F426838

General Info

Members Datasets Scaffolds Average Seq Length
374 189 748 218

Family's Representative Sequence

Representative Sequence 3300046684|Ga0495669_0156956|Ga0495669_0156956_91_843
Length 250
Sequence MLPPPTLRSTPVNKYLTEFIGTFFLVLTIGLSVLGGTPMAPLAIGAVLMVMVYMGGHVSGGHYNPAVSLAVLLRGKLHPRDVVPYMTMQVVGAVAAAVVVYVVLGRTFAPAPGQAASVVGALVVEVLYTTALCLVVLHSATAPQTTGNSFYGLAIGFTVAAGAFAGGPISGGAFNPAVGIGPIFVSAVLGSDGSPWANLWLYLVGPFVGGALAAAVYRVQQPAEATPQEALAAPADLDEAMPSSRRMTPA

Samples

Sample ID Description Type Environment
1 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
173 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.27
Rhizosphere 97.86
Stem 0
Stem Tuber 0
Unclassified 22.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495669_0156956 3300046684 Bacteria 1079
2 JGI24744J21845_10024755 3300002077 Bacteria 1173
3 JGI24033J26618_1000066 3300002155 Bacteria 15346
4 Ga0065704_10189135 3300005289 Bacteria 1198
5 Ga0065707_10010743 3300005295 Bacteria 2864
6 Ga0065707_10018141 3300005295 Unclassified 1969
7 Ga0070670_100075752 3300005331 Bacteria 2891
8 Ga0070670_100349390 3300005331 Bacteria 1299
9 Ga0070670_100391570 3300005331 Bacteria 1225
10 Ga0070677_10033914 3300005333 Archaea 1969
11 Ga0068869_100190689 3300005334 Bacteria 1611
12 Ga0070680_100109820 3300005336 Unclassified 2295
13 Ga0068868_100169713 3300005338 Bacteria 1806
14 Ga0070689_100010435 3300005340 Bacteria 6621
15 Ga0070687_100016725 3300005343 Bacteria 3355
16 Ga0070661_100003872 3300005344 Bacteria 10300
17 Ga0070661_100213538 3300005344 Bacteria 1478
18 Ga0070668_100070581 3300005347 Unclassified 2720
19 Ga0070669_100006999 3300005353 Bacteria 8105
20 Ga0070669_100143120 3300005353 Bacteria 1845
21 Ga0070675_100069435 3300005354 Unclassified 2919
22 Ga0070675_100073549 3300005354 Unclassified 2837
23 Ga0070675_100118202 3300005354 Unclassified 2251
24 Ga0070675_100466111 3300005354 Bacteria 1135
25 Ga0070671_100060183 3300005355 Unclassified 3162
26 Ga0070671_100064735 3300005355 Bacteria 3045
27 Ga0070671_100116853 3300005355 Bacteria 2243
28 Ga0070671_100133005 3300005355 Bacteria 2095
29 Ga0070674_100034537 3300005356 Bacteria 3379
30 Ga0070674_100093044 3300005356 Bacteria 2181
31 Ga0070674_100132176 3300005356 Unclassified 1862
32 Ga0070674_100310609 3300005356 Unclassified 1260
33 Ga0070673_100134602 3300005364 Bacteria 2078
34 Ga0070673_100396796 3300005364 Unclassified 1233
35 Ga0070688_100148440 3300005365 Bacteria 1600
36 Ga0070703_10024308 3300005406 Bacteria 1790
37 Ga0070714_100389228 3300005435 Unclassified 1316
38 Ga0070713_100023424 3300005436 Bacteria 4792
39 Ga0070713_100268605 3300005436 Bacteria 1561
40 Ga0070701_10223033 3300005438 Unclassified 1125
41 Ga0070701_10225295 3300005438 Bacteria 1120
42 Ga0070705_100002398 3300005440 Bacteria 9434
43 Ga0070705_100036223 3300005440 Bacteria 2772
44 Ga0070705_100102470 3300005440 Unclassified 1810
45 Ga0070705_100451610 3300005440 Bacteria 964
46 Ga0070700_100067623 3300005441 Unclassified 2270
47 Ga0070694_100009991 3300005444 Bacteria 5834
48 Ga0070694_100023205 3300005444 Bacteria 3987
49 Ga0070694_100058235 3300005444 Bacteria 2628
50 Ga0070694_100285328 3300005444 Unclassified 1260
51 Ga0070694_100306314 3300005444 Bacteria 1219
52 Ga0070708_100009251 3300005445 Bacteria 7942
53 Ga0070708_100027273 3300005445 Bacteria 4900
54 Ga0070708_100034883 3300005445 Bacteria 4380
55 Ga0070708_100426982 3300005445 Bacteria 1250
56 Ga0070708_100496376 3300005445 Bacteria 1151
57 Ga0070678_100035865 3300005456 Bacteria 3467
58 Ga0070681_10002467 3300005458 Bacteria 16942
59 Ga0070681_10023393 3300005458 Bacteria 6213
60 Ga0070685_10308886 3300005466 Bacteria 1068
61 Ga0070706_100065930 3300005467 Unclassified 3349
