F426841

General Info

Members Datasets Scaffolds Average Seq Length
374 246 748 190

Family's Representative Sequence

Representative Sequence 3300047469|Ga0495673_0011372|Ga0495673_0011372_1495_2139
Length 214
Sequence MISNRKMMSAMRDDPPILICADLQIEYITEGRRHVIADAEAITSRCLELMTLWRSNLWPIIHLKRIAQAAWFNPASNLTDWIADLKPRPGELAFEHPLPSAYSSSRFAEYMTNMKSIRCVVSGFSLDETILSTVIDGFHRSHRYQIVSDAAACRRPGIGDAASYKMAVVKVISNFAGILEGADLVEADPAIAVRSGSAGSFDAGQGVNLSLDRP

Samples

Sample ID Description Type Environment
1 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
90 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
91 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
92 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
95 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
109 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
127 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
218 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
219 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
220 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
223 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
224 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
225 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
226 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
227 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
228 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
229 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
230 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
232 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
233 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
234 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
235 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
236 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
237 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
238 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
239 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
240 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
241 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
242 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
243 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
244 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
245 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
246 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 0.53
Isolates 4.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 2.41
Rhizoplane 5.08
Rhizosphere 74.87
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495673_0011372 3300047469 Bacteria 4788
2 rootL2_10287256 3300003322 Bacteria 1365
3 rootH1_10155853 3300003323 Bacteria 1735
4 JGI25160J50197_1004660 3300003354 Bacteria 5884
5 JGI25404J52841_10010184 3300003659 Bacteria 2019
6 JGI25404J52841_10017649 3300003659 Bacteria 1547
7 JGI25404J52841_10029892 3300003659 Bacteria 1168
8 Ga0055543_1014218 3300004625 Bacteria 1556
9 Ga0065165_1001593 3300005262 Bacteria 23304
10 Ga0070682_100185144 3300005337 Bacteria 1458
11 Ga0070661_100403882 3300005344 Bacteria 1081
12 Ga0070675_100095594 3300005354 Bacteria 2495
13 Ga0070709_10095334 3300005434 Bacteria 1971
14 Ga0070714_100020347 3300005435 Bacteria 5418
15 Ga0070714_100033412 3300005435 Bacteria 4300
16 Ga0070714_100036071 3300005435 Bacteria 4146
17 Ga0070713_100004676 3300005436 Bacteria 9242
18 Ga0070713_100058338 3300005436 Bacteria 3219
19 Ga0070713_100074510 3300005436 Bacteria 2876
20 Ga0070713_100708373 3300005436 Bacteria 961
21 Ga0070713_100877531 3300005436 Bacteria 862
22 Ga0070711_100005570 3300005439 Bacteria 7539
23 Ga0070708_100081308 3300005445 Bacteria 2933
24 Ga0070663_100340499 3300005455 Bacteria 1212
25 Ga0070678_100191685 3300005456 Bacteria 1681
26 Ga0070681_10052518 3300005458 Bacteria 4065
