F426526

General Info

Members Datasets Scaffolds Average Seq Length
373 273 360 223

Family's Representative Sequence

Representative Sequence 3300053117|Ga0500593_000250|Ga0500593_000250_19550_20251
Length 228
Sequence MNEPVHIKRVTSRATSKTPAPSGKKKTTRTNDPERTQANILAVAEAEFGEKGLAGARIDEIAAATNTSKRFGSKEGLYLAVLEEAYRRVRDVEAELHLQDLTPEEALRRLVAFTFDHHLHHENYIRLVMSENIHRGEYLAQSPRIQELNVPAIAAIKNLYERGVKAGTFRKGLNPIDIHASISALSFFNVSNRHTFSLIFKLDMNSPTYITARREHVVEMIVRFVRKT

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2643221570 Acidovorax sp. Root568 Isolate Unclassified
4 2643221596 Acidovorax sp. Root70 Isolate Unclassified
5 2643221652 Acidovorax sp. Root402 Isolate Unclassified
6 2643221717 Acidovorax sp. Root267 Isolate Unclassified
7 2738543013 Variovorax sp. BT01 Isolate Unclassified
8 2821131069 Duganella sp. 1224 Isolate Unclassified
9 2842733646 Variovorax sp. R-72446 Isolate Unclassified
10 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
11 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
12 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
13 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
14 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
168 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
173 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
174 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
177 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
208 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
222 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
229 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
230 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
231 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
245 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
246 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
250 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
251 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
261 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
262 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
263 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
264 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
265 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
266 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
267 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
268 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
269 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
270 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
271 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
272 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
273 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.51
Metatranscriptomes 0
Isolates 3.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.45
Nodule 0
Rhizoplane 1.88
Rhizosphere 67.56
Stem 0
Stem Tuber 0
Unclassified 9.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_8477249 2162886012 Bacteria 1196
2 JGI25159J45721_1013944 3300002987 Bacteria 1836
3 JGI25153J46596_10027494 3300003215 Bacteria 1991
4 rootL2_10116331 3300003322 Bacteria 1534
5 Ga0055536_1028981 3300003781 Bacteria 1496
6 Ga0055534_1000530 3300003784 Bacteria 20526
7 Ga0055530_10002389 3300003791 Bacteria 12160
8 Ga0055540_1006756 3300003792 Bacteria 4486
9 Ga0055531_10000281 3300003794 Bacteria 51971
10 Ga0055531_10008193 3300003794 Bacteria 5563
11 Ga0065165_1000192 3300005262 Bacteria 106862
12 Ga0065165_1011135 3300005262 Bacteria 3794
13 Ga0065165_1027648 3300005262 Bacteria 1844
14 Ga0065715_10319995 3300005293 Bacteria 1004
15 Ga0070658_10452261 3300005327 Bacteria 1107
16 Ga0070690_100043980 3300005330 Bacteria 2834
17 Ga0070670_100029231 3300005331 Bacteria 4743
18 Ga0070670_100242257 3300005331 Bacteria 1570
19 Ga0068869_100024432 3300005334 Bacteria 4186
20 Ga0070666_10004700 3300005335 Bacteria 8344
21 Ga0070689_100216918 3300005340 Bacteria 1568
22 Ga0070687_100165341 3300005343 Bacteria 1312
23 Ga0070668_100049584 3300005347 Bacteria 3230
24 Ga0070669_100026225 3300005353 Bacteria 4192
25 Ga0070675_100000772 3300005354 Bacteria 22339
26 Ga0070671_100003449 3300005355 Bacteria 12337
27 Ga0070674_100330193 3300005356 Bacteria 1225
28 Ga0070673_100007674 3300005364 Bacteria 7137
29 Ga0070688_100011377 3300005365 Bacteria 4943
30 Ga0070667_100007507 3300005367 Bacteria 9043
31 Ga0070709_10445303 3300005434 Bacteria 975
32 Ga0070700_100037542 3300005441 Bacteria 2947
33 Ga0070708_100028056 3300005445 Bacteria 4839
34 Ga0070663_100365192 3300005455 Bacteria 1172
35 Ga0070678_100001367 3300005456 Bacteria 12969
36 Ga0070662_100084585 3300005457 Bacteria 2370
37 Ga0068867_100006149 3300005459 Bacteria 8500
38 Ga0070685_10019694 3300005466 Bacteria 3645
39 Ga0070706_100000680 3300005467 Bacteria 38488
40 Ga0070707_100182560 3300005468 Bacteria 2045
41 Ga0070698_100546082 3300005471 Bacteria 1098
42 Ga0070672_100093084 3300005543 Bacteria 2434
43 Ga0070686_100058661 3300005544 Bacteria 2477
44 Ga0070686_100584508 3300005544 Bacteria 878
45 Ga0070664_100390120 3300005564 Bacteria 1272
46 Ga0070702_100065538 3300005615 Bacteria 2128
47 Ga0068852_100045658 3300005616 Bacteria 3728
48 Ga0068852_100062268 3300005616 Bacteria 3245
49 Ga0068859_100006800 3300005617 Bacteria 11622
50 Ga0068859_100246634 3300005617 Bacteria 1876
51 Ga0068864_100000270 3300005618 Bacteria 46170
52 Ga0068864_100195282 3300005618 Bacteria 1857
53 Ga0068866_10397951 3300005718 Bacteria 887
54 Ga0068861_100037832 3300005719 Bacteria 3588
55 Ga0068861_100193452 3300005719 Bacteria 1702
56 Ga0068851_10033125 3300005834 Bacteria 2574
57 Ga0068863_100000679 3300005841 Bacteria 34412
58 Ga0068863_100029648 3300005841 Bacteria 5223
59 Ga0068858_100000225 3300005842 Bacteria 61439
60 Ga0068862_100127558 3300005844 Bacteria 2247
61 Ga0068862_100265059 3300005844 Bacteria 1569
62 Ga0081455_10039295 3300005937 Bacteria 4183
63 Ga0075365_10102304 3300006038 Bacteria 1963
64 Ga0075365_10219618 3300006038 Bacteria 1333
65 Ga0075365_10465851 3300006038 Bacteria 893
66 Ga0075368_10002604 3300006042 Bacteria 5915
67 Ga0075363_100030292 3300006048 Bacteria 2800
68 Ga0075364_10064254 3300006051 Bacteria 2409
69 Ga0075362_10102556 3300006177 Bacteria 1339
70 Ga0075362_10173773 3300006177 Bacteria 1042
71 Ga0075362_10218154 3300006177 Bacteria 932
72 Ga0075367_10010157 3300006178 Bacteria 4938
73 Ga0075367_10094112 3300006178 Bacteria 1826
74 Ga0075369_10150011 3300006186 Bacteria 1065
75 Ga0075366_10006288 3300006195 Bacteria 6496
76 Ga0075366_10027807 3300006195 Bacteria 3319
77 Ga0075366_10043131 3300006195 Bacteria 2672
78 Ga0075366_10107824 3300006195 Bacteria 1675
79 Ga0075366_10121419 3300006195 Bacteria 1575
80 Ga0075366_10245859 3300006195 Bacteria 1091