62 Ga0070706_100081660 3300005467 Unclassified 2994
63 Ga0070706_100102726 3300005467 Unclassified 2658
64 Ga0070706_100231779 3300005467 Bacteria 1724
65 Ga0070706_100443063 3300005467 Bacteria 1209
66 Ga0070706_100530397 3300005467 Bacteria 1095
67 Ga0070707_100001756 3300005468 Bacteria 20884
68 Ga0070707_100005225 3300005468 Bacteria 12154
69 Ga0070707_100020392 3300005468 Bacteria 6252
70 Ga0070707_100028579 3300005468 Bacteria 5308
71 Ga0070707_100048290 3300005468 Unclassified 4078
72 Ga0070707_100140640 3300005468 Bacteria 2349
73 Ga0070707_100244690 3300005468 Bacteria 1745
74 Ga0070707_100269851 3300005468 Bacteria 1654
75 Ga0070707_101216418 3300005468 Unclassified 719
76 Ga0070698_100004739 3300005471 Bacteria 14941
77 Ga0070698_100013329 3300005471 Bacteria 8701
78 Ga0070698_100016817 3300005471 Bacteria 7715
79 Ga0070698_100036189 3300005471 Bacteria 5101
80 Ga0070698_100053441 3300005471 Bacteria 4105
81 Ga0070698_100063272 3300005471 Bacteria 3731
82 Ga0070698_100080471 3300005471 Bacteria 3253
83 Ga0070698_100498842 3300005471 Bacteria 1155
84 Ga0070698_100667002 3300005471 Unclassified 981
85 Ga0070699_100000646 3300005518 Bacteria 32649
86 Ga0070699_100000870 3300005518 Bacteria 28095
87 Ga0070699_100000883 3300005518 Bacteria 27929
88 Ga0070699_100003153 3300005518 Bacteria 14592
89 Ga0070699_100026112 3300005518 Bacteria 5037
90 Ga0070699_100067109 3300005518 Bacteria 3115
91 Ga0070699_100338211 3300005518 Unclassified 1355
92 Ga0070679_100001208 3300005530 Bacteria 22740
93 Ga0070684_100055714 3300005535 Bacteria 3448
94 Ga0070684_100406347 3300005535 Bacteria 1256
95 Ga0070697_100000579 3300005536 Bacteria 27659
96 Ga0070697_100019994 3300005536 Bacteria 5292
97 Ga0070697_100056906 3300005536 Unclassified 3182
98 Ga0070697_100116844 3300005536 Bacteria 2228
99 Ga0070697_100164343 3300005536 Unclassified 1876
100 Ga0070697_100222271 3300005536 Bacteria 1610
101 Ga0070672_100019465 3300005543 Bacteria 4927
102 Ga0070686_100031994 3300005544 Bacteria 3222
103 Ga0070695_100001067 3300005545 Bacteria 14995
104 Ga0070695_100013426 3300005545 Bacteria 4922
105 Ga0070695_100075076 3300005545 Bacteria 2223
106 Ga0070695_100075855 3300005545 Bacteria 2213
107 Ga0070696_100196717 3300005546 Bacteria 1503
108 Ga0070696_100237475 3300005546 Unclassified 1373
109 Ga0070665_100826154 3300005548 Bacteria 940
110 Ga0070704_100003638 3300005549 Bacteria 8863
111 Ga0070704_100119788 3300005549 Bacteria 2019
112 Ga0070704_100410968 3300005549 Bacteria 1157
113 Ga0070664_100007006 3300005564 Bacteria 9093
114 Ga0070664_100059423 3300005564 Bacteria 3252
115 Ga0068857_100121328 3300005577 Unclassified 2353
116 Ga0068856_100583491 3300005614 Bacteria 1139
117 Ga0070702_100235786 3300005615 Bacteria 1232
118 Ga0068852_100642739 3300005616 Bacteria 1068
119 Ga0068859_100242615 3300005617 Bacteria 1891
120 Ga0068859_100258825 3300005617 Bacteria 1831
121 Ga0068859_100334460 3300005617 Bacteria 1609
122 Ga0068861_100044034 3300005719 Bacteria 3354
123 Ga0068861_100291650 3300005719 Unclassified 1409
124 Ga0068863_100077303 3300005841 Bacteria 3150
125 Ga0068863_100080549 3300005841 Bacteria 3084
126 Ga0068860_100141419 3300005843 Bacteria 2313
127 Ga0068862_100978077 3300005844 Unclassified 836
128 Ga0081539_10035985 3300005985 Bacteria 2968
129 Ga0070717_10000119 3300006028 Bacteria 61576
130 Ga0070717_10007470 3300006028 Bacteria 8114
131 Ga0070717_10052316 3300006028 Bacteria 3364
132 Ga0070717_10057610 3300006028 Bacteria 3212
133 Ga0075432_10070923 3300006058 Bacteria 1252
134 Ga0097621_100678679 3300006237 Bacteria 947
135 Ga0075428_100068114 3300006844 Bacteria 3894
136 Ga0075428_100132830 3300006844 Bacteria 2707