27 Ga0070681_10068279 3300005458 Bacteria 3522
28 Ga0070681_10247443 3300005458 Bacteria 1696
29 Ga0070706_100131553 3300005467 Bacteria 2335
30 Ga0070706_100239529 3300005467 Bacteria 1694
31 Ga0070698_100028875 3300005471 Bacteria 5757
32 Ga0070698_100802881 3300005471 Bacteria 885
33 Ga0070679_100104616 3300005530 Bacteria 2817
34 Ga0070684_100014564 3300005535 Bacteria 6375
35 Ga0070697_100032895 3300005536 Bacteria 4175
36 Ga0070697_100054591 3300005536 Bacteria 3248
37 Ga0070672_100201426 3300005543 Bacteria 1665
38 Ga0070693_100504653 3300005547 Bacteria 859
39 Ga0068855_100440180 3300005563 Bacteria 1424
40 Ga0068857_100031049 3300005577 Bacteria 4721
41 Ga0068854_100752993 3300005578 Bacteria 845
42 Ga0068856_100000082 3300005614 Bacteria 88302
43 Ga0068856_101118471 3300005614 Bacteria 805
44 Ga0068851_10152792 3300005834 Bacteria 1263
45 Ga0068870_10120611 3300005840 Bacteria 1510
46 Ga0068858_100819308 3300005842 Unclassified 908
47 Ga0081540_1009115 3300005983 Bacteria 6852
48 Ga0081540_1037964 3300005983 Bacteria 2545
49 Ga0070717_10000729 3300006028 Bacteria 21406
50 Ga0070717_10006956 3300006028 Bacteria 8361
51 Ga0070717_10275064 3300006028 Bacteria 1492
52 Ga0070715_10085474 3300006163 Bacteria 1441
53 Ga0070716_100119793 3300006173 Bacteria 1646
54 Ga0070716_100122952 3300006173 Bacteria 1628
55 Ga0070712_100023993 3300006175 Bacteria 4035
56 Ga0070712_100089467 3300006175 Bacteria 2252
57 Ga0068871_100080316 3300006358 Bacteria 2700
58 Ga0075434_100011002 3300006871 Bacteria 8511
59 Ga0099794_10008198 3300007265 Bacteria 4330
60 Ga0099794_10034044 3300007265 Bacteria 2397
61 Ga0099794_10085504 3300007265 Bacteria 1561
62 Ga0099795_10003455 3300007788 Bacteria 3911
63 Ga0099795_10267496 3300007788 Bacteria 742
64 Ga0105240_10404501 3300009093 Bacteria 1537
65 Ga0111539_11865835 3300009094 Bacteria 697
66 Ga0105245_10235518 3300009098 Bacteria 1772
67 Ga0105241_10063452 3300009174 Bacteria 2850
68 Ga0105237_10522241 3300009545 Bacteria 1194
69 Ga0105238_10017831 3300009551 Bacteria 7218
70 Ga0105238_10095359 3300009551 Bacteria 2962
71 Ga0099796_10003557 3300010159 Bacteria 3636
72 Ga0099796_10059035 3300010159 Bacteria 1354
73 Ga0105239_10058750 3300010375 Bacteria 4221
74 Ga0157369_10093475 3300013105 Bacteria 3210
75 Ga0157378_11527792 3300013297 Bacteria 713
76 Ga0157372_10943100 3300013307 Bacteria 1000
77 Ga0157375_11632440 3300013308 Bacteria 763
78 Ga0157380_10517807 3300014326 Bacteria 1163
79 Ga0157377_10526215 3300014745 Bacteria 831
80 Ga0213872_10019685 3300021361 Bacteria 3109
81 Ga0213872_10030697 3300021361 Bacteria 2463
82 Ga0213876_10101701 3300021384 Bacteria 1524
83 Ga0209677_100507 3300025253 Bacteria 21817
84 Ga0209233_1001070 3300025261 Bacteria 11346
85 Ga0209233_1002026 3300025261 Bacteria 7675
86 Ga0209455_1002657 3300025272 Bacteria 6741
87 Ga0209455_1004861 3300025272 Bacteria 4281
88 Ga0209758_1000160 3300025297 Bacteria 154304
89 Ga0207426_1053992 3300025302 Bacteria 1184
90 Ga0207692_10004062 3300025898 Bacteria 5769
91 Ga0207688_10319783 3300025901 Bacteria 952
92 Ga0207699_10002274 3300025906 Bacteria 9062
93 Ga0207699_10111367 3300025906 Bacteria 1755
94 Ga0207684_10118289 3300025910 Bacteria 2271
95 Ga0207684_10176460 3300025910 Bacteria 1842
96 Ga0207684_10389087 3300025910 Bacteria 1199
97 Ga0207684_10851863 3300025910 Bacteria 768
98 Ga0207654_10018175 3300025911 Bacteria 3686
99 Ga0207707_10013955 3300025912 Bacteria 7004
100 Ga0207707_10020067 3300025912 Bacteria 5832
101 Ga0207707_10171329 3300025912 Bacteria 1897
102 Ga0207695_10288875 3300025913 Bacteria 1532
103 Ga0207671_10330876 3300025914 Bacteria 1206
104 Ga0207693_10038706 3300025915 Bacteria 3754
105 Ga0207693_10270415 3300025915 Bacteria 1332
106 Ga0207663_10009293 3300025916 Bacteria 5187