81 Ga0097621_100014089 3300006237 Bacteria 5976
82 Ga0075370_10009589 3300006353 Bacteria 5034
83 Ga0075370_10031735 3300006353 Bacteria 2950
84 Ga0075370_10118570 3300006353 Bacteria 1540
85 Ga0075430_100119424 3300006846 Bacteria 2197
86 Ga0075429_100180358 3300006880 Bacteria 1851
87 Ga0068865_100003419 3300006881 Bacteria 9497
88 Ga0068865_100434033 3300006881 Bacteria 1083
89 Ga0097620_100006800 3300006931 Bacteria 11622
90 Ga0097620_100246616 3300006931 Bacteria 1876
91 Ga0105243_10416603 3300009148 Bacteria 1252
92 Ga0105248_10001412 3300009177 Bacteria 26839
93 Ga0105248_10052904 3300009177 Bacteria 4556
94 Ga0105248_10272844 3300009177 Bacteria 1905
95 Ga0105237_10560959 3300009545 Bacteria 1149
96 Ga0105237_11039493 3300009545 Bacteria 826
97 Ga0105238_10005024 3300009551 Bacteria 13078
98 Ga0105249_10291018 3300009553 Bacteria 1635
99 Ga0157374_10098434 3300013296 Bacteria 2800
100 Ga0157378_10001679 3300013297 Bacteria 19946
101 Ga0157378_10388759 3300013297 Bacteria 1372
102 Ga0163162_10001712 3300013306 Bacteria 20568
103 Ga0163162_10006036 3300013306 Bacteria 11727
104 Ga0157375_10004784 3300013308 Bacteria 11770
105 Ga0157375_10510818 3300013308 Bacteria 1365
106 Ga0163163_10004407 3300014325 Bacteria 11999
107 Ga0163163_10235992 3300014325 Bacteria 1878
108 Ga0157380_10058691 3300014326 Bacteria 3068
109 Ga0157380_10106623 3300014326 Bacteria 2345
110 Ga0157379_10082372 3300014968 Bacteria 2883
111 Ga0157379_10119072 3300014968 Bacteria 2375
112 Ga0157376_10104115 3300014969 Bacteria 2486
113 Ga0157376_10883307 3300014969 Bacteria 911
114 Ga0213871_10007129 3300021441 Bacteria 2402
115 Ga0209673_1005024 3300025273 Bacteria 6831
116 Ga0209130_1001418 3300025284 Bacteria 15969
117 Ga0209675_1000811 3300025291 Bacteria 20589
118 Ga0209676_1002690 3300025292 Bacteria 12026
119 Ga0209564_1042314 3300025295 Bacteria 1210
120 Ga0209758_1001874 3300025297 Bacteria 23048
121 Ga0209050_1000029 3300025298 Bacteria 465801
122 Ga0207426_1040619 3300025302 Bacteria 1448
123 Ga0209051_1000172 3300025303 Bacteria 117180
124 Ga0209051_1006266 3300025303 Bacteria 6742
125 Ga0209257_1000015 3300025304 Bacteria 908141
126 Ga0209257_1000108 3300025304 Bacteria 240229
127 Ga0209257_1000493 3300025304 Bacteria 71002
128 Ga0209257_1004206 3300025304 Bacteria 11418
129 Ga0209257_1009628 3300025304 Bacteria 5117
130 Ga0207656_10018663 3300025321 Bacteria 2734
131 Ga0207688_10273497 3300025901 Bacteria 1028
132 Ga0207680_10000416 3300025903 Bacteria 20261
133 Ga0207645_10002645 3300025907 Bacteria 13947
134 Ga0207645_10119018 3300025907 Bacteria 1713
135 Ga0207643_10082035 3300025908 Bacteria 1869
136 Ga0207705_10390906 3300025909 Bacteria 1075
137 Ga0207684_10001213 3300025910 Bacteria 28693
138 Ga0207662_10236151 3300025918 Bacteria 1195
139 Ga0207646_10319592 3300025922 Bacteria 1403
140 Ga0207681_10181500 3300025923 Bacteria 1603
141 Ga0207694_10017443 3300025924 Bacteria 5427
142 Ga0207694_10770589 3300025924 Bacteria 812
143 Ga0207650_10019320 3300025925 Bacteria 4785
144 Ga0207650_10200872 3300025925 Bacteria 1597
145 Ga0207659_10000337 3300025926 Bacteria 28208
146 Ga0207644_10000543 3300025931 Bacteria 24519
147 Ga0207706_10125540 3300025933 Bacteria 2257
148 Ga0207709_10014788 3300025935 Bacteria 4315
149 Ga0207670_10181459 3300025936 Bacteria 1586
150 Ga0207669_10177988 3300025937 Bacteria 1521
151 Ga0207704_10414626 3300025938 Bacteria 1066
152 Ga0207691_10014458 3300025940 Bacteria 7525
153 Ga0207711_10000843 3300025941 Bacteria 29642
154 Ga0207711_10299562 3300025941 Bacteria 1483
155 Ga0207689_10084482 3300025942 Bacteria 2609
156 Ga0207651_10005653 3300025960 Bacteria 6447
157 Ga0207658_10018787 3300025986 Bacteria 4778
158 Ga0207677_10012916 3300026023 Bacteria 4822
159 Ga0207677_10429704 3300026023 Bacteria 1127
160 Ga0207703_10000408 3300026035 Bacteria 45772
161 Ga0207639_10558162 3300026041 Bacteria 1052
162 Ga0207678_10187797 3300026067 Bacteria 1766
163 Ga0207678_10343547 3300026067 Bacteria 1286
164 Ga0207708_10034069 3300026075 Bacteria 3872
165 Ga0207708_10135202 3300026075 Bacteria 1930
166 Ga0207641_10002842 3300026088 Bacteria 15737
167 Ga0207641_10031669 3300026088 Bacteria 4387
168 Ga0207648_10006743 3300026089 Bacteria 11389
169 Ga0207648_10055399 3300026089 Bacteria 3461
170 Ga0207676_10000269 3300026095 Bacteria 45280
171 Ga0207676_10081765 3300026095 Bacteria 2625
172 Ga0207676_10277193 3300026095 Bacteria 1521
173 Ga0207675_100035344 3300026118 Bacteria 4661
174 Ga0207675_100093216 3300026118 Bacteria 2833
175 Ga0207683_10001051 3300026121 Bacteria 25171
176 Ga0207698_10017202 3300026142 Bacteria 4898
177 Ga0209813_10004416 3300027866 Bacteria 3358
178 Ga0209974_10001122 3300027876 Bacteria 9505
179 Ga0268265_10501790 3300028380 Bacteria 1143
180 Ga0268265_10674096 3300028380 Bacteria 996
181 Ga0268264_10034183 3300028381 Bacteria 4180
182 Ga0268264_10197095 3300028381 Bacteria 1839
183 Ga0307515_10000013 3300028794 Bacteria 568456
184 Ga0307515_10000239 3300028794 Bacteria 135971
185 Ga0307515_10033953 3300028794 Bacteria 8376
186 Ga0307515_10076790 3300028794 Bacteria 4423
187 Ga0307511_10000001 3300030521 Bacteria 206079
188 Ga0307511_10003076 3300030521 Bacteria 17215
189 Ga0307513_10046191 3300031456 Bacteria 4752
190 Ga0307509_10121081 3300031507 Bacteria 2594
191 Ga0307408_100369941 3300031548 Bacteria 1222
192 Ga0307408_100920432 3300031548 Bacteria 801
193 Ga0307514_10001361 3300031649 Bacteria 30951
194 Ga0307516_10000705 3300031730 Bacteria 45448
195 Ga0307406_10000278 3300031901 Bacteria 30154
196 Ga0307412_10377442 3300031911 Bacteria 1147
197 Ga0307412_10578970 3300031911 Bacteria 947
198 Ga0307416_100482162 3300032002 Bacteria 1300
199 Ga0307411_10236305 3300032005 Bacteria 1428
200 Ga0307510_10023712 3300033180 Bacteria 7108
201 Ga0307510_10144733 3300033180 Bacteria 2012
202 Ga0373932_0013941 3300035112 Bacteria 2011
203 Ga0373931_0056689 3300035691 Bacteria 2100
204 Ga0373935_0228773 3300035692 Bacteria 1294
205 Ga0373927_0137564 3300035695 Bacteria 1597
206 Ga0373925_0002569 3300037068 Bacteria 14454
207 Ga0373925_0505469 3300037068 Bacteria 992
208 Ga0395899_0006012 3300037312 Bacteria 9421
209 Ga0395900_0020080 3300037418 Bacteria 6815
210 Ga0395898_0206681 3300037466 Bacteria 1873
211 Ga0395905_0014961 3300037471 Bacteria 7399
212 Ga0395905_0062024 3300037471 Bacteria 3497
213 Ga0395901_0406006 3300038443 Bacteria 1399
214 Ga0395901_0790050 3300038443 Bacteria 939
215 Ga0436360_1345034 3300039438 Bacteria 3538
216 Ga0436361_0535480 3300039447 Bacteria 1333
217 Ga0436363_1712103 3300039450 Bacteria 944
218 Ga0439439_0024695 3300041406 Bacteria 1509
219 Ga0451798_0407693 3300041458 Bacteria 996
220 Ga0451853_1934982 3300041512 Bacteria 961