137 Ga0075428_100189402 3300006844 Unclassified 2225
138 Ga0075428_100234982 3300006844 Bacteria 1978
139 Ga0075428_100350302 3300006844 Bacteria 1585
140 Ga0075430_100026464 3300006846 Bacteria 4934
141 Ga0075430_100902436 3300006846 Bacteria 728
142 Ga0075431_100053741 3300006847 Bacteria 4152
143 Ga0075431_100361900 3300006847 Unclassified 1457
144 Ga0075431_101184422 3300006847 Unclassified 727
145 Ga0075433_10169817 3300006852 Unclassified 1941
146 Ga0075433_10230627 3300006852 Unclassified 1644
147 Ga0075433_10266046 3300006852 Bacteria 1520
148 Ga0075433_10818437 3300006852 Unclassified 813
149 Ga0075434_100261721 3300006871 Bacteria 1749
150 Ga0075429_100033605 3300006880 Bacteria 4457
151 Ga0075429_100228217 3300006880 Bacteria 1631
152 Ga0075429_100314568 3300006880 Unclassified 1370
153 Ga0068865_100140517 3300006881 Bacteria 1820
154 Ga0075436_100016543 3300006914 Bacteria 5049
155 Ga0075436_100059093 3300006914 Bacteria 2648
156 Ga0075436_100182839 3300006914 Bacteria 1482
157 Ga0075436_100207564 3300006914 Bacteria 1388
158 Ga0097620_100242614 3300006931 Bacteria 1891
159 Ga0097620_100258823 3300006931 Bacteria 1831
160 Ga0097620_100334494 3300006931 Bacteria 1609
161 Ga0075435_100022203 3300007076 Bacteria 4893
162 Ga0075435_100699797 3300007076 Bacteria 881
163 Ga0111539_10005268 3300009094 Bacteria 16742
164 Ga0111539_10028719 3300009094 Bacteria 6783
165 Ga0111539_10553300 3300009094 Unclassified 1340
166 Ga0114129_10005319 3300009147 Bacteria 18170
167 Ga0114129_10087452 3300009147 Bacteria 4321
168 Ga0114129_10131289 3300009147 Bacteria 3440
169 Ga0114129_10264579 3300009147 Bacteria 2303
170 Ga0114129_11161346 3300009147 Unclassified 964
171 Ga0105243_10332126 3300009148 Unclassified 1389
172 Ga0105243_10333548 3300009148 Bacteria 1386
173 Ga0105242_10938855 3300009176 Bacteria 868
174 Ga0105248_10252080 3300009177 Bacteria 1987
175 Ga0105249_10008630 3300009553 Bacteria 8880
176 Ga0105249_10063128 3300009553 Bacteria 3402
177 Ga0105246_10178420 3300011119 Bacteria 1633
178 Ga0157374_10441687 3300013296 Bacteria 1302
179 Ga0157378_10003150 3300013297 Bacteria 14663
180 Ga0157378_10182893 3300013297 Bacteria 1973
181 Ga0163162_10019204 3300013306 Bacteria 6702
182 Ga0163162_10203485 3300013306 Bacteria 2109
183 Ga0157375_10037745 3300013308 Bacteria 4631
184 Ga0157375_10089419 3300013308 Bacteria 3136
185 Ga0157375_10701098 3300013308 Unclassified 1166
186 Ga0163163_10022154 3300014325 Bacteria 6010
187 Ga0157380_10042979 3300014326 Bacteria 3535
188 Ga0157380_11181211 3300014326 Unclassified 808
189 Ga0157380_11539520 3300014326 Bacteria 719
190 Ga0213876_10001376 3300021384 Bacteria 15206
191 Ga0213876_10006461 3300021384 Bacteria 6391
192 Ga0213875_10038268 3300021388 Bacteria 2260
193 Ga0207682_10017869 3300025893 Unclassified 2768
194 Ga0207688_10026367 3300025901 Bacteria 3196
195 Ga0207645_10009593 3300025907 Bacteria 6687
196 Ga0207643_10004015 3300025908 Bacteria 7917
197 Ga0207684_10000001 3300025910 Bacteria 1115726
198 Ga0207684_10062902 3300025910 Bacteria 3151
199 Ga0207684_10208829 3300025910 Unclassified 1684
200 Ga0207707_10001284 3300025912 Bacteria 23421
201 Ga0207707_10022024 3300025912 Bacteria 5570
202 Ga0207660_10060778 3300025917 Unclassified 2718
203 Ga0207662_10008522 3300025918 Bacteria 5617
204 Ga0207649_10000427 3300025920 Bacteria 30819
205 Ga0207652_10000678 3300025921 Bacteria 33275
206 Ga0207646_10000021 3300025922 Bacteria 272003
207 Ga0207646_10000309 3300025922 Bacteria 66396
208 Ga0207646_10006561 3300025922 Bacteria 12007
209 Ga0207646_10013576 3300025922 Bacteria 7780
210 Ga0207646_10015563 3300025922 Bacteria 7179
211 Ga0207646_10020534 3300025922 Bacteria 6119