107 Ga0207660_10054123 3300025917 Bacteria 2863
108 Ga0207660_10294673 3300025917 Bacteria 1291
109 Ga0207652_10186077 3300025921 Bacteria 1867
110 Ga0207694_10033167 3300025924 Bacteria 3956
111 Ga0207687_10429285 3300025927 Bacteria 1092
112 Ga0207700_10002089 3300025928 Bacteria 11394
113 Ga0207700_10076988 3300025928 Bacteria 2590
114 Ga0207700_10359695 3300025928 Bacteria 1269
115 Ga0207700_10472853 3300025928 Bacteria 1107
116 Ga0207700_10561868 3300025928 Bacteria 1013
117 Ga0207700_10888154 3300025928 Bacteria 797
118 Ga0207664_10071722 3300025929 Bacteria 2791
119 Ga0207665_10025509 3300025939 Bacteria 3900
120 Ga0207665_10056282 3300025939 Bacteria 2654
121 Ga0207691_10228459 3300025940 Bacteria 1612
122 Ga0207661_10035934 3300025944 Bacteria 3864
123 Ga0207703_10263860 3300026035 Bacteria 1558
124 Ga0207678_10447683 3300026067 Bacteria 1122
125 Ga0207678_10481972 3300026067 Bacteria 1080
126 Ga0207702_10000048 3300026078 Bacteria 143125
127 Ga0207674_10132629 3300026116 Bacteria 2454
128 Ga0207683_10195665 3300026121 Bacteria 1837
129 Ga0209588_1050681 3300027671 Bacteria 1342
130 Ga0268264_11008014 3300028381 Unclassified 839
131 Ga0265337_1019454 3300028556 Bacteria 2139
132 Ga0265326_10005953 3300028558 Bacteria 3821
133 Ga0265319_1021252 3300028563 Bacteria 2386
134 Ga0265334_10008859 3300028573 Bacteria 4272
135 Ga0265318_10016057 3300028577 Bacteria 3099
136 Ga0265323_10007182 3300028653 Bacteria 4645
137 Ga0265322_10012817 3300028654 Bacteria 2428
138 Ga0265336_10000474 3300028666 Bacteria 23860
139 Ga0265338_10000086 3300028800 Bacteria 175026
140 Ga0265324_10032955 3300029957 Bacteria 1809
141 Ga0265330_10032530 3300031235 Bacteria 2337
142 Ga0265325_10005176 3300031241 Bacteria 8103
143 Ga0265340_10001336 3300031247 Bacteria 14132
144 Ga0265339_10077677 3300031249 Bacteria 1759
145 Ga0265339_10116585 3300031249 Bacteria 1377
146 Ga0265316_10178205 3300031344 Bacteria 1583
147 Ga0307509_10133007 3300031507 Bacteria 2439
148 Ga0265314_10079832 3300031711 Bacteria 2162
149 Ga0307415_101444605 3300032126 Bacteria 656
150 Ga0307510_10019357 3300033180 Bacteria 7986
151 Ga0316215_1002183 3300033544 Bacteria 1851
152 Ga0373934_0006280 3300035086 Bacteria 4405
153 Ga0373936_0039052 3300035113 Bacteria 1899
154 Ga0373945_0033278 3300035116 Bacteria 1831
155 Ga0373953_0001298 3300035117 Bacteria 7152
156 Ga0373953_0023318 3300035117 Bacteria 2342
157 Ga0373954_0007902 3300035118 Bacteria 4659
158 Ga0373956_0010202 3300035119 Bacteria 3841
159 Ga0373957_0001216 3300035120 Bacteria 6872
160 Ga0373943_0003057 3300035170 Bacteria 7600
161 Ga0373943_0097285 3300035170 Bacteria 1533
162 Ga0373943_0262240 3300035170 Bacteria 973
163 Ga0373946_0040467 3300035171 Bacteria 1907
164 Ga0373946_0052020 3300035171 Bacteria 1716
165 Ga0373955_0000840 3300035172 Bacteria 13157
166 Ga0373955_0027046 3300035172 Bacteria 2961
167 Ga0373955_0264729 3300035172 Bacteria 1032
168 Ga0373924_0011295 3300035410 Bacteria 3314
169 Ga0373924_0259175 3300035410 Bacteria 770
170 Ga0373931_0425246 3300035691 Bacteria 845
171 Ga0373935_0002523 3300035692 Bacteria 10491
172 Ga0373935_0065712 3300035692 Bacteria 2328
173 Ga0373935_0549658 3300035692 Bacteria 841
174 Ga0373927_0005981 3300035695 Bacteria 8333
175 Ga0373927_0011394 3300035695 Bacteria 5922
176 Ga0373927_0020048 3300035695 Bacteria 4385
177 Ga0373933_0000041 3300035724 Bacteria 79805
178 Ga0373933_0000563 3300035724 Bacteria 23152
179 Ga0373933_0022634 3300035724 Bacteria 3581
180 Ga0373933_0056740 3300035724 Bacteria 2352
181 Ga0373947_0002253 3300035725 Bacteria 11647
182 Ga0373947_0036144 3300035725 Bacteria 2928
183 Ga0373937_0011363 3300036401 Bacteria 7813
184 Ga0373937_0117690 3300036401 Bacteria 2475
185 Ga0310112_012798 3300036458 Bacteria 1198
