075367_11108373
447 Ga0075366_10168743
448 Ga0097621_102389408
449 Ga0075428_100021666
450 Ga0075428_100028376
451 Ga0075428_100030120
452 Ga0075428_102051902
453 Ga0075428_102657782
454 Ga0075430_100085632
455 Ga0075430_100204283
456 Ga0075430_101398372
457 Ga0075430_101596422
458 Ga0075430_101658222
459 Ga0075431_100002664
460 Ga0075431_100052377
461 Ga0075431_100056458
462 Ga0075431_100067638
463 Ga0075431_100199071
464 Ga0075431_100652344
465 Ga0075431_101388989
466 Ga0075433_10043141
467 Ga0075433_10057426
468 Ga0075433_10089545
469 Ga0075434_100001946
470 Ga0075434_100332071
471 Ga0075434_101797402
472 Ga0075434_102044348
473 Ga0075429_100012545
474 Ga0075429_100020900
475 Ga0075429_100049105
476 Ga0075429_100059712
477 Ga0075429_100078900
478 Ga0075429_100218469
479 Ga0075429_101433231
480 Ga0068865_100552644
481 Ga0068865_102088961
482 Ga0075436_100038336
483 Ga0097620_100056516
484 Ga0097620_100181863
485 Ga0097620_102768651
486 Ga0075435_100011949
487 Ga0075435_100093167
488 Ga0075435_100638544
489 Ga0075435_101463072
490 Ga0099794_10099409
491 Ga0099794_10462153
492 Ga0111539_10008515
493 Ga0105245_10547482
494 Ga0105247_11109318
495 Ga0114129_10000694
496 Ga0114129_10002963
497 Ga0114129_10007257
498 Ga0114129_10021318
499 Ga0114129_10106466
500 Ga0114129_10302854
501 Ga0114129_10309336
502 Ga0114129_10423547
503 Ga0114129_10477950
504 Ga0114129_10993757
505 Ga0105243_10094767
506 Ga0105241_10198493
507 Ga0105241_10304558
508 Ga0105242_10053686
509 Ga0105242_10938123
510 Ga0105248_10465097
511 Ga0105249_10035557
512 Ga0105249_10085104
513 Ga0105249_10399531
514 Ga0105249_10522316
515 Ga0105246_10683991
516 Ga0157373_11168177
517 Ga0157378_10056442
518 Ga0157378_11305314
519 Ga0163162_10240754
520 Ga0163162_11768211
521 Ga0157375_10150570
522 Ga0157377_10648880
523 Ga0163161_10917842
524 Ga0213872_10066851
525 Ga0207692_10108271
526 Ga0207710_10548648
527 Ga0207685_10235775
528 Ga0207684_10003339
529 Ga0207684_10292014
530 Ga0207684_10452742
531 Ga0207654_10105713
532 Ga0207654_10413541
533 Ga0207707_11190895
534 Ga0207693_10175867
535 Ga0207660_11358309
536 Ga0207657_11028505
537 Ga0207652_10611628
538 Ga0207646_10002996
539 Ga0207646_10078172
540 Ga0207646_10349363
541 Ga0207646_10361304
542 Ga0207681_10398006
543 Ga0207681_11132097
544 Ga0207700_10586535
545 Ga0207664_10002586
546 Ga0207664_11814974
547 Ga0207644_10582544
548 Ga0207706_10115355
549 Ga0207686_10165502
550 Ga0207709_10060565
551 Ga0207670_11102241
552 Ga0207665_10177523
553 Ga0207691_10020088
554 Ga0207711_10369363
555 Ga0207712_10096162
556 Ga0207712_10101521
557 Ga0207712_10461970
558 Ga0207668_11758804
559 Ga0207640_10291535
560 Ga0207658_11315249
561 Ga0207703_11036438
562 Ga0207703_12180504
563 Ga0207708_10165928
564 Ga0207648_11912825
565 Ga0207676_10596036
566 Ga0207674_10859472
567 Ga0207675_100071143
