F426526
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 373 | 273 | 360 | 223 |
Family's Representative Sequence
| Representative Sequence | 3300053117|Ga0500593_000250|Ga0500593_000250_19550_20251 |
| Length | 228 |
| Sequence | MNEPVHIKRVTSRATSKTPAPSGKKKTTRTNDPERTQANILAVAEAEFGEKGLAGARIDEIAAATNTSKRFGSKEGLYLAVLEEAYRRVRDVEAELHLQDLTPEEALRRLVAFTFDHHLHHENYIRLVMSENIHRGEYLAQSPRIQELNVPAIAAIKNLYERGVKAGTFRKGLNPIDIHASISALSFFNVSNRHTFSLIFKLDMNSPTYITARREHVVEMIVRFVRKT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 4 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 5 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 6 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 7 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 8 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 9 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 10 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 11 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 12 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 13 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 14 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 15 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 93 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 143 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 144 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 145 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 146 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 147 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 148 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 149 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 150 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 151 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 152 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 153 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 154 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 157 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 158 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 160 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 161 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 162 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 163 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 164 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 165 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 166 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 167 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 168 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 170 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 171 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 172 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 173 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 174 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 175 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 176 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 177 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 178 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 179 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 180 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 181 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 182 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 183 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 238 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 239 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 240 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 241 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 242 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 243 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 244 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 246 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 247 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 250 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 251 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 252 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 253 