186 Ga0372808_023581 3300036459 Bacteria 883
187 Ga0373925_0010706 3300037068 Bacteria 6651
188 Ga0395899_0040771 3300037312 Bacteria 3472
189 Ga0395900_0001685 3300037418 Bacteria 25715
190 Ga0395898_0062472 3300037466 Bacteria 3617
191 Ga0395905_0005761 3300037471 Bacteria 12591
192 Ga0395901_0093372 3300038443 Bacteria 3151
193 Ga0436365_0680900 3300039437 Bacteria 2127
194 Ga0436365_1538276 3300039437 Bacteria 785
195 Ga0436360_0934579 3300039438 Bacteria 1147
196 Ga0436361_0057712 3300039447 Bacteria 1867
197 Ga0436361_1050743 3300039447 Bacteria 3641
198 Ga0436363_1212487 3300039450 Bacteria 4383
199 Ga0436362_0316800 3300039453 Bacteria 4140
200 Ga0436362_1008100 3300039453 Bacteria 781
201 Ga0451833_1120811 3300041491 Bacteria 1053
202 Ga0466965_0463327 3300044683 Bacteria 707
203 Ga0466968_0012358 3300044735 Bacteria 3341
204 Ga0466970_0257298 3300044765 Bacteria 979
205 Ga0466960_0016530 3300044901 Bacteria 3203
206 Ga0466960_0155701 3300044901 Bacteria 1224
207 Ga0466959_0049491 3300045049 Bacteria 3088
208 Ga0466959_0090930 3300045049 Bacteria 2192
209 Ga0466967_0171258 3300045976 Bacteria 2043
210 Ga0495592_0005090 3300046454 Bacteria 9683
211 Ga0495592_0037151 3300046454 Bacteria 3667
212 Ga0495592_0077431 3300046454 Bacteria 2411
213 Ga0495603_0000329 3300046455 Bacteria 25682
214 Ga0495603_0090023 3300046455 Bacteria 1795
215 Ga0495629_0000355 3300046459 Bacteria 39013
216 Ga0495629_0001261 3300046459 Bacteria 19886
217 Ga0495629_0055167 3300046459 Bacteria 2779
218 Ga0495651_0035841 3300046462 Bacteria 3862
219 Ga0495653_0014880 3300046463 Bacteria 6346
220 Ga0495580_0000744 3300046472 Bacteria 27906
221 Ga0495580_0168357 3300046472 Bacteria 1515
222 Ga0495582_0005216 3300046473 Bacteria 7270
223 Ga0495582_0018470 3300046473 Bacteria 3813
224 Ga0495639_0000061 3300046475 Bacteria 48670
225 Ga0495639_0003076 3300046475 Bacteria 7263
226 Ga0495662_0000437 3300046476 Bacteria 18723
227 Ga0495662_0034865 3300046476 Bacteria 2429
228 Ga0495662_0123400 3300046476 Bacteria 1272
229 Ga0495664_0044143 3300046477 Bacteria 2641
230 Ga0495664_0160167 3300046477 Bacteria 1365
231 Ga0495664_0257896 3300046477 Bacteria 1054
232 Ga0495594_0002652 3300046499 Bacteria 9308
233 Ga0495608_0019396 3300046511 Bacteria 4679
234 Ga0495618_0033941 3300046514 Bacteria 3199
235 Ga0495618_0063435 3300046514 Bacteria 2346
236 Ga0495628_0034482 3300046516 Bacteria 4070
237 Ga0495630_0099319 3300046517 Bacteria 2202
238 Ga0495644_0201868 3300046523 Bacteria 767
239 Ga0495666_0029721 3300046526 Bacteria 2688
240 Ga0495652_0012274 3300046529 Bacteria 7734
241 Ga0495652_0108993 3300046529 Bacteria 2230
242 Ga0495652_0114024 3300046529 Bacteria 2169
243 Ga0495665_0000414 3300046531 Bacteria 21734
244 Ga0495665_0003822 3300046531 Bacteria 8151
245 Ga0495640_0000826 3300046533 Bacteria 23573
246 Ga0495640_0006399 3300046533 Bacteria 9316
247 Ga0495640_0019224 3300046533 Bacteria 5046
248 Ga0495640_0065271 3300046533 Bacteria 2458
249 Ga0495622_0016180 3300046557 Bacteria 3472
250 Ga0495667_0001528 3300046559 Bacteria 15306
251 Ga0495667_0021166 3300046559 Bacteria 4387
252 Ga0495667_0409767 3300046559 Bacteria 853
253 Ga0495634_0000762 3300046642 Bacteria 31177
254 Ga0495634_0002573 3300046642 Bacteria 14976
255 Ga0495634_0052467 3300046642 Bacteria 2733
256 Ga0495635_0000187 3300046663 Bacteria 39002
257 Ga0495635_0001091 3300046663 Bacteria 18022
258 Ga0495635_0009566 3300046663 Bacteria 6773
259 Ga0495588_0040382 3300046674 Bacteria 2380
260 Ga0495657_0008735 3300046675 Bacteria 7734
261 Ga0495657_0034562 3300046675 Bacteria 3510
262 Ga0495599_0003241 3300046678 Bacteria 9471
263 Ga0495599_0115417 3300046678 Bacteria 1671
264 Ga0495646_0006474 3300046680 Bacteria 7429
265 Ga0495646_0028456 3300046680 Bacteria 3499
266 Ga0495647_0001125 3300046681 Bacteria 8188