221 Ga0439445_0006557 3300042004 Bacteria 2678
222 Ga0439445_0124872 3300042004 Bacteria 740
223 Ga0439449_0000091 3300042007 Bacteria 29348
224 Ga0439462_0010996 3300042015 Bacteria 2300
225 Ga0450911_000074 3300042115 Bacteria 41259
226 Ga0450898_003764 3300042134 Bacteria 2199
227 Ga0439434_0029557 3300042435 Bacteria 1661
228 Ga0439464_0025663 3300042439 Bacteria 1632
229 Ga0450893_0000665 3300042532 Bacteria 4944
230 Ga0451577_0003070 3300042876 Bacteria 18890
231 Ga0451577_0381673 3300042876 Bacteria 1279
232 Ga0453683_0023502 3300044673 Bacteria 3928
233 Ga0453684_0009366 3300044712 Bacteria 17157
234 Ga0453684_0103234 3300044712 Bacteria 3484
235 Ga0466957_0343700 3300044842 Bacteria 1011
236 Ga0451576_0006443 3300045051 Bacteria 14393
237 Ga0451576_0027515 3300045051 Bacteria 6105
238 Ga0451576_0059345 3300045051 Bacteria 3994
239 Ga0451576_0141870 3300045051 Bacteria 2505
240 Ga0451576_0231287 3300045051 Bacteria 1931
241 Ga0451576_0372790 3300045051 Bacteria 1496
242 Ga0495629_0156247 3300046459 Bacteria 1585
243 Ga0495638_0309992 3300046460 Bacteria 847
244 Ga0495653_0001078 3300046463 Bacteria 21050
245 Ga0495650_0002079 3300046471 Bacteria 17300
246 Ga0495580_0007236 3300046472 Bacteria 8924
247 Ga0495582_0001025 3300046473 Bacteria 15634
248 Ga0495584_0028331 3300046491 Bacteria 2837
249 Ga0495594_0015973 3300046499 Bacteria 3950
250 Ga0495594_0021304 3300046499 Bacteria 3459
251 Ga0495607_0000862 3300046501 Bacteria 28399
252 Ga0495583_0023677 3300046506 Bacteria 3101
253 Ga0495606_0221366 3300046507 Bacteria 1066
254 Ga0495610_0000938 3300046512 Bacteria 27065
255 Ga0495610_0002815 3300046512 Bacteria 14197
256 Ga0495616_0000034 3300046513 Bacteria 129394
257 Ga0495630_0021314 3300046517 Bacteria 4785
258 Ga0495630_0027564 3300046517 Bacteria 4216
259 Ga0495632_0000636 3300046519 Bacteria 32294
260 Ga0495632_0000936 3300046519 Bacteria 25571
261 Ga0495643_0000028 3300046522 Bacteria 262886
262 Ga0495643_0000868 3300046522 Bacteria 32233
263 Ga0495648_0010756 3300046524 Bacteria 6948
264 Ga0495666_0007400 3300046526 Bacteria 5502
265 Ga0495642_0005483 3300046528 Bacteria 4872
266 Ga0495652_0012458 3300046529 Bacteria 7666
267 Ga0495654_0046630 3300046530 Bacteria 2134
268 Ga0495665_0003099 3300046531 Bacteria 8998
269 Ga0495586_0008567 3300046535 Bacteria 5444
270 Ga0495587_0016771 3300046536 Bacteria 4555
271 Ga0495598_0019000 3300046537 Bacteria 1795
272 Ga0495609_0005071 3300046538 Bacteria 7023
273 Ga0495609_0014239 3300046538 Bacteria 3743
274 Ga0495609_0064568 3300046538 Bacteria 1615
275 Ga0495621_0159682 3300046539 Bacteria 891
276 Ga0495597_0000072 3300046542 Bacteria 87914
277 Ga0495597_0000694 3300046542 Bacteria 27099
278 Ga0495656_0039008 3300046615 Bacteria 1971
279 Ga0495668_0000452 3300046616 Bacteria 52507
280 Ga0495668_0000590 3300046616 Bacteria 44130
281 Ga0495668_0014425 3300046616 Bacteria 4633
282 Ga0495634_0007168 3300046642 Bacteria 8406
283 Ga0495625_0003267 3300046660 Bacteria 16384
284 Ga0495625_0010699 3300046660 Bacteria 7558
285 Ga0495625_0018651 3300046660 Bacteria 5408
286 Ga0495661_0000082 3300046665 Bacteria 116600
287 Ga0495661_0000569 3300046665 Bacteria 38310
288 Ga0495588_0006854 3300046674 Bacteria 5160
289 Ga0495623_0004565 3300046679 Bacteria 9097
290 Ga0495646_0147134 3300046680 Bacteria 1313
291 Ga0495658_0146265 3300046683 Bacteria 1448
292 Ga0495669_0001658 3300046684 Bacteria 9137
293 Ga0495649_0001399 3300046694 Bacteria 18205
294 Ga0495589_0002690 3300046794 Bacteria 9828
295 Ga0495581_0210226 3300047315 Bacteria 1138
296 Ga0495604_0013449 3300047317 Bacteria 6521
297 Ga0495672_0000212 3300047320 Bacteria 83026
298 Ga0495680_0170792 3300047322 Bacteria 1574
299 Ga0495675_0001518 3300047444 Bacteria 14026
300 Ga0495675_0101313 3300047444 Bacteria 1802
301 Ga0495677_0002989 3300047445 Bacteria 6576
302 Ga0495593_0026762 3300047673 Bacteria 3181
303 Ga0495615_0002514 3300048090 Bacteria 2949
304 Ga0495615_0074492 3300048090 Bacteria 921
305 Ga0495626_0002360 3300048091 Bacteria 13261
306 Ga0496100_0474493 3300048903 Bacteria 961
307 Ga0496104_0251153 3300048907 Bacteria 1681
308 Ga0496106_0604314 3300048909 Bacteria 878
309 Ga0496109_0155974 3300048912 Bacteria 2138
310 Ga0496113_0022239 3300048916 Bacteria 4482
311 Ga0496114_0534893 3300048917 Bacteria 1036
312 Ga0496121_0003833 3300048924 Bacteria 20921
313 Ga0496122_0000255 3300048925 Bacteria 120384
314 Ga0496122_0103379 3300048925 Bacteria 1896
315 Ga0496123_0001210 3300048926 Bacteria 37670
316 Ga0496124_0073837 3300048927 Bacteria 2821
317 Ga0496124_0094395 3300048927 Bacteria 2433
318 Ga0496125_0002317 3300048928 Bacteria 25097
319 Ga0496125_0016204 3300048928 Bacteria 7165
320 Ga0496126_0019342 3300048929 Bacteria 6708
321 Ga0495678_000029 3300049459 Bacteria 219803
322 Ga0501292_002050 3300049515 Bacteria 2559
323 Ga0501303_007357 3300049526 Bacteria 980
324 Ga0501039_0544493 3300049575 Bacteria 911
325 Ga0501043_0316810 3300049579 Bacteria 1190
326 Ga0501252_000940 3300049682 Bacteria 2522
327 Ga0501257_057085 3300049686 Bacteria 981
328 Ga0501265_000976 3300049762 Bacteria 3221
329 nmdc:mga03683_151002_c1 3300050489 Bacteria 1048
330 nmdc:mga03683_211883_c1 3300050489 Bacteria 892
331 nmdc:mga03683_64719_c1 3300050489 Bacteria 1552
332 nmdc:mga03n38_64242_c1 3300050490 Bacteria 1680
333 nmdc:mga00v17_139313_c1 3300050491 Bacteria 1555
334 nmdc:mga0yw44_149560_c1 3300050492 Bacteria 1522
335 nmdc:mga0k408_109962_c1 3300050493 Bacteria 1629
336 nmdc:mga0k408_120296_c1 3300050493 Bacteria 1555
337 nmdc:mga0k408_19795_c1 3300050493 Bacteria 3765
338 nmdc:mga0k408_239158_c1 3300050493 Bacteria 1084
339 nmdc:mga0k408_39442_c1 3300050493 Bacteria 2713
340 nmdc:mga06z11_148706_c1 3300050494 Bacteria 1330
341 nmdc:mga06z11_299741_c1 3300050494 Bacteria 955
342 nmdc:mga04h51_11211_c1 3300050495 Bacteria 2483
343 nmdc:mga07m45_101186_c1 3300050496 Bacteria 1655
344 nmdc:mga07m45_118059_c1 3300050496 Bacteria 1531
345 nmdc:mga07m45_5034_c1 3300050496 Bacteria 6530
346 nmdc:mga07m45_6292_c1 3300050496 Bacteria 5995
347 nmdc:mga0sz30_114926_c1 3300050516 Bacteria 1181
348 Ga0500646_0032876 3300053090 Bacteria 1433
349 Ga0500583_0003461 3300053092 Bacteria 4966
350 Ga0500555_045387 3300053103 Bacteria 1215
351 Ga0500562_046315 3300053108 Bacteria 1159
352 Ga0500572_000112 3300053111 Bacteria 27077
353 Ga0500593_000250 3300053117 Bacteria 22072
354 Ga0500595_081467 3300053119 Bacteria 946
355 Ga0500642_0003106 3300053130 Bacteria 4972
356 Ga0500588_0069360 3300053146 Bacteria 1152
357 Ga0500590_130443 3300053148 Bacteria 1164
358 Ga0500604_0012007 3300053151 Bacteria 2334
359 Ga0500616_0178166 3300053153 Bacteria 959
360 Ga0500636_0019039 3300053177 Bacteria 4062