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 254 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 255 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 256 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 257 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 258 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 259 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 260 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 261 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 262 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 263 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 264 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 265 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 266 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 267 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 268 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 269 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 270 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 271 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 272 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 273 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.51 |
| Metatranscriptomes | 0 |
| Isolates | 3.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.45 |
| Nodule | 0 |
| Rhizoplane | 1.88 |
| Rhizosphere | 67.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_8477249 | 2162886012 | Bacteria | 1196 |
| 2 | JGI25159J45721_1013944 | 3300002987 | Bacteria | 1836 |
| 3 | JGI25153J46596_10027494 | 3300003215 | Bacteria | 1991 |
| 4 | rootL2_10116331 | 3300003322 | Bacteria | 1534 |
| 5 | Ga0055536_1028981 | 3300003781 | Bacteria | 1496 |
| 6 | Ga0055534_1000530 | 3300003784 | Bacteria | 20526 |
| 7 | Ga0055530_10002389 | 3300003791 | Bacteria | 12160 |
| 8 | Ga0055540_1006756 | 3300003792 | Bacteria | 4486 |
| 9 | Ga0055531_10000281 | 3300003794 | Bacteria | 51971 |
| 10 | Ga0055531_10008193 | 3300003794 | Bacteria | 5563 |
| 11 | Ga0065165_1000192 | 3300005262 | Bacteria | 106862 |
| 12 | Ga0065165_1011135 | 3300005262 | Bacteria | 3794 |
| 13 | Ga0065165_1027648 | 3300005262 | Bacteria | 1844 |
| 14 | Ga0065715_10319995 | 3300005293 | Bacteria | 1004 |
| 15 | Ga0070658_10452261 | 3300005327 | Bacteria | 1107 |
| 16 | Ga0070690_100043980 | 3300005330 | Bacteria | 2834 |
| 17 | Ga0070670_100029231 | 3300005331 | Bacteria | 4743 |
| 18 | Ga0070670_100242257 | 3300005331 | Bacteria | 1570 |
| 19 | Ga0068869_100024432 | 3300005334 | Bacteria | 4186 |
| 20 | Ga0070666_10004700 | 3300005335 | Bacteria | 8344 |
| 21 | Ga0070689_100216918 | 3300005340 | Bacteria | 1568 |
| 22 | Ga0070687_100165341 | 3300005343 | Bacteria | 1312 |
| 23 | Ga0070668_100049584 | 3300005347 | Bacteria | 3230 |
| 24 | Ga0070669_100026225 | 3300005353 | Bacteria | 4192 |
| 25 | Ga0070675_100000772 | 3300005354 | Bacteria | 22339 |
| 26 | Ga0070671_100003449 | 3300005355 | Bacteria | 12337 |
| 27 | Ga0070674_100330193 | 3300005356 | Bacteria | 1225 |
| 28 | Ga0070673_100007674 | 3300005364 | Bacteria | 7137 |
| 29 | Ga0070688_100011377 | 3300005365 | Bacteria | 4943 |
| 30 | Ga0070667_100007507 | 3300005367 | Bacteria | 9043 |
| 31 | Ga0070709_10445303 | 3300005434 | Bacteria | 975 |
| 32 | Ga0070700_100037542 | 3300005441 | Bacteria | 2947 |
| 33 | Ga0070708_100028056 | 3300005445 | Bacteria | 4839 |
| 34 | Ga0070663_100365192 | 3300005455 | Bacteria | 1172 |
| 35 | Ga0070678_100001367 | 3300005456 | Bacteria | 12969 |
| 36 | Ga0070662_100084585 | 3300005457 | Bacteria | 2370 |
| 37 | Ga0068867_100006149 | 3300005459 | Bacteria | 8500 |
| 38 | Ga0070685_10019694 | 3300005466 | Bacteria | 3645 |
| 39 | Ga0070706_100000680 | 3300005467 | Bacteria | 38488 |
| 40 | Ga0070707_100182560 | 3300005468 | Bacteria | 2045 |
| 41 | Ga0070698_100546082 | 3300005471 | Bacteria | 1098 |
| 42 | Ga0070672_100093084 | 3300005543 | Bacteria | 2434 |
| 43 | Ga0070686_100058661 | 3300005544 | Bacteria | 2477 |
| 44 | Ga0070686_100584508 | 3300005544 | Bacteria | 878 |
| 45 | Ga0070664_100390120 | 3300005564 | Bacteria | 1272 |