267 Ga0495647_0023771 3300046681 Bacteria 2225
268 Ga0495658_0000047 3300046683 Bacteria 59626
269 Ga0495658_0020133 3300046683 Bacteria 3496
270 Ga0495613_0019255 3300046689 Bacteria 5089
271 Ga0495613_0045365 3300046689 Bacteria 3251
272 Ga0495624_0000188 3300046690 Bacteria 46706
273 Ga0495600_0002225 3300046809 Bacteria 11039
274 Ga0495600_0351563 3300046809 Bacteria 923
275 Ga0495581_0000705 3300047315 Bacteria 17570
276 Ga0495581_0003838 3300047315 Bacteria 8641
277 Ga0495604_0015655 3300047317 Bacteria 6053
278 Ga0495604_0021667 3300047317 Bacteria 5130
279 Ga0495674_0015080 3300047319 Bacteria 7232
280 Ga0495674_0016543 3300047319 Bacteria 6883
281 Ga0495674_0019564 3300047319 Bacteria 6281
282 Ga0495676_0030536 3300047321 Bacteria 4571
283 Ga0495676_0036571 3300047321 Bacteria 4098
284 Ga0495680_0005405 3300047322 Bacteria 12029
285 Ga0495675_0035757 3300047444 Bacteria 3171
286 Ga0495684_0020212 3300047471 Bacteria 5129
287 Ga0495684_0042683 3300047471 Bacteria 3473
288 Ga0495593_0000616 3300047673 Bacteria 20328
289 Ga0495593_0072809 3300047673 Bacteria 1783
290 Ga0495602_0065372 3300048088 Bacteria 3139
291 Ga0495614_0004428 3300048089 Bacteria 6332
292 Ga0496100_0138345 3300048903 Bacteria 1723
293 Ga0496100_0816827 3300048903 Bacteria 731
294 Ga0496104_0035768 3300048907 Bacteria 4639
295 Ga0496104_0062643 3300048907 Bacteria 3526
296 Ga0496104_0259508 3300048907 Bacteria 1650
297 Ga0496105_0013534 3300048908 Bacteria 6480
298 Ga0496105_0074170 3300048908 Bacteria 2811
299 Ga0496105_0183027 3300048908 Bacteria 1715
300 Ga0496108_0051821 3300048911 Bacteria 3438
301 Ga0496108_0622196 3300048911 Bacteria 940
302 Ga0496109_0258725 3300048912 Bacteria 1639
303 Ga0496110_0084109 3300048913 Bacteria 2840
304 Ga0496112_0108122 3300048915 Bacteria 2751
305 Ga0496113_0014988 3300048916 Bacteria 5309
306 Ga0496113_0383954 3300048916 Bacteria 1127
307 Ga0496114_0068007 3300048917 Bacteria 2990
308 Ga0496115_0075198 3300048918 Bacteria 2743
309 Ga0496115_0340949 3300048918 Bacteria 1223
310 Ga0496115_0365403 3300048918 Bacteria 1175
311 Ga0496116_0257623 3300048919 Bacteria 863
312 Ga0496117_0247064 3300048920 Bacteria 976
313 Ga0496118_0064723 3300048921 Bacteria 2681
314 Ga0496118_0238896 3300048921 Bacteria 1042
315 Ga0496119_0012923 3300048922 Bacteria 6719
316 Ga0496119_0166704 3300048922 Bacteria 1166
317 Ga0496120_0012568 3300048923 Bacteria 5754
318 Ga0496121_0021888 3300048924 Bacteria 6239
319 Ga0496121_0026882 3300048924 Bacteria 5403
320 Ga0496121_0109631 3300048924 Bacteria 2109
321 Ga0496121_0247728 3300048924 Bacteria 1237
322 Ga0496122_0080819 3300048925 Bacteria 2265
323 Ga0496126_0030180 3300048929 Bacteria 5139
324 Ga0496126_0182579 3300048929 Bacteria 1781
325 Ga0496126_0895471 3300048929 Bacteria 673
326 nmdc:mga00v17_706239_c1 3300050491 Bacteria 646
327 nmdc:mga07m45_105599_c1 3300050496 Bacteria 1620
328 nmdc:mga0n895_20096_c1 3300050512 Bacteria 6220
329 nmdc:mga08x19_493897_c1 3300050514 Bacteria 864
330 nmdc:mga0a205_439707_c1 3300050515 Bacteria 1165
331 Ga0495601_0020044 3300053077 Bacteria 4081
332 Ga0495601_0064415 3300053077 Bacteria 2331
333 Ga0495601_0121578 3300053077 Bacteria 1696
334 Ga0495612_0088898 3300053078 Bacteria 1305
335 Ga0500635_0002924 3300053080 Bacteria 4254
336 Ga0495595_0002399 3300053084 Bacteria 7316
337 Ga0495619_0002636 3300053085 Bacteria 11719
338 Ga0500566_0000026 3300053094 Bacteria 77138
339 Ga0500640_005254 3300053095 Bacteria 4805
340 Ga0500572_000172 3300053111 Bacteria 22845
341 Ga0500572_000279 3300053111 Bacteria 18581
342 Ga0500608_006140 3300053122 Bacteria 4861
343 Ga0500559_0000633 3300053136 Bacteria 23806
344 Ga0500559_0002297 3300053136 Bacteria 10044
345 Ga0500603_000047 3300053150 Bacteria 29770