212 Ga0207646_10024964 3300025922 Bacteria 5469
213 Ga0207646_10069144 3300025922 Bacteria 3154
214 Ga0207646_10099579 3300025922 Unclassified 2605
215 Ga0207646_10130784 3300025922 Unclassified 2259
216 Ga0207646_10305293 3300025922 Bacteria 1438
217 Ga0207681_10337842 3300025923 Unclassified 1202
218 Ga0207650_10073347 3300025925 Unclassified 2578
219 Ga0207650_10113942 3300025925 Bacteria 2097
220 Ga0207659_10124750 3300025926 Bacteria 1978
221 Ga0207659_10174703 3300025926 Bacteria 1697
222 Ga0207700_10079302 3300025928 Bacteria 2557
223 Ga0207664_10153239 3300025929 Bacteria 1960
224 Ga0207664_10249173 3300025929 Bacteria 1550
225 Ga0207664_10523292 3300025929 Bacteria 1063
226 Ga0207644_10010075 3300025931 Bacteria 6224
227 Ga0207644_10017524 3300025931 Bacteria 4839
228 Ga0207644_10051266 3300025931 Unclassified 2962
229 Ga0207644_10060712 3300025931 Bacteria 2736
230 Ga0207706_10086079 3300025933 Bacteria 2763
231 Ga0207709_10468532 3300025935 Unclassified 977
232 Ga0207670_10107296 3300025936 Bacteria 2005
233 Ga0207669_10106270 3300025937 Bacteria 1869
234 Ga0207669_10232637 3300025937 Unclassified 1361
235 Ga0207669_10408050 3300025937 Unclassified 1066
236 Ga0207669_10674998 3300025937 Bacteria 847
237 Ga0207704_10116182 3300025938 Bacteria 1820
238 Ga0207691_10008756 3300025940 Bacteria 9706
239 Ga0207691_10243413 3300025940 Unclassified 1554
240 Ga0207711_10264403 3300025941 Bacteria 1582
241 Ga0207711_10415592 3300025941 Unclassified 1251
242 Ga0207689_10043798 3300025942 Bacteria 3699
243 Ga0207661_10184071 3300025944 Bacteria 1827
244 Ga0207679_10069284 3300025945 Bacteria 2654
245 Ga0207679_10091800 3300025945 Unclassified 2351
246 Ga0207651_10363131 3300025960 Unclassified 1223
247 Ga0207668_10025843 3300025972 Bacteria 3805
248 Ga0207640_10942311 3300025981 Unclassified 756
249 Ga0207658_10136492 3300025986 Bacteria 1979
250 Ga0207658_10847982 3300025986 Bacteria 831
251 Ga0207708_10096089 3300026075 Unclassified 2289
252 Ga0207702_10132304 3300026078 Bacteria 2246
253 Ga0207641_10076599 3300026088 Bacteria 2892
254 Ga0207641_10306391 3300026088 Unclassified 1502
255 Ga0207641_11148744 3300026088 Unclassified 776
256 Ga0207648_10028907 3300026089 Bacteria 4914
257 Ga0207648_10078649 3300026089 Unclassified 2877
258 Ga0207674_10055481 3300026116 Bacteria 4028
259 Ga0207674_10080623 3300026116 Unclassified 3257
260 Ga0207675_100053635 3300026118 Bacteria 3762
261 Ga0207683_10229482 3300026121 Unclassified 1693
262 Ga0207698_10647641 3300026142 Bacteria 1046
263 Ga0207428_10019670 3300027907 Bacteria 5754
264 Ga0207428_10451379 3300027907 Unclassified 937
265 Ga0268266_10202139 3300028379 Unclassified 1819
266 Ga0268265_10010554 3300028380 Bacteria 6237
267 Ga0268265_10729639 3300028380 Bacteria 960
268 Ga0268264_10065516 3300028381 Unclassified 3061
269 Ga0265337_1002380 3300028556 Bacteria 8681
270 Ga0265318_10006358 3300028577 Bacteria 5450
271 Ga0265318_10105533 3300028577 Bacteria 1036
272 Ga0265336_10000774 3300028666 Bacteria 16931
273 Ga0265330_10137469 3300031235 Bacteria 1039
274 Ga0265332_10036484 3300031238 Bacteria 2134
275 Ga0265320_10001530 3300031240 Bacteria 16753
276 Ga0265331_10019639 3300031250 Bacteria 3486
277 Ga0265316_10055038 3300031344 Bacteria 3114
278 Ga0265316_10128681 3300031344 Bacteria 1908
279 Ga0265314_10161292 3300031711 Bacteria 1364
280 Ga0265342_10171484 3300031712 Bacteria 1193
281 Ga0307405_10182726 3300031731 Bacteria 1507
282 Ga0307413_10021042 3300031824 Bacteria 3483
283 Ga0307413_10080621 3300031824 Bacteria 2084
284 Ga0307413_10312886 3300031824 Bacteria 1196
285 Ga0307413_10616138 3300031824 Bacteria 890
286 Ga0307410_10037346 3300031852 Bacteria 3172