568 Ga0207675_100076212
569 Ga0207675_100592802
570 Ga0209588_1044912
571 Ga0209966_1070549
572 Ga0209813_10014415
573 Ga0207428_10090976
574 Ga0268265_10067739
575 Ga0268264_10163515
576 Ga0268264_10761425
577 Ga0268264_12660418
578 Ga0307515_10000096
579 Ga0307408_101627612
580 Ga0307516_10047984
581 Ga0307413_10650930
582 Ga0307409_102017003
583 Ga0307416_101550008
584 Ga0307416_102156630
585 Ga0307414_11448267
586 Ga0307411_11404553
587 Ga0307415_100725014
588 Ga0307415_102395523
589 Ga0373934_0000117
590 Ga0373923_0481083
591 Ga0373932_0245797
592 Ga0373954_0190715
593 Ga0373956_0001705
594 Ga0373957_0000425
595 Ga0373955_0027594
596 Ga0373933_0000538
597 Ga0373937_0006010
598 Ga0373925_0867037
599 Ga0395899_0559586
600 Ga0395905_0674659
601 Ga0436364_1247853
602 Ga0395901_0088394
603 Ga0436365_0663430
604 Ga0436361_0272782
605 Ga0436361_0427960
606 Ga0436363_1708901
607 Ga0439459_0143352
608 Ga0451577_0269772
609 Ga0451577_1749286
610 Ga0453683_0469886
611 Ga0466966_0740842
612 Ga0451576_1306616
613 Ga0451576_2167913
614 Ga0495603_0103795
615 Ga0495591_179621
616 Ga0495651_0013266
617 Ga0495650_0022546
618 Ga0495584_0077866
619 Ga0495594_0005474
620 Ga0495608_0173023
621 Ga0495642_0016357
622 Ga0495656_0825011
623 Ga0495611_0508147
624 Ga0495659_0167401
625 Ga0495588_0182111
626 Ga0495657_0368379
627 Ga0495670_0711906
628 Ga0495680_0098167
629 Ga0495677_0188792
630 Ga0501033_0985542
631 Ga0501036_0382319
632 Ga0501037_0566948
633 Ga0501038_0218012
634 Ga0501039_0107775
635 Ga0501039_0930233
636 Ga0501040_0002193
637 Ga0501040_0132961
638 Ga0501040_0550412
639 Ga0501040_0947885
640 Ga0501040_1212422
641 Ga0501041_0076362
642 Ga0501041_0292699
643 Ga0501042_0262530
644 Ga0501043_0474122
645 Ga0501046_0030631
646 Ga0501046_0166489
647 Ga0501048_0027950
648 Ga0501048_0274575
649 Ga0501048_1236252
650 Ga0501068_0770879
651 Ga0501072_0032344
652 Ga0501072_0384037
653 Ga0501072_0500607
654 Ga0501072_0951263
655 Ga0501075_0069873
656 Ga0501075_0144914
657 Ga0501075_0152753
658 Ga0501075_0236379
659 Ga0501075_0264696
660 Ga0501075_0366515
661 Ga0501075_0607401
662 Ga0501076_0007558
663 Ga0501076_0312146
664 Ga0501076_0439829
665 Ga0501076_1507558
666 Ga0501077_0043434
667 Ga0501077_0236117
668 Ga0501077_0357865
669 Ga0501079_0202221
670 Ga0501079_0211497
671 Ga0501079_0782767
672 Ga0501079_1556154
673 Ga0501080_0998052
674 Ga0501080_1368288
675 Ga0501081_0013648
676 Ga0501081_0125662
677 Ga0501081_0190826
678 Ga0501081_0217442
679 Ga0501081_0303617
680 Ga0501081_0516525
681 Ga0501045_0121209
682 nmdc:mga03n38_148986_c1
683 nmdc:mga00v17_406454_c1
684 nmdc:mga0yw44_1017736_c1
685 nmdc:mga0k408_133248_c1
686 nmdc:mga06z11_144397_c1
687 nmdc:mga04h51_19060_c1
688 nmdc:mga07m45_500784_c1
689 nmdc:mga05p37_132671_c1
690 nmdc:mga05p37_21053_c1
691 nmdc:mga05p37_266690_c1