346 Ga0500603_000212 3300053150 Bacteria 15404
347 Ga0500630_005362 3300053159 Bacteria 6254
348 Ga0500638_154366 3300053162 Bacteria 1017
349 Ga0500639_000269 3300053163 Bacteria 25662
350 Ga0500639_242059 3300053163 Bacteria 731
351 Ga0500637_0000545 3300053178 Bacteria 14737
352 Ga0500637_0184328 3300053178 Bacteria 1195
353 Ga0500576_009741 3300053725 Bacteria 4231
354 Ga0500596_000058 3300053735 Bacteria 15240
355 Ga0500596_004610 3300053735 Bacteria 2512
356 Ga0500596_011076 3300053735 Bacteria 1383
357 Ga0500601_000048 3300053737 Bacteria 25132
358 Ga0500661_011485 3300055283 Bacteria 1602
359 Ga0466962_0054722 3300061719 Bacteria 1907
360 2507508515 2507262055 Bacteria 8048963
361 2511393510 2511231028 Bacteria 8046582
362 2513718608 2513237104 Bacteria 10034502
363 2513889182 2513237141 Bacteria 8496279
364 2515629822 2515154112 Bacteria 8294334
365 2824701348 2824696289 Bacteria 8335049
366 2842038992 2842038055 Bacteria 8002051
367 2842048061 2842045827 Bacteria 8006841
368 2874615486 2874612657 Bacteria 8252029
369 2874627755 2874620515 Bacteria 8290088
370 2874631934 2874628541 Bacteria 8630250
371 2885373232 2885366525 Bacteria 8326213
372 2904672925 2904666416 Bacteria 8226587
373 3005599320 3005594810 Bacteria 8716512
374 8019684334 8019678201 Bacteria 8863603
375 Ga0495673_0011372
376 rootL2_10287256
377 rootH1_10155853
378 JGI25160J50197_1004660
379 JGI25404J52841_10010184
380 JGI25404J52841_10017649
381 JGI25404J52841_10029892
382 Ga0055543_1014218
383 Ga0065165_1001593
384 Ga0070682_100185144
385 Ga0070661_100403882
386 Ga0070675_100095594
387 Ga0070709_10095334
388 Ga0070714_100020347
389 Ga0070714_100033412
390 Ga0070714_100036071
391 Ga0070713_100004676
392 Ga0070713_100058338
393 Ga0070713_100074510
394 Ga0070713_100708373
395 Ga0070713_100877531
396 Ga0070711_100005570
397 Ga0070708_100081308
398 Ga0070663_100340499
399 Ga0070678_100191685
400 Ga0070681_10052518
401 Ga0070681_10068279
402 Ga0070681_10247443
403 Ga0070706_100131553
404 Ga0070706_100239529
405 Ga0070698_100028875
406 Ga0070698_100802881
407 Ga0070679_100104616
408 Ga0070684_100014564
409 Ga0070697_100032895
410 Ga0070697_100054591
411 Ga0070672_100201426
412 Ga0070693_100504653
413 Ga0068855_100440180
414 Ga0068857_100031049
415 Ga0068854_100752993
416 Ga0068856_100000082
417 Ga0068856_101118471
418 Ga0068851_10152792
419 Ga0068870_10120611
420 Ga0068858_100819308
421 Ga0081540_1009115
422 Ga0081540_1037964
423 Ga0070717_10000729
424 Ga0070717_10006956
425 Ga0070717_10275064
426 Ga0070715_10085474
427 Ga0070716_100119793
428 Ga0070716_100122952
429 Ga0070712_100023993
430 Ga0070712_100089467
431 Ga0068871_100080316
432 Ga0075434_100011002
433 Ga0099794_10008198
434 Ga0099794_10034044
435 Ga0099794_10085504
436 Ga0099795_10003455
437 Ga0099795_10267496
438 Ga0105240_10404501
439 Ga0111539_11865835
440 Ga0105245_10235518
441 Ga0105241_10063452
442 Ga0105237_10522241
443 Ga0105238_10017831
444 Ga0105238_10095359
445 Ga0099796_10003557
446 Ga0099796_10059035
447 Ga0105239_10058750
448 Ga0157369_10093475
449 Ga0157378_11527792
450 Ga0157372_10943100
451 Ga0157375_11632440
452 Ga0157380_10517807
453 Ga0157377_10526215
454 Ga0213872_10019685
455 Ga0213872_10030697
456 Ga0213876_10101701
457 Ga0209677_100507
458 Ga0209233_1001070
459 Ga0209233_1002026
460 Ga0209455_1002657
461 Ga0209455_1004861
462 Ga0209758_1000160
463 Ga0207426_1053992
464 Ga0207692_10004062
465 Ga0207688_10319783
466 Ga0207699_10002274
467 Ga0207699_10111367
468 Ga0207684_10118289
469 Ga0207684_10176460
470 Ga0207684_10389087
471 Ga0207684_10851863
472 Ga0207654_10018175
473 Ga0207707_10013955
474 Ga0207707_10020067
475 Ga0207707_10171329
476 Ga0207695_10288875
477 Ga0207671_10330876
478 Ga0207693_10038706
479 Ga0207693_10270415
480 Ga0207663_10009293
481 Ga0207660_10054123