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031730 Ga0307516_10000705 Ga0307516_1000070525 196
2 3300037068 Ga0373925_0002569 Ga0373925_0002569_13076_13666 196
3 3300042004 Ga0439445_0124872 Ga0439445_0124872_136_726 196
4 3300046522 Ga0495643_0000028 Ga0495643_0000028_227659_228345 196
5 3300046683 Ga0495658_0146265 Ga0495658_0146265_561_1151 196
6 3300047320 Ga0495672_0000212 Ga0495672_0000212_79041_79727 196
7 3300049459 Ga0495678_000029 Ga0495678_000029_8624_9310 196
8 3300046460 Ga0495638_0309992 Ga0495638_0309992_20_706 197
9 3300046512 Ga0495610_0000938 Ga0495610_0000938_19821_20507 197
10 3300046524 Ga0495648_0010756 Ga0495648_0010756_4778_5464 197
11 3300046538 Ga0495609_0005071 Ga0495609_0005071_1758_2444 197
12 3300046660 Ga0495625_0018651 Ga0495625_0018651_2909_3595 197
13 3300046694 Ga0495649_0001399 Ga0495649_0001399_12424_13110 197
14 3300009545 Ga0105237_11039493 Ga0105237_110394932 205
15 3300046539 Ga0495621_0159682 Ga0495621_0159682_35_652 205
16 3300046616 Ga0495668_0000590 Ga0495668_0000590_37640_38263 206
17 3300005434 Ga0070709_10445303 Ga0070709_104453032 207
18 3300053103 Ga0500555_045387 Ga0500555_045387_29_715 207
19 3300053108 Ga0500562_046315 Ga0500562_046315_203_919 207
20 3300053151 Ga0500604_0012007 Ga0500604_0012007_1491_2177 207
21 3300026023 Ga0207677_10429704 Ga0207677_104297043 208
22 3300030521 Ga0307511_10000001 Ga0307511_1000000129 208
23 3300047322 Ga0495680_0170792 Ga0495680_0170792_11_643 208
24 3300050496 nmdc:mga07m45_118059_c1 nmdc:mga07m45_118059_c1_648_1337 208
25 3300053092 Ga0500583_0003461 Ga0500583_0003461_633_1319 208
26 3300006038 Ga0075365_10465851 Ga0075365_104658511 209
27 3300006195 Ga0075366_10107824 Ga0075366_101078242 209
28 3300035692 Ga0373935_0228773 Ga0373935_0228773_82_741 209
29 3300035695 Ga0373927_0137564 Ga0373927_0137564_828_1487 209
30 3300050493 nmdc:mga0k408_109962_c1 nmdc:mga0k408_109962_c1_507_1208 209
31 iso_pu_bacteria 3003665799 3003672609 209
32 3300003215 JGI25153J46596_10027494 JGI25153J46596_100274942 210
33 3300003791 Ga0055530_10002389 Ga0055530_100023897 210
34 3300003794 Ga0055531_10008193 Ga0055531_100081935 210
35 3300005262 Ga0065165_1000192 Ga0065165_100019255 210
36 3300005544 Ga0070686_100584508 Ga0070686_1005845081 210
37 3300006195 Ga0075366_10027807 Ga0075366_100278074 210
38 3300006353 Ga0075370_10009589 Ga0075370_100095895 210
39 3300025297 Ga0209758_1001874 Ga0209758_10018745 210
40 3300025298 Ga0209050_1000029 Ga0209050_1000029406 210
41 3300025304 Ga0209257_1000493 Ga0209257_100049356 210
42 3300037418 Ga0395900_0020080 Ga0395900_0020080_2621_3265 210
43 3300037471 Ga0395905_0014961 Ga0395905_0014961_2847_3491 210
44 3300038443 Ga0395901_0790050 Ga0395901_0790050_272_916 210
45 3300050493 nmdc:mga0k408_19795_c1 nmdc:mga0k408_19795_c1_787_1431 210
46 3300050496 nmdc:mga07m45_5034_c1 nmdc:mga07m45_5034_c1_2108_2752 210
47 3300006038 Ga0075365_10219618 Ga0075365_102196182 211
48 3300006042 Ga0075368_10002604 Ga0075368_100026043 211
49 3300006048 Ga0075363_100030292 Ga0075363_1000302923 211
50 3300006051 Ga0075364_10064254 Ga0075364_100642542 211
51 3300006177 Ga0075362_10102556 Ga0075362_101025562 211
52 3300006178 Ga0075367_10010157 Ga0075367_100101574 211
53 3300006186 Ga0075369_10150011 Ga0075369_101500112 211
54 3300006353 Ga0075370_10031735 Ga0075370_100317352 211
55 3300027866 Ga0209813_10004416 Ga0209813_100044163 211
56 3300050490 nmdc:mga03n38_64242_c1 nmdc:mga03n38_64242_c1_418_1083 211
57 3300050491 nmdc:mga00v17_139313_c1 nmdc:mga00v17_139313_c1_737_1402 211
58 3300050495 nmdc:mga04h51_11211_c1 nmdc:mga04h51_11211_c1_1581_2246 211
59 3300050496 nmdc:mga07m45_6292_c1 nmdc:mga07m45_6292_c1_1334_1999 211
60 3300050516 nmdc:mga0sz30_114926_c1 nmdc:mga0sz30_114926_c1_242_907 211
61 iso_pu_bacteria 2821131069 2821132165 211
62 3300006353 Ga0075370_10118570 Ga0075370_101185702 212
63 3300046471 Ga0495650_0002079 Ga0495650_0002079_12642_13343 212
64 3300046660 Ga0495625_0003267 Ga0495625_0003267_510_1211 212
65 3300050494 nmdc:mga06z11_299741_c1 nmdc:mga06z11_299741_c1_272_928 212
66 3300025304 Ga0209257_1009628 Ga0209257_10096284 213
67 3300028794 Ga0307515_10000239 Ga0307515_1000023964 213
68 iso_pu_bacteria 2842733646 2842735515 213
69 3300053146 Ga0500588_0069360 Ga0500588_0069360_54_725 214
70 3300053153 Ga0500616_0178166 Ga0500616_0178166_103_774 214
71 3300053177 Ga0500636_0019039 Ga0500636_0019039_1458_2135 214
72 3300005467 Ga0070706_100000680 Ga0070706_1000006807 215
73 3300005468 Ga0070707_100182560 Ga0070707_1001825603 215
74 3300006178 Ga0075367_10094112 Ga0075367_100941123 215
75 3300025910 Ga0207684_10001213 Ga0207684_100012135 215
76 3300025922 Ga0207646_10319592 Ga0207646_103195922 215
77 3300046463 Ga0495653_0001078 Ga0495653_0001078_13696_14346 215
78 3300046472 Ga0495580_0007236 Ga0495580_0007236_3054_3704 215
79 3300046473 Ga0495582_0001025 Ga0495582_0001025_10095_10745 215
80 3300046491 Ga0495584_0028331 Ga0495584_0028331_1489_2139 215
81 3300046499 Ga0495594_0015973 Ga0495594_0015973_1310_1960 215
82 3300046499 Ga0495594_0021304 Ga0495594_0021304_197_847 215
83 3300046506 Ga0495583_0023677 Ga0495583_0023677_213_863 215
84 3300046507 Ga0495606_0221366 Ga0495606_0221366_398_1048 215
85 3300046513 Ga0495616_0000034 Ga0495616_0000034_91510_92160 215
86 3300046517 Ga0495630_0021314 Ga0495630_0021314_949_1599 215
87 3300046519 Ga0495632_0000636 Ga0495632_0000636_23563_24213 215
88 3300046522 Ga0495643_0000868 Ga0495643_0000868_3286_3936 215
89 3300046526 Ga0495666_0007400 Ga0495666_0007400_2212_2862 215
90 3300046528 Ga0495642_0005483 Ga0495642_0005483_484_1134 215
91 3300046529 Ga0495652_0012458 Ga0495652_0012458_1865_2515 215
92 3300046530 Ga0495654_0046630 Ga0495654_0046630_670_1320 215