287 Ga0307410_10079300 3300031852 Bacteria 2300
288 Ga0307406_10037197 3300031901 Bacteria 3004
289 Ga0307406_10049110 3300031901 Bacteria 2669
290 Ga0307407_10037326 3300031903 Bacteria 2684
291 Ga0307407_10062536 3300031903 Bacteria 2180
292 Ga0307407_10227808 3300031903 Bacteria 1264
293 Ga0307412_10085914 3300031911 Unclassified 2188
294 Ga0307409_100102126 3300031995 Unclassified 2381
295 Ga0307409_101132162 3300031995 Bacteria 804
296 Ga0307416_100015838 3300032002 Bacteria 5221
297 Ga0307416_100633820 3300032002 Bacteria 1152
298 Ga0307414_10478045 3300032004 Bacteria 1098
299 Ga0307411_10036499 3300032005 Bacteria 3080
300 Ga0307411_10380080 3300032005 Bacteria 1161
301 Ga0307415_100052235 3300032126 Bacteria 2778
302 Ga0373931_0059505 3300035691 Bacteria 2055
303 Ga0373925_0287770 3300037068 Unclassified 1325
304 Ga0395905_0000011 3300037471 Bacteria 424563
305 Ga0436364_0627242 3300037853 Unclassified 1267
306 Ga0436364_0654386 3300037853 Bacteria 8588
307 Ga0436365_0737153 3300039437 Bacteria 14103
308 Ga0436365_0929096 3300039437 Bacteria 27643
309 Ga0451577_0004313 3300042876 Bacteria 15097
310 Ga0453683_0374810 3300044673 Bacteria 916
311 Ga0453684_0106795 3300044712 Bacteria 3411
312 Ga0453684_0366563 3300044712 Bacteria 1621
313 Ga0451576_0015626 3300045051 Bacteria 8401
314 Ga0451576_0314567 3300045051 Bacteria 1638
315 Ga0451576_0519868 3300045051 Bacteria 1250
316 Ga0495603_0006493 3300046455 Bacteria 7006
317 Ga0495584_0028383 3300046491 Bacteria 2835
318 Ga0495584_0067103 3300046491 Bacteria 1804
319 Ga0495620_0138049 3300046515 Bacteria 954
320 Ga0495663_0088140 3300046525 Bacteria 1008
321 Ga0495663_0108803 3300046525 Unclassified 919
322 Ga0495642_0003962 3300046528 Bacteria 5793
323 Ga0495598_0055536 3300046537 Unclassified 1206
324 Ga0495609_0067059 3300046538 Bacteria 1581
325 Ga0495659_0001799 3300046664 Bacteria 7115
326 Ga0495669_0290164 3300046684 Bacteria 788
327 Ga0495670_0375508 3300046691 Unclassified 767
328 Ga0495636_0042486 3300047318 Unclassified 1889
329 Ga0495636_0099731 3300047318 Bacteria 1268
330 Ga0495677_0076085 3300047445 Bacteria 1255
331 Ga0495677_0141366 3300047445 Bacteria 924
332 Ga0495677_0247741 3300047445 Bacteria 696
333 Ga0495685_007818 3300047447 Bacteria 3536
334 Ga0496106_0743011 3300048909 Unclassified 780
335 Ga0501036_0281536 3300049572 Bacteria 1392
336 Ga0501067_0067520 3300049583 Bacteria 1980
337 Ga0501249_035377 3300049679 Bacteria 1123
338 Ga0501257_048980 3300049686 Bacteria 1051
339 Ga0501081_0434773 3300049743 Bacteria 974
340 Ga0501273_004870 3300049770 Bacteria 1496
341 nmdc:mga05p37_153536_c1 3300050507 Bacteria 2815
342 nmdc:mga05p37_174335_c1 3300050507 Bacteria 2621
343 nmdc:mga05p37_409586_c1 3300050507 Bacteria 1581
344 nmdc:mga05p37_41147_c1 3300050507 Bacteria 5675
345 nmdc:mga05p37_71517_c1 3300050507 Bacteria 4267
346 nmdc:mga05p37_728125_c1 3300050507 Unclassified 1097
347 nmdc:mga09592_19982_c1 3300050508 Bacteria 5501
348 nmdc:mga09592_511164_c1 3300050508 Unclassified 1034
349 nmdc:mga0qj67_291974_c1 3300050509 Unclassified 1321
350 nmdc:mga0qj67_653794_c1 3300050509 Bacteria 838
351 nmdc:mga0qj67_70068_c1 3300050509 Bacteria 2797
352 nmdc:mga06r32_25722_c1 3300050510 Bacteria 5479
353 nmdc:mga06r32_493819_c1 3300050510 Unclassified 1201
354 nmdc:mga06r32_509070_c1 3300050510 Bacteria 1180
355 nmdc:mga06r32_862492_c1 3300050510 Unclassified 863
356 nmdc:mga08y16_133580_c1 3300050511 Bacteria 2579
357 nmdc:mga08y16_232566_c1 3300050511 Unclassified 1906
358 nmdc:mga0n895_91174_c1 3300050512 Unclassified 3050
359 nmdc:mga0rr50_104338_c1 3300050513 Bacteria 2233
360 nmdc:mga0rr50_176906_c1 3300050513 Bacteria 1742
361 nmdc:mga0rr50_209959_c1 3300050513 Bacteria 1604