482 Ga0207660_10294673
483 Ga0207652_10186077
484 Ga0207694_10033167
485 Ga0207687_10429285
486 Ga0207700_10002089
487 Ga0207700_10076988
488 Ga0207700_10359695
489 Ga0207700_10472853
490 Ga0207700_10561868
491 Ga0207700_10888154
492 Ga0207664_10071722
493 Ga0207665_10025509
494 Ga0207665_10056282
495 Ga0207691_10228459
496 Ga0207661_10035934
497 Ga0207703_10263860
498 Ga0207678_10447683
499 Ga0207678_10481972
500 Ga0207702_10000048
501 Ga0207674_10132629
502 Ga0207683_10195665
503 Ga0209588_1050681
504 Ga0268264_11008014
505 Ga0265337_1019454
506 Ga0265326_10005953
507 Ga0265319_1021252
508 Ga0265334_10008859
509 Ga0265318_10016057
510 Ga0265323_10007182
511 Ga0265322_10012817
512 Ga0265336_10000474
513 Ga0265338_10000086
514 Ga0265324_10032955
515 Ga0265330_10032530
516 Ga0265325_10005176
517 Ga0265340_10001336
518 Ga0265339_10077677
519 Ga0265339_10116585
520 Ga0265316_10178205
521 Ga0307509_10133007
522 Ga0265314_10079832
523 Ga0307415_101444605
524 Ga0307510_10019357
525 Ga0316215_1002183
526 Ga0373934_0006280
527 Ga0373936_0039052
528 Ga0373945_0033278
529 Ga0373953_0001298
530 Ga0373953_0023318
531 Ga0373954_0007902
532 Ga0373956_0010202
533 Ga0373957_0001216
534 Ga0373943_0003057
535 Ga0373943_0097285
536 Ga0373943_0262240
537 Ga0373946_0040467
538 Ga0373946_0052020
539 Ga0373955_0000840
540 Ga0373955_0027046
541 Ga0373955_0264729
542 Ga0373924_0011295
543 Ga0373924_0259175
544 Ga0373931_0425246
545 Ga0373935_0002523
546 Ga0373935_0065712
547 Ga0373935_0549658
548 Ga0373927_0005981
549 Ga0373927_0011394
550 Ga0373927_0020048
551 Ga0373933_0000041
552 Ga0373933_0000563
553 Ga0373933_0022634
554 Ga0373933_0056740
555 Ga0373947_0002253
556 Ga0373947_0036144
557 Ga0373937_0011363
558 Ga0373937_0117690
559 Ga0310112_012798
560 Ga0372808_023581
561 Ga0373925_0010706
562 Ga0395899_0040771
563 Ga0395900_0001685
564 Ga0395898_0062472
565 Ga0395905_0005761
566 Ga0395901_0093372
567 Ga0436365_0680900
568 Ga0436365_1538276
569 Ga0436360_0934579
570 Ga0436361_0057712
571 Ga0436361_1050743
572 Ga0436363_1212487
573 Ga0436362_0316800
574 Ga0436362_1008100
575 Ga0451833_1120811
576 Ga0466965_0463327
577 Ga0466968_0012358
578 Ga0466970_0257298
579 Ga0466960_0016530
580 Ga0466960_0155701
581 Ga0466959_0049491
582 Ga0466959_0090930
583 Ga0466967_0171258
584 Ga0495592_0005090
585 Ga0495592_0037151
586 Ga0495592_0077431
587 Ga0495603_0000329
588 Ga0495603_0090023
589 Ga0495629_0000355
590 Ga0495629_0001261
591 Ga0495629_0055167
592 Ga0495651_0035841
593 Ga0495653_0014880
594 Ga0495580_0000744
595 Ga0495580_0168357
596 Ga0495582_0005216
597 Ga0495582_0018470
598 Ga0495639_0000061
599 Ga0495639_0003076
600 Ga0495662_0000437
601 Ga0495662_0034865
602 Ga0495662_0123400
603 Ga0495664_0044143
604 Ga0495664_0160167
605 Ga0495664_0257896
606 Ga0495594_0002652
607 Ga0495608_0019396
608 Ga0495618_0033941
609 Ga0495618_0063435
610 Ga0495628_0034482
611 Ga0495630_0099319
612 Ga0495644_0201868
613 Ga0495666_0029721
614 Ga0495652_0012274
615 Ga0495652_0108993
616 Ga0495652_0114024
617 Ga0495665_0000414
618 Ga0495665_0003822
619 Ga0495640_0000826
620 Ga0495640_0006399
621 Ga0495640_0019224
622 Ga0495640_0065271
623 Ga0495622_0016180
624 Ga0495667_0001528
625 Ga0495667_0021166
626 Ga0495667_0409767
627 Ga0495634_0000762
628 Ga0495634_0002573
629 Ga0495634_0052467
630 Ga0495635_0000187
631 Ga0495635_0001091
632 Ga0495635_0009566
633 Ga0495588_0040382
634 Ga0495657_0008735
635 Ga0495657_0034562
636 Ga0495599_0003241
637 Ga0495599_0115417
638 Ga0495646_0006474
639 Ga0495646_0028456
640 Ga0495647_0001125
641 Ga0495647_0023771
642 Ga0495658_0000047
643 Ga0495658_0020133
644 Ga0495613_0019255
645 Ga0495613_0045365
646 Ga0495624_0000188
647 Ga0495600_0002225
648 Ga0495600_0351563
649 Ga0495581_0000705
650 Ga0495581_0003838
651 Ga0495604_0015655