93 3300046531 Ga0495665_0003099 Ga0495665_0003099_7387_8037 215
94 3300046535 Ga0495586_0008567 Ga0495586_0008567_696_1346 215
95 3300046538 Ga0495609_0014239 Ga0495609_0014239_1954_2604 215
96 3300046538 Ga0495609_0064568 Ga0495609_0064568_263_913 215
97 3300046542 Ga0495597_0000694 Ga0495597_0000694_20269_20919 215
98 3300046616 Ga0495668_0014425 Ga0495668_0014425_2091_2741 215
99 3300046642 Ga0495634_0007168 Ga0495634_0007168_5302_5952 215
100 3300046660 Ga0495625_0010699 Ga0495625_0010699_5351_6001 215
101 3300046665 Ga0495661_0000082 Ga0495661_0000082_66888_67535 215
102 3300046674 Ga0495588_0006854 Ga0495588_0006854_3502_4152 215
103 3300046679 Ga0495623_0004565 Ga0495623_0004565_7418_8068 215
104 3300046684 Ga0495669_0001658 Ga0495669_0001658_581_1231 215
105 3300046794 Ga0495589_0002690 Ga0495589_0002690_8600_9250 215
106 3300047317 Ga0495604_0013449 Ga0495604_0013449_2971_3621 215
107 3300047444 Ga0495675_0001518 Ga0495675_0001518_9479_10129 215
108 3300048091 Ga0495626_0002360 Ga0495626_0002360_11157_11807 215
109 3300048903 Ga0496100_0474493 Ga0496100_0474493_290_937 215
110 3300048912 Ga0496109_0155974 Ga0496109_0155974_83_730 215
111 3300048916 Ga0496113_0022239 Ga0496113_0022239_3230_3877 215
112 3300048925 Ga0496122_0000255 Ga0496122_0000255_69878_70525 215
113 3300048925 Ga0496122_0103379 Ga0496122_0103379_22_669 215
114 3300048926 Ga0496123_0001210 Ga0496123_0001210_15431_16078 215
115 3300048927 Ga0496124_0073837 Ga0496124_0073837_1793_2440 215
116 3300048927 Ga0496124_0094395 Ga0496124_0094395_430_1077 215
117 3300048928 Ga0496125_0002317 Ga0496125_0002317_12424_13071 215
118 iso_pu_bacteria 2881101125 2881103684 215
119 3300005618 Ga0068864_100195282 Ga0068864_1001952822 216
120 3300005937 Ga0081455_10039295 Ga0081455_100392955 216
121 3300009545 Ga0105237_10560959 Ga0105237_105609592 216
122 3300014325 Ga0163163_10235992 Ga0163163_102359921 216
123 3300025907 Ga0207645_10002645 Ga0207645_100026453 216
124 3300026095 Ga0207676_10277193 Ga0207676_102771932 216
125 3300031507 Ga0307509_10121081 Ga0307509_101210812 216
126 3300031911 Ga0307412_10578970 Ga0307412_105789701 216
127 3300032002 Ga0307416_100482162 Ga0307416_1004821621 216
128 3300035112 Ga0373932_0013941 Ga0373932_0013941_546_1196 216
129 3300035691 Ga0373931_0056689 Ga0373931_0056689_659_1309 216
130 3300037068 Ga0373925_0505469 Ga0373925_0505469_315_965 216
131 3300039450 Ga0436363_1712103 Ga0436363_1712103_34_687 216
132 3300046517 Ga0495630_0027564 Ga0495630_0027564_2573_3223 216
133 3300046536 Ga0495587_0016771 Ga0495587_0016771_2098_2754 216
134 3300046680 Ga0495646_0147134 Ga0495646_0147134_556_1212 216
135 3300047315 Ga0495581_0210226 Ga0495581_0210226_469_1125 216
136 3300047444 Ga0495675_0101313 Ga0495675_0101313_586_1242 216
137 3300047673 Ga0495593_0026762 Ga0495593_0026762_2363_3013 216
138 3300021441 Ga0213871_10007129 Ga0213871_100071292 217
139 3300030521 Ga0307511_10003076 Ga0307511_100030769 217
140 3300033180 Ga0307510_10023712 Ga0307510_100237125 217
141 3300039438 Ga0436360_1345034 Ga0436360_1345034_1648_2355 217
142 3300039447 Ga0436361_0535480 Ga0436361_0535480_32_739 217
143 3300053119 Ga0500595_081467 Ga0500595_081467_223_921 217
144 iso_pu_bacteria 2928115317 2928119775 217
145 3300005616 Ga0068852_100062268 Ga0068852_1000622682 218
146 3300046542 Ga0495597_0000072 Ga0495597_0000072_32493_33188 218
147 3300053111 Ga0500572_000112 Ga0500572_000112_12745_13413 218
148 3300053130 Ga0500642_0003106 Ga0500642_0003106_1640_2311 218
149 3300006038 Ga0075365_10102304 Ga0075365_101023042 219
150 3300009177 Ga0105248_10001412 Ga0105248_1000141222 219
151 3300013297 Ga0157378_10388759 Ga0157378_103887592 219
152 3300028794 Ga0307515_10033953 Ga0307515_100339535 219
153 3300031548 Ga0307408_100920432 Ga0307408_1009204321 219
154 3300041458 Ga0451798_0407693 Ga0451798_0407693_181_879 219
155 3300046512 Ga0495610_0002815 Ga0495610_0002815_3371_4045 219
156 3300046616 Ga0495668_0000452 Ga0495668_0000452_44786_45460 219
157 3300053117 Ga0500593_000250 Ga0500593_000250_19550_20251 219
158 3300053148 Ga0500590_130443 Ga0500590_130443_258_932 219
159 iso_pu_bacteria 2919704043 2919704392 219
160 3300005441 Ga0070700_100037542 Ga0070700_1000375423 220
161 3300005459 Ga0068867_100006149 Ga0068867_10000614910 220
162 3300005543 Ga0070672_100093084 Ga0070672_1000930841 220
163 3300005617 Ga0068859_100246634 Ga0068859_1002466341 220
164 3300005719 Ga0068861_100037832 Ga0068861_1000378323 220
165 3300005844 Ga0068862_100127558 Ga0068862_1001275583 220
166 3300006195 Ga0075366_10043131 Ga0075366_100431313 220
167 3300006881 Ga0068865_100003419 Ga0068865_1000034192 220
168 3300006931 Ga0097620_100246616 Ga0097620_1002466161 220
169 3300009148 Ga0105243_10416603 Ga0105243_104166032 220
170 3300009551 Ga0105238_10005024 Ga0105238_100050245 220
171 3300013297 Ga0157378_10001679 Ga0157378_100016794 220
172 3300013306 Ga0163162_10001712 Ga0163162_1000171213 220
173 3300014326 Ga0157380_10058691 Ga0157380_100586913 220
174 3300014968 Ga0157379_10119072 Ga0157379_101190723 220
175 3300025901 Ga0207688_10273497 Ga0207688_102734971 220
176 3300025907 Ga0207645_10119018 Ga0207645_101190182 220
177 3300025924 Ga0207694_10017443 Ga0207694_100174432 220
178 3300025935 Ga0207709_10014788 Ga0207709_100147885 220
179 3300025938 Ga0207704_10414626 Ga0207704_104146261 220
180 3300025940 Ga0207691_10014458 Ga0207691_100144586 220
181 3300025941 Ga0207711_10000843 Ga0207711_1000084324 220
182 3300026075 Ga0207708_10034069 Ga0207708_100340693 220
183 3300026089 Ga0207648_10055399 Ga0207648_100553992 220
184 3300026118 Ga0207675_100093216 Ga0207675_1000932163 220
185 3300028380 Ga0268265_10501790 Ga0268265_105017902 220