362 nmdc:mga0rr50_270250_c1 3300050513 Archaea 1417
363 nmdc:mga08x19_40746_c1 3300050514 Bacteria 2957
364 nmdc:mga08x19_83331_c1 3300050514 Unclassified 2102
365 nmdc:mga0a205_121825_c1 3300050515 Unclassified 2507
366 nmdc:mga0a205_126930_c1 3300050515 Bacteria 2451
367 nmdc:mga0a205_331047_c1 3300050515 Bacteria 1393
368 Ga0590071_000332 3300059421 Bacteria 13875
369 Ga0590071_030856 3300059421 Bacteria 1277
370 Ga0590074_000690 3300059423 Bacteria 5138
371 Ga0590075_000372 3300059424 Bacteria 12306
372 Ga0590077_000051 3300059426 Bacteria 27843
373 Ga0590077_015749 3300059426 Bacteria 1583
374 2889420722 2889415604 Bacteria 8048700
375 Ga0495669_0156956
376 JGI24744J21845_10024755
377 JGI24033J26618_1000066
378 Ga0065704_10189135
379 Ga0065707_10010743
380 Ga0065707_10018141
381 Ga0070670_100075752
382 Ga0070670_100349390
383 Ga0070670_100391570
384 Ga0070677_10033914
385 Ga0068869_100190689
386 Ga0070680_100109820
387 Ga0068868_100169713
388 Ga0070689_100010435
389 Ga0070687_100016725
390 Ga0070661_100003872
391 Ga0070661_100213538
392 Ga0070668_100070581
393 Ga0070669_100006999
394 Ga0070669_100143120
395 Ga0070675_100069435
396 Ga0070675_100073549
397 Ga0070675_100118202
398 Ga0070675_100466111
399 Ga0070671_100060183
400 Ga0070671_100064735
401 Ga0070671_100116853
402 Ga0070671_100133005
403 Ga0070674_100034537
404 Ga0070674_100093044
405 Ga0070674_100132176
406 Ga0070674_100310609
407 Ga0070673_100134602
408 Ga0070673_100396796
409 Ga0070688_100148440
410 Ga0070703_10024308
411 Ga0070714_100389228
412 Ga0070713_100023424
413 Ga0070713_100268605
414 Ga0070701_10223033
415 Ga0070701_10225295
416 Ga0070705_100002398
417 Ga0070705_100036223
418 Ga0070705_100102470
419 Ga0070705_100451610
420 Ga0070700_100067623
421 Ga0070694_100009991
422 Ga0070694_100023205
423 Ga0070694_100058235
424 Ga0070694_100285328
425 Ga0070694_100306314
426 Ga0070708_100009251
427 Ga0070708_100027273
428 Ga0070708_100034883
429 Ga0070708_100426982
430 Ga0070708_100496376
431 Ga0070678_100035865
432 Ga0070681_10002467
433 Ga0070681_10023393
434 Ga0070685_10308886
435 Ga0070706_100065930
436 Ga0070706_100081660
437 Ga0070706_100102726
438 Ga0070706_100231779
439 Ga0070706_100443063
440 Ga0070706_100530397
441 Ga0070707_100001756
442 Ga0070707_100005225
443 Ga0070707_100020392
444 Ga0070707_100028579
445 Ga0070707_100048290
446 Ga0070707_100140640
447 Ga0070707_100244690
448 Ga0070707_100269851
449 Ga0070707_101216418
450 Ga0070698_100004739
451 Ga0070698_100013329
452 Ga0070698_100016817
453 Ga0070698_100036189
454 Ga0070698_100053441
455 Ga0070698_100063272
456 Ga0070698_100080471
457 Ga0070698_100498842
458 Ga0070698_100667002
459 Ga0070699_100000646
460 Ga0070699_100000870
461 Ga0070699_100000883
462 Ga0070699_100003153
463 Ga0070699_100026112
464 Ga0070699_100067109
465 Ga0070699_100338211
466 Ga0070679_100001208
467 Ga0070684_100055714
468 Ga0070684_100406347
469 Ga0070697_100000579
470 Ga0070697_100019994
471 Ga0070697_100056906
472 Ga0070697_100116844
473 Ga0070697_100164343
474 Ga0070697_100222271
475 Ga0070672_100019465
476 Ga0070686_100031994
477 Ga0070695_100001067
478 Ga0070695_100013426
479 Ga0070695_100075076
480 Ga0070695_100075855
481 Ga0070696_100196717
482 Ga0070696_100237475
483 Ga0070665_100826154
484 Ga0070704_100003638
485 Ga0070704_100119788
486 Ga0070704_100410968
487 Ga0070664_100007006
488 Ga0070664_100059423
489 Ga0068857_100121328
490 Ga0068856_100583491
491 Ga0070702_100235786
492 Ga0068852_100642739
493 Ga0068859_100242615
494 Ga0068859_100258825
495 Ga0068859_100334460
496 Ga0068861_100044034
497 Ga0068861_100291650
498 Ga0068863_100077303
499 Ga0068863_100080549
500 Ga0068860_100141419
501 Ga0068862_100978077