652 Ga0495604_0021667
653 Ga0495674_0015080
654 Ga0495674_0016543
655 Ga0495674_0019564
656 Ga0495676_0030536
657 Ga0495676_0036571
658 Ga0495680_0005405
659 Ga0495675_0035757
660 Ga0495684_0020212
661 Ga0495684_0042683
662 Ga0495593_0000616
663 Ga0495593_0072809
664 Ga0495602_0065372
665 Ga0495614_0004428
666 Ga0496100_0138345
667 Ga0496100_0816827
668 Ga0496104_0035768
669 Ga0496104_0062643
670 Ga0496104_0259508
671 Ga0496105_0013534
672 Ga0496105_0074170
673 Ga0496105_0183027
674 Ga0496108_0051821
675 Ga0496108_0622196
676 Ga0496109_0258725
677 Ga0496110_0084109
678 Ga0496112_0108122
679 Ga0496113_0014988
680 Ga0496113_0383954
681 Ga0496114_0068007
682 Ga0496115_0075198
683 Ga0496115_0340949
684 Ga0496115_0365403
685 Ga0496116_0257623
686 Ga0496117_0247064
687 Ga0496118_0064723
688 Ga0496118_0238896
689 Ga0496119_0012923
690 Ga0496119_0166704
691 Ga0496120_0012568
692 Ga0496121_0021888
693 Ga0496121_0026882
694 Ga0496121_0109631
695 Ga0496121_0247728
696 Ga0496122_0080819
697 Ga0496126_0030180
698 Ga0496126_0182579
699 Ga0496126_0895471
700 nmdc:mga00v17_706239_c1
701 nmdc:mga07m45_105599_c1
702 nmdc:mga0n895_20096_c1
703 nmdc:mga08x19_493897_c1
704 nmdc:mga0a205_439707_c1
705 Ga0495601_0020044
706 Ga0495601_0064415
707 Ga0495601_0121578
708 Ga0495612_0088898
709 Ga0500635_0002924
710 Ga0495595_0002399
711 Ga0495619_0002636
712 Ga0500566_0000026
713 Ga0500640_005254
714 Ga0500572_000172
715 Ga0500572_000279
716 Ga0500608_006140
717 Ga0500559_0000633
718 Ga0500559_0002297
719 Ga0500603_000047
720 Ga0500603_000212
721 Ga0500630_005362
722 Ga0500638_154366
723 Ga0500639_000269
724 Ga0500639_242059
725 Ga0500637_0000545
726 Ga0500637_0184328
727 Ga0500576_009741
728 Ga0500596_000058
729 Ga0500596_004610
730 Ga0500596_011076
731 Ga0500601_000048
732 Ga0500661_011485
733 Ga0466962_0054722
734 2507508515
735 2511393510
736 2513718608
737 2513889182
738 2515629822
739 2824701348
740 2842038992
741 2842048061
742 2874615486
743 2874627755
744 2874631934
745 2885373232
746 2904672925
747 3005599320
748 8019684334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

16

180

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cib-assembly1.cif.gz_F structural and functional analysis of the pseudomonas aeruginosa pa1677 protein 0.8701 16 184
3lqy-assembly1.cif.gz_A crystal structure of putative isochorismatase hydrolase from oleispira antarctica 0.8336 17 186
4h17-assembly1.cif.gz_B crystal structure of an isochorismatase (pp1826) from pseudomonas putida kt2440 at 1.60 a resolution 0.8298 7 183
2b34-assembly1.cif.gz_A structure of mar1 ribonuclease from caenorhabditis elegans 0.8226 17 188
3mcw-assembly1.cif.gz_B crystal structure of an a putative hydrolase of the isochorismatase family (cv_1320) from chromobacterium violaceum atcc 12472 at 1.06 a resolution 0.8162 16 191
ID Description Score Start End Superfamily
af_A0JME6_2_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8353 17 181 3.40.50.850
af_B0G192_1_183_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8255 17 186 3.40.50.850
2a67C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8226 17 180 3.40.50.850
3irvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8127 17 189 3.40.50.850
af_Q54NZ8_2_198_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8036 16 187 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A0J6WX33-F1-model_v4 Isochorismatase-like domain-containing protein 0.9081 17 186 GO:0016787
AF-A0A1F3SV28-F1-model_v4 Isochorismatase-like domain-containing protein 0.907 16 184 GO:0016787
AF-A0A4D7BEZ0-F1-model_v4 Cysteine hydrolase 0.9018 16 188 GO:0016787
AF-A0A370GFI7-F1-model_v4 Nicotinamidase-related amidase 0.8991 17 189 GO:0016810
AF-A0A2D6T093-F1-model_v4 Isochorismatase-like domain-containing protein 0.889 16 193 GO:0016787

Map