692 nmdc:mga05p37_490970_c1
693 nmdc:mga05p37_49620_c1
694 nmdc:mga05p37_517_c1
695 nmdc:mga05p37_5801_c1
696 nmdc:mga05p37_6051_c1
697 nmdc:mga05p37_959264_c1
698 nmdc:mga09592_10506_c1
699 nmdc:mga09592_1051246_c1
700 nmdc:mga09592_1165649_c1
701 nmdc:mga09592_17481_c1
702 nmdc:mga09592_311862_c1
703 nmdc:mga09592_501178_c1
704 nmdc:mga09592_57527_c1
705 nmdc:mga09592_696745_c1
706 nmdc:mga0qj67_1095589_c1
707 nmdc:mga0qj67_1340185_c1
708 nmdc:mga0qj67_1506571_c1
709 nmdc:mga0qj67_192710_c1
710 nmdc:mga0qj67_481200_c1
711 nmdc:mga0qj67_552015_c1
712 nmdc:mga0qj67_874803_c1
713 nmdc:mga06r32_14717_c1
714 nmdc:mga06r32_373855_c1
715 nmdc:mga06r32_470028_c1
716 nmdc:mga06r32_532614_c1
717 nmdc:mga06r32_585471_c1
718 nmdc:mga08y16_12280_c1
719 nmdc:mga0n895_1040345_c1
720 nmdc:mga0n895_21177_c1
721 nmdc:mga0n895_70002_c1
722 nmdc:mga0n895_894927_c1
723 nmdc:mga0rr50_12121_c1
724 nmdc:mga0rr50_286940_c1
725 nmdc:mga0rr50_417623_c1
726 nmdc:mga0rr50_64489_c1
727 nmdc:mga08x19_56673_c1
728 nmdc:mga08x19_60073_c1
729 nmdc:mga0a205_5452_c1
730 nmdc:mga0a205_56669_c1
731 Ga0500583_0221781
732 Ga0500651_0220251
733 Ga0500642_0001303
734 Ga0500622_0003132
735 Ga0500622_0005573
736 Ga0501084_0130679
737 Ga0501084_0196867
738 Ga0501084_1397237
739 Ga0590075_140641
740 Ga0501082_0066276
741 Ga0501082_0116078
742 Ga0501082_0216424
743 Ga0501082_1258610
744 Ga0501082_1394342
745 Ga0501082_1984176
746 Ga0530510_0012323
747 Ga0530510_0122758
748 Ga0530510_0603090
749 Ga0530510_0729270
750 Ga0530510_1292403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08770

SoxZ

Sulphur oxidation protein SoxZ

7

104

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oxg-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.9409 4 105
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.9273 4 106
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.9272 4 106
2oxh-assembly1.cif.gz_Z the soxyz complex of paracoccus pantotrophus 0.8978 2 105
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8917 4 106
ID Description Score Start End Superfamily
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9272 4 106 2.60.40.10
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8917 4 106 2.60.40.10
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8229 4 104 2.60.40.10
af_Q58151_5_116_2.60.40.730 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.8227 5 106 2.60.40.730
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8115 1 106 2.60.40.2470
ID Description Score Start End GO Terms
AF-A0A4R6GX45-F1-model_v4 deleted 0.9354 4 106
AF-A0A0N1N341-F1-model_v4 Sulfur oxidation protein 0.9346 9 106
AF-A0A2C9D410-F1-model_v4 Putative secreted protein 0.9344 4 106
AF-A0A6L7KFJ9-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9341 4 106
AF-A0A522V9H2-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9335 1 106

Map