502 Ga0081539_10035985
503 Ga0070717_10000119
504 Ga0070717_10007470
505 Ga0070717_10052316
506 Ga0070717_10057610
507 Ga0075432_10070923
508 Ga0097621_100678679
509 Ga0075428_100068114
510 Ga0075428_100132830
511 Ga0075428_100189402
512 Ga0075428_100234982
513 Ga0075428_100350302
514 Ga0075430_100026464
515 Ga0075430_100902436
516 Ga0075431_100053741
517 Ga0075431_100361900
518 Ga0075431_101184422
519 Ga0075433_10169817
520 Ga0075433_10230627
521 Ga0075433_10266046
522 Ga0075433_10818437
523 Ga0075434_100261721
524 Ga0075429_100033605
525 Ga0075429_100228217
526 Ga0075429_100314568
527 Ga0068865_100140517
528 Ga0075436_100016543
529 Ga0075436_100059093
530 Ga0075436_100182839
531 Ga0075436_100207564
532 Ga0097620_100242614
533 Ga0097620_100258823
534 Ga0097620_100334494
535 Ga0075435_100022203
536 Ga0075435_100699797
537 Ga0111539_10005268
538 Ga0111539_10028719
539 Ga0111539_10553300
540 Ga0114129_10005319
541 Ga0114129_10087452
542 Ga0114129_10131289
543 Ga0114129_10264579
544 Ga0114129_11161346
545 Ga0105243_10332126
546 Ga0105243_10333548
547 Ga0105242_10938855
548 Ga0105248_10252080
549 Ga0105249_10008630
550 Ga0105249_10063128
551 Ga0105246_10178420
552 Ga0157374_10441687
553 Ga0157378_10003150
554 Ga0157378_10182893
555 Ga0163162_10019204
556 Ga0163162_10203485
557 Ga0157375_10037745
558 Ga0157375_10089419
559 Ga0157375_10701098
560 Ga0163163_10022154
561 Ga0157380_10042979
562 Ga0157380_11181211
563 Ga0157380_11539520
564 Ga0213876_10001376
565 Ga0213876_10006461
566 Ga0213875_10038268
567 Ga0207682_10017869
568 Ga0207688_10026367
569 Ga0207645_10009593
570 Ga0207643_10004015
571 Ga0207684_10000001
572 Ga0207684_10062902
573 Ga0207684_10208829
574 Ga0207707_10001284
575 Ga0207707_10022024
576 Ga0207660_10060778
577 Ga0207662_10008522
578 Ga0207649_10000427
579 Ga0207652_10000678
580 Ga0207646_10000021
581 Ga0207646_10000309
582 Ga0207646_10006561
583 Ga0207646_10013576
584 Ga0207646_10015563
585 Ga0207646_10020534
586 Ga0207646_10024964
587 Ga0207646_10069144
588 Ga0207646_10099579
589 Ga0207646_10130784
590 Ga0207646_10305293
591 Ga0207681_10337842
592 Ga0207650_10073347
593 Ga0207650_10113942
594 Ga0207659_10124750
595 Ga0207659_10174703
596 Ga0207700_10079302
597 Ga0207664_10153239
598 Ga0207664_10249173
599 Ga0207664_10523292
600 Ga0207644_10010075
601 Ga0207644_10017524
602 Ga0207644_10051266
603 Ga0207644_10060712
604 Ga0207706_10086079
605 Ga0207709_10468532
606 Ga0207670_10107296
607 Ga0207669_10106270
608 Ga0207669_10232637
609 Ga0207669_10408050
610 Ga0207669_10674998
611 Ga0207704_10116182
612 Ga0207691_10008756
613 Ga0207691_10243413
614 Ga0207711_10264403
615 Ga0207711_10415592
616 Ga0207689_10043798
617 Ga0207661_10184071
618 Ga0207679_10069284
619 Ga0207679_10091800
620 Ga0207651_10363131
621 Ga0207668_10025843
622 Ga0207640_10942311
623 Ga0207658_10136492
624 Ga0207658_10847982
625 Ga0207708_10096089
626 Ga0207702_10132304
627 Ga0207641_10076599
628 Ga0207641_10306391
629 Ga0207641_11148744
630 Ga0207648_10028907
631 Ga0207648_10078649
632 Ga0207674_10055481
633 Ga0207674_10080623
634 Ga0207675_100053635
635 Ga0207683_10229482
636 Ga0207698_10647641
637 Ga0207428_10019670
638 Ga0207428_10451379
639 Ga0268266_10202139
640 Ga0268265_10010554
641 Ga0268265_10729639
642 Ga0268264_10065516
643 Ga0265337_1002380
644 Ga0265318_10006358
645 Ga0265318_10105533
646 Ga0265336_10000774
647 Ga0265330_10137469
648 Ga0265332_10036484
649 Ga0265320_10001530
650 Ga0265331_10019639
651 Ga0265316_10055038
652 Ga0265316_10128681
653 Ga0265314_10161292
654 Ga0265342_10171484
655 Ga0307405_10182726
656 Ga0307413_10021042
657 Ga0307413_10080621
658 Ga0307413_10312886
659 Ga0307413_10616138
660 Ga0307410_10037346
661 Ga0307410_10079300