186 3300028381 Ga0268264_10034183 Ga0268264_100341833 220
187 3300031649 Ga0307514_10001361 Ga0307514_1000136117 220
188 3300045051 Ga0451576_0231287 Ga0451576_0231287_695_1366 220
189 3300050489 nmdc:mga03683_64719_c1 nmdc:mga03683_64719_c1_701_1414 220
190 3300050492 nmdc:mga0yw44_149560_c1 nmdc:mga0yw44_149560_c1_543_1241 220
191 3300050493 nmdc:mga0k408_39442_c1 nmdc:mga0k408_39442_c1_1049_1732 220
192 iso_pu_bacteria 2738543013 2739251559 220
193 3300041512 Ga0451853_1934982 Ga0451853_1934982_81_824 221
194 3300046501 Ga0495607_0000862 Ga0495607_0000862_26601_27281 221
195 3300046519 Ga0495632_0000936 Ga0495632_0000936_15782_16462 221
196 3300046665 Ga0495661_0000569 Ga0495661_0000569_12451_13131 221
197 3300047445 Ga0495677_0002989 Ga0495677_0002989_5353_6033 221
198 iso_pu_bacteria 2547132374 2548500437 221
199 iso_pu_bacteria 2643221596 2643992845 221
200 iso_pu_bacteria 2643221717 2644647016 221
201 3300028794 Ga0307515_10000013 Ga0307515_10000013423 222
202 3300028794 Ga0307515_10076790 Ga0307515_100767903 222
203 3300031911 Ga0307412_10377442 Ga0307412_103774422 222
204 3300042134 Ga0450898_003764 Ga0450898_003764_595_1278 222
205 3300042435 Ga0439434_0029557 Ga0439434_0029557_893_1576 222
206 3300042439 Ga0439464_0025663 Ga0439464_0025663_839_1522 222
207 3300044673 Ga0453683_0023502 Ga0453683_0023502_312_1001 222
208 3300045051 Ga0451576_0027515 Ga0451576_0027515_1502_2191 222
209 3300045051 Ga0451576_0059345 Ga0451576_0059345_1866_2558 222
210 3300049515 Ga0501292_002050 Ga0501292_002050_1369_2055 222
211 3300049526 Ga0501303_007357 Ga0501303_007357_63_749 222
212 3300049686 Ga0501257_057085 Ga0501257_057085_121_807 222
213 3300049762 Ga0501265_000976 Ga0501265_000976_843_1529 222
214 3300050493 nmdc:mga0k408_239158_c1 nmdc:mga0k408_239158_c1_400_1074 222
215 3300003322 rootL2_10116331 rootL2_101163312 223
216 3300003792 Ga0055540_1006756 Ga0055540_10067565 223
217 3300003794 Ga0055531_10000281 Ga0055531_1000028145 223
218 3300005262 Ga0065165_1011135 Ga0065165_10111352 223
219 3300005331 Ga0070670_100242257 Ga0070670_1002422571 223
220 3300005841 Ga0068863_100029648 Ga0068863_1000296484 223
221 3300006177 Ga0075362_10173773 Ga0075362_101737732 223
222 3300006195 Ga0075366_10121419 Ga0075366_101214192 223
223 3300006195 Ga0075366_10245859 Ga0075366_102458592 223
224 3300006846 Ga0075430_100119424 Ga0075430_1001194243 223
225 3300006880 Ga0075429_100180358 Ga0075429_1001803583 223
226 3300009177 Ga0105248_10272844 Ga0105248_102728443 223
227 3300025273 Ga0209673_1005024 Ga0209673_10050247 223
228 3300025302 Ga0207426_1040619 Ga0207426_10406192 223
229 3300025303 Ga0209051_1000172 Ga0209051_100017297 223
230 3300025304 Ga0209257_1000015 Ga0209257_1000015490 223
231 3300025304 Ga0209257_1000108 Ga0209257_1000108220 223
232 3300025925 Ga0207650_10200872 Ga0207650_102008721 223
233 3300026067 Ga0207678_10187797 Ga0207678_101877972 223
234 3300026088 Ga0207641_10031669 Ga0207641_100316693 223
235 3300026089 Ga0207648_10006743 Ga0207648_100067432 223
236 3300026095 Ga0207676_10081765 Ga0207676_100817652 223
237 3300031548 Ga0307408_100369941 Ga0307408_1003699412 223
238 3300033180 Ga0307510_10144733 Ga0307510_101447332 223
239 3300037312 Ga0395899_0006012 Ga0395899_0006012_6927_7613 223
240 3300037466 Ga0395898_0206681 Ga0395898_0206681_287_973 223
241 3300041406 Ga0439439_0024695 Ga0439439_0024695_609_1304 223
242 3300042004 Ga0439445_0006557 Ga0439445_0006557_1725_2423 223
243 3300042007 Ga0439449_0000091 Ga0439449_0000091_3447_4142 223
244 3300042015 Ga0439462_0010996 Ga0439462_0010996_1070_1759 223
245 3300042115 Ga0450911_000074 Ga0450911_000074_37013_37711 223
246 3300042876 Ga0451577_0381673 Ga0451577_0381673_401_1084 223
247 3300044712 Ga0453684_0103234 Ga0453684_0103234_464_1147 223
248 3300045051 Ga0451576_0006443 Ga0451576_0006443_10365_11048 223
249 3300048090 Ga0495615_0074492 Ga0495615_0074492_183_869 223
250 3300048924 Ga0496121_0003833 Ga0496121_0003833_17516_18214 223
251 3300048928 Ga0496125_0016204 Ga0496125_0016204_4612_5310 223
252 3300049682 Ga0501252_000940 Ga0501252_000940_1423_2106 223
253 3300050489 nmdc:mga03683_151002_c1 nmdc:mga03683_151002_c1_247_933 223
254 3300050489 nmdc:mga03683_211883_c1 nmdc:mga03683_211883_c1_39_725 223
255 3300053090 Ga0500646_0032876 Ga0500646_0032876_508_1278 223
256 2162886012 MBSR1b_contig_8477249 MBSR1b_0907.00000570 224
257 3300002987 JGI25159J45721_1013944 JGI25159J45721_10139443 224
258 3300003781 Ga0055536_1028981 Ga0055536_10289812 224
259 3300003784 Ga0055534_1000530 Ga0055534_10005308 224
260 3300005262 Ga0065165_1027648 Ga0065165_10276482 224
261 3300005293 Ga0065715_10319995 Ga0065715_103199952 224
262 3300005327 Ga0070658_10452261 Ga0070658_104522612 224
263 3300005330 Ga0070690_100043980 Ga0070690_1000439802 224
264 3300005331 Ga0070670_100029231 Ga0070670_1000292312 224
265 3300005334 Ga0068869_100024432 Ga0068869_1000244323 224
266 3300005335 Ga0070666_10004700 Ga0070666_100047004 224
267 3300005340 Ga0070689_100216918 Ga0070689_1002169182 224
268 3300005343 Ga0070687_100165341 Ga0070687_1001653412 224
269 3300005347 Ga0070668_100049584 Ga0070668_1000495842 224
270 3300005353 Ga0070669_100026225 Ga0070669_1000262252 224
271 3300005354 Ga0070675_100000772 Ga0070675_1000007723 224
272 3300005355 Ga0070671_100003449 Ga0070671_1000034495 224
273 3300005356 Ga0070674_100330193 Ga0070674_1003301932 224
274 3300005364 Ga0070673_100007674 Ga0070673_1000076747 224
275 3300005365 Ga0070688_100011377 Ga0070688_1000113774 224
276 3300005367 Ga0070667_100007507 Ga0070667_1000075078 224
277 3300005445 Ga0070708_100028056 Ga0070708_1000280566 224
278 3300005455 Ga0070663_100365192 Ga0070663_1003651922 224
279 3300005456 Ga0070678_100001367 Ga0070678_1000013676 224
280 3300005457 Ga0070662_100084585 Ga0070662_1000845852 224
281 3300005466 Ga0070685_10019694 Ga0070685_100196943 224
282 3300005471 Ga0070698_100546082 Ga0070698_1005460821 224
283 3300005544 Ga0070686_100058661 Ga0070686_1000586612 224
284 3300005564 Ga0070664_100390120 Ga0070664_1003901201 224
285 3300005615 Ga0070702_100065538 Ga0070702_1000655382 224
286 3300005616 Ga0068852_100045658 Ga0068852_1000456583 224
287 3300005617 Ga0068859_100006800 Ga0068859_1000068005 224
288 3300005618 Ga0068864_100000270 Ga0068864_10000027019 224
289 3300005718 Ga0068866_10397951 Ga0068866_103979511 224
290 3300005719 Ga0068861_100193452 Ga0068861_1001934522 224
291 3300005834 Ga0068851_10033125 Ga0068851_100331252 224
292 3300005841 Ga0068863_100000679 Ga0068863_10000067917 224
293 3300005842 Ga0068858_100000225 Ga0068858_10000022519 224
294 3300005844 Ga0068862_100265059 Ga0068862_1002650592 224
295 3300006177 Ga0075362_10218154 Ga0075362_102181542 224
296 3300006195 Ga0075366_10006288 Ga0075366_100062886 224
297 3300006237 Ga0097621_100014089 Ga0097621_1000140894 224
298 3300006881 Ga0068865_100434033 Ga0068865_1004340331 224
299 3300006931 Ga0097620_100006800 Ga0097620_1000068007 224
300 3300009177 Ga0105248_10052904 Ga0105248_100529043 224
301 3300009553 Ga0105249_10291018 Ga0105249_102910181 224
302 3300013296 Ga0157374_10098434 Ga0157374_100984342 224
303 3300013306 Ga0163162_10006036 Ga0163162_100060365 224
304 3300013308 Ga0157375_10004784 Ga0157375_100047842 224
305 3300013308 Ga0157375_10510818 Ga0157375_105108182 224
306 3300014325 Ga0163163_10004407 Ga0163163_100044072 224
307 3300014326 Ga0157380_10106623 Ga0157380_101066232 224
308 3300014968 Ga0157379_10082372 Ga0157379_100823722 224
309 3300014969 Ga0157376_10104115 Ga0157376_101041153 224
310 3300014969 Ga0157376_10883307 Ga0157376_108833071 224
311 3300025284 Ga0209130_1001418 Ga0209130_10014186 224
312 3300025291 Ga0209675_1000811 Ga0209675_100081112 224
313 3300025292 Ga0209676_1002690 Ga0209676_10026907 224
314 3300025295 Ga0209564_1042314 Ga0209564_10423141 224
315 3300025303 Ga0209051_1006266 Ga0209051_10062667 224
316 3300025304 Ga0209257_1004206 Ga0209257_100420613 224
317 3300025321 Ga0207656_10018663 Ga0207656_100186632 224
318 3300025903 Ga0207680_10000416 Ga0207680_100004165 224
319 3300025908 Ga0207643_10082035 Ga0207643_100820352 224
320 3300025909 Ga0207705_10390906 Ga0207705_103909062 224
321 3300025918 Ga0207662_10236151 Ga0207662_102361512 224
322 3300025923 Ga0207681_10181500 Ga0207681_101815002 224
323 3300025924 Ga0207694_10770589 Ga0207694_107705891 224
324 3300025925 Ga0207650_10019320 Ga0207650_100193204 224
325 3300025926 Ga0207659_10000337 Ga0207659_100003378 224
326 3300025931 Ga0207644_10000543 Ga0207644_1000054311 224
327 3300025933 Ga0207706_10125540 Ga0207706_101255402 224
328 3300025936 Ga0207670_10181459 Ga0207670_101814591 224
329 3300025937 Ga0207669_10177988 Ga0207669_101779882 224
330 3300025941 Ga0207711_10299562 Ga0207711_102995622 224
331 3300025942 Ga0207689_10084482 Ga0207689_100844822 224
332 3300025960 Ga0207651_10005653 Ga0207651_100056537 224
333 3300025986 Ga0207658_10018787 Ga0207658_100187872 224
334 3300026023 Ga0207677_10012916 Ga0207677_100129163 224
335 3300026035 Ga0207703_10000408 Ga0207703_1000040827 224
336 3300026041 Ga0207639_10558162 Ga0207639_105581622 224
337 3300026067 Ga0207678_10343547 Ga0207678_103435472 224
338 3300026075 Ga0207708_10135202 Ga0207708_101352022 224
339 3300026088 Ga0207641_10002842 Ga0207641_100028422 224
340 3300026095 Ga0207676_10000269 Ga0207676_1000026927 224
341 3300026118 Ga0207675_100035344 Ga0207675_1000353443 224
342 3300026121 Ga0207683_10001051 Ga0207683_100010516 224
343 3300026142 Ga0207698_10017202 Ga0207698_100172022 224
344 3300027876 Ga0209974_10001122 Ga0209974_100011227 224
345 3300028380 Ga0268265_10674096 Ga0268265_106740962 224
346 3300028381 Ga0268264_10197095 Ga0268264_101970952 224
347 3300031456 Ga0307513_10046191 Ga0307513_100461914 224
348 3300031901 Ga0307406_10000278 Ga0307406_1000027821 224
349 3300032005 Ga0307411_10236305 Ga0307411_102363052 224
350 3300037471 Ga0395905_0062024 Ga0395905_0062024_2539_3237 224
351 3300038443 Ga0395901_0406006 Ga0395901_0406006_350_1048 224
352 3300042532 Ga0450893_0000665 Ga0450893_0000665_1066_1764 224
353 3300042876 Ga0451577_0003070 Ga0451577_0003070_5765_6463 224
354 3300044712 Ga0453684_0009366 Ga0453684_0009366_6763_7461 224
355 3300044842 Ga0466957_0343700 Ga0466957_0343700_111_809 224
356 3300045051 Ga0451576_0141870 Ga0451576_0141870_263_961 224
357 3300045051 Ga0451576_0372790 Ga0451576_0372790_758_1432 224
358 3300046459 Ga0495629_0156247 Ga0495629_0156247_172_846 224
359 3300046537 Ga0495598_0019000 Ga0495598_0019000_124_798 224
360 3300046615 Ga0495656_0039008 Ga0495656_0039008_383_1075 224
361 3300048090 Ga0495615_0002514 Ga0495615_0002514_340_1032 224
362 3300048907 Ga0496104_0251153 Ga0496104_0251153_922_1596 224
363 3300048909 Ga0496106_0604314 Ga0496106_0604314_117_791 224
364 3300048917 Ga0496114_0534893 Ga0496114_0534893_313_987 224
365 3300048929 Ga0496126_0019342 Ga0496126_0019342_3050_3751 224
366 3300049575 Ga0501039_0544493 Ga0501039_0544493_58_747 224
367 3300049579 Ga0501043_0316810 Ga0501043_0316810_31_726 224
368 3300050493 nmdc:mga0k408_120296_c1 nmdc:mga0k408_120296_c1_718_1401 224
369 3300050494 nmdc:mga06z11_148706_c1 nmdc:mga06z11_148706_c1_151_834 224
370 3300050496 nmdc:mga07m45_101186_c1 nmdc:mga07m45_101186_c1_704_1387 224
371 iso_pu_bacteria 2643221570 2643864543 224
372 iso_pu_bacteria 2643221652 2644291768 224
373 iso_pu_bacteria 2990710928 2990715122 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17938