662 Ga0307406_10037197
663 Ga0307406_10049110
664 Ga0307407_10037326
665 Ga0307407_10062536
666 Ga0307407_10227808
667 Ga0307412_10085914
668 Ga0307409_100102126
669 Ga0307409_101132162
670 Ga0307416_100015838
671 Ga0307416_100633820
672 Ga0307414_10478045
673 Ga0307411_10036499
674 Ga0307411_10380080
675 Ga0307415_100052235
676 Ga0373931_0059505
677 Ga0373925_0287770
678 Ga0395905_0000011
679 Ga0436364_0627242
680 Ga0436364_0654386
681 Ga0436365_0737153
682 Ga0436365_0929096
683 Ga0451577_0004313
684 Ga0453683_0374810
685 Ga0453684_0106795
686 Ga0453684_0366563
687 Ga0451576_0015626
688 Ga0451576_0314567
689 Ga0451576_0519868
690 Ga0495603_0006493
691 Ga0495584_0028383
692 Ga0495584_0067103
693 Ga0495620_0138049
694 Ga0495663_0088140
695 Ga0495663_0108803
696 Ga0495642_0003962
697 Ga0495598_0055536
698 Ga0495609_0067059
699 Ga0495659_0001799
700 Ga0495669_0290164
701 Ga0495670_0375508
702 Ga0495636_0042486
703 Ga0495636_0099731
704 Ga0495677_0076085
705 Ga0495677_0141366
706 Ga0495677_0247741
707 Ga0495685_007818
708 Ga0496106_0743011
709 Ga0501036_0281536
710 Ga0501067_0067520
711 Ga0501249_035377
712 Ga0501257_048980
713 Ga0501081_0434773
714 Ga0501273_004870
715 nmdc:mga05p37_153536_c1
716 nmdc:mga05p37_174335_c1
717 nmdc:mga05p37_409586_c1
718 nmdc:mga05p37_41147_c1
719 nmdc:mga05p37_71517_c1
720 nmdc:mga05p37_728125_c1
721 nmdc:mga09592_19982_c1
722 nmdc:mga09592_511164_c1
723 nmdc:mga0qj67_291974_c1
724 nmdc:mga0qj67_653794_c1
725 nmdc:mga0qj67_70068_c1
726 nmdc:mga06r32_25722_c1
727 nmdc:mga06r32_493819_c1
728 nmdc:mga06r32_509070_c1
729 nmdc:mga06r32_862492_c1
730 nmdc:mga08y16_133580_c1
731 nmdc:mga08y16_232566_c1
732 nmdc:mga0n895_91174_c1
733 nmdc:mga0rr50_104338_c1
734 nmdc:mga0rr50_176906_c1
735 nmdc:mga0rr50_209959_c1
736 nmdc:mga0rr50_270250_c1
737 nmdc:mga08x19_40746_c1
738 nmdc:mga08x19_83331_c1
739 nmdc:mga0a205_121825_c1
740 nmdc:mga0a205_126930_c1
741 nmdc:mga0a205_331047_c1
742 Ga0590071_000332
743 Ga0590071_030856
744 Ga0590074_000690
745 Ga0590075_000372
746 Ga0590077_000051
747 Ga0590077_015749
748 2889420722

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

6

217

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w7r-assembly1.cif.gz_A high resolution structure of a fish aquaporin reveals a novel extracellular fold. 0.9059 2 202
7w7r-assembly2.cif.gz_D-3 high resolution structure of a fish aquaporin reveals a novel extracellular fold. 0.9009 2 202
2b5f-assembly1.cif.gz_A crystal structure of the spinach aquaporin sopip2;1 in an open conformation to 3.9 resolution 0.8971 2 201
2w1p-assembly1.cif.gz_A 1.4 angstrom crystal structure of p.pastoris aquaporin, aqy1, in a closed conformation at ph 8.0 0.8898 2 204
2o9d-assembly2.cif.gz_B crystal structure of aqpz mutant t183c. 0.8888 2 202
ID Description Score Start End Superfamily
af_Q4DNM8_182_433_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9126 3 202 1.20.1080.10
af_Q54V53_9_255_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9081 2 203 1.20.1080.10
af_A0A2R8QLW2_4_252_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9072 2 203 1.20.1080.10
af_A0A1D6J0S8_31_279_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.907 2 204 1.20.1080.10
af_A4I001_41_293_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9066 1 204 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A1H1S6V7-F1-model_v4 Aquaporin Z 0.9753 2 206 GO:0015267
GO:0016020
AF-A0A7Y5NEI9-F1-model_v4 Aquaporin 0.9726 1 207 GO:0005737
GO:0012505
GO:0015250
GO:0016020
GO:0043231
AF-A0A7Y4T2A6-F1-model_v4 Porin 0.9726 2 203 GO:0005886
GO:0015250
AF-K6V945-F1-model_v4 Aquaporin Z 0.972 2 207 GO:0015267
GO:0016020
AF-A0A0Q9DDB6-F1-model_v4 deleted 0.9685 2 205

Map