TetR_C_29

Tetracyclin repressor-like, C-terminal domain

103

221

1

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

40

81

0.97

PF14514

TetR_C_9

Tetracyclin repressor-like, C-terminal domain

100

226

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3npi-assembly1.cif.gz_B crystal structure of a tetr family regulatory protein (dip1788) from corynebacterium diphtheriae at 2.96 a resolution 0.8768 30 222
3him-assembly1.cif.gz_A the crystal structure of a bacterial regulatory protein in the tetr family from rhodococcus rha1 to 2.2a 0.8399 27 222
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8234 28 111
7amt-assembly1.cif.gz_A structure of luxr with dna (activation) 0.821 26 217
4x1e-assembly1.cif.gz_B crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant 0.8169 31 221
ID Description Score Start End Superfamily
4jykB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9762 28 77 1.10.10.60
1pb6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9687 25 77 1.10.10.60
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9668 31 77 1.10.10.60
4xk4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9642 28 77 1.10.10.60
4xk4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.964 28 77 1.10.10.60
ID Description Score Start End GO Terms
AF-J8RZG5-F1-model_v4 deleted 0.984 64 224
AF-A0A7C8TQP1-F1-model_v4 deleted 0.9745 30 223
AF-A0A1V3YWI0-F1-model_v4 deleted 0.9738 33 224
AF-A0A7C4E3B7-F1-model_v4 TetR family transcriptional regulator 0.9737 24 224 GO:0003677
AF-A0A127F2G6-F1-model_v4 TetR family transcriptional regulator 0.9642 25 224 GO:0003677

Feature Viewer

pLDDT pTM Quality
89.92 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map