| 46 | Ga0070702_100065538 | 3300005615 | Bacteria | 2128 |
| 47 | Ga0068852_100045658 | 3300005616 | Bacteria | 3728 |
| 48 | Ga0068852_100062268 | 3300005616 | Bacteria | 3245 |
| 49 | Ga0068859_100006800 | 3300005617 | Bacteria | 11622 |
| 50 | Ga0068859_100246634 | 3300005617 | Bacteria | 1876 |
| 51 | Ga0068864_100000270 | 3300005618 | Bacteria | 46170 |
| 52 | Ga0068864_100195282 | 3300005618 | Bacteria | 1857 |
| 53 | Ga0068866_10397951 | 3300005718 | Bacteria | 887 |
| 54 | Ga0068861_100037832 | 3300005719 | Bacteria | 3588 |
| 55 | Ga0068861_100193452 | 3300005719 | Bacteria | 1702 |
| 56 | Ga0068851_10033125 | 3300005834 | Bacteria | 2574 |
| 57 | Ga0068863_100000679 | 3300005841 | Bacteria | 34412 |
| 58 | Ga0068863_100029648 | 3300005841 | Bacteria | 5223 |
| 59 | Ga0068858_100000225 | 3300005842 | Bacteria | 61439 |
| 60 | Ga0068862_100127558 | 3300005844 | Bacteria | 2247 |
| 61 | Ga0068862_100265059 | 3300005844 | Bacteria | 1569 |
| 62 | Ga0081455_10039295 | 3300005937 | Bacteria | 4183 |
| 63 | Ga0075365_10102304 | 3300006038 | Bacteria | 1963 |
| 64 | Ga0075365_10219618 | 3300006038 | Bacteria | 1333 |
| 65 | Ga0075365_10465851 | 3300006038 | Bacteria | 893 |
| 66 | Ga0075368_10002604 | 3300006042 | Bacteria | 5915 |
| 67 | Ga0075363_100030292 | 3300006048 | Bacteria | 2800 |
| 68 | Ga0075364_10064254 | 3300006051 | Bacteria | 2409 |
| 69 | Ga0075362_10102556 | 3300006177 | Bacteria | 1339 |
| 70 | Ga0075362_10173773 | 3300006177 | Bacteria | 1042 |
| 71 | Ga0075362_10218154 | 3300006177 | Bacteria | 932 |
| 72 | Ga0075367_10010157 | 3300006178 | Bacteria | 4938 |
| 73 | Ga0075367_10094112 | 3300006178 | Bacteria | 1826 |
| 74 | Ga0075369_10150011 | 3300006186 | Bacteria | 1065 |
| 75 | Ga0075366_10006288 | 3300006195 | Bacteria | 6496 |
| 76 | Ga0075366_10027807 | 3300006195 | Bacteria | 3319 |
| 77 | Ga0075366_10043131 | 3300006195 | Bacteria | 2672 |
| 78 | Ga0075366_10107824 | 3300006195 | Bacteria | 1675 |
| 79 | Ga0075366_10121419 | 3300006195 | Bacteria | 1575 |
| 80 | Ga0075366_10245859 | 3300006195 | Bacteria | 1091 |
| 81 | Ga0097621_100014089 | 3300006237 | Bacteria | 5976 |
| 82 | Ga0075370_10009589 | 3300006353 | Bacteria | 5034 |
| 83 | Ga0075370_10031735 | 3300006353 | Bacteria | 2950 |
| 84 | Ga0075370_10118570 | 3300006353 | Bacteria | 1540 |
| 85 | Ga0075430_100119424 | 3300006846 | Bacteria | 2197 |
| 86 | Ga0075429_100180358 | 3300006880 | Bacteria | 1851 |
| 87 | Ga0068865_100003419 | 3300006881 | Bacteria | 9497 |
| 88 | Ga0068865_100434033 | 3300006881 | Bacteria | 1083 |
| 89 | Ga0097620_100006800 | 3300006931 | Bacteria | 11622 |
| 90 | Ga0097620_100246616 | 3300006931 | Bacteria | 1876 |
| 91 | Ga0105243_10416603 | 3300009148 | Bacteria | 1252 |
| 92 | Ga0105248_10001412 | 3300009177 | Bacteria | 26839 |
| 93 | Ga0105248_10052904 | 3300009177 | Bacteria | 4556 |
| 94 | Ga0105248_10272844 | 3300009177 | Bacteria | 1905 |
| 95 | Ga0105237_10560959 | 3300009545 | Bacteria | 1149 |
| 96 | Ga0105237_11039493 | 3300009545 | Bacteria | 826 |
| 97 | Ga0105238_10005024 | 3300009551 | Bacteria | 13078 |
| 98 | Ga0105249_10291018 | 3300009553 | Bacteria | 1635 |
| 99 | Ga0157374_10098434 | 3300013296 | Bacteria | 2800 |
| 100 | Ga0157378_10001679 | 3300013297 | Bacteria | 19946 |
| 101 | Ga0157378_10388759 | 3300013297 | Bacteria | 1372 |
| 102 | Ga0163162_10001712 | 3300013306 | Bacteria | 20568 |
| 103 | Ga0163162_10006036 | 3300013306 | Bacteria | 11727 |
| 104 | Ga0157375_10004784 | 3300013308 | Bacteria | 11770 |
| 105 | Ga0157375_10510818 | 3300013308 | Bacteria | 1365 |
| 106 | Ga0163163_10004407 | 3300014325 | Bacteria | 11999 |
| 107 | Ga0163163_10235992 | 3300014325 | Bacteria | 1878 |
| 108 | Ga0157380_10058691 | 3300014326 | Bacteria | 3068 |
| 109 | Ga0157380_10106623 | 3300014326 | Bacteria | 2345 |
| 110 | Ga0157379_10082372 | 3300014968 | Bacteria | 2883 |
| 111 | Ga0157379_10119072 | 3300014968 | Bacteria | 2375 |
| 112 | Ga0157376_10104115 | 3300014969 | Bacteria | 2486 |
| 113 | Ga0157376_10883307 | 3300014969 | Bacteria | 911 |
| 114 | Ga0213871_10007129 | 3300021441 | Bacteria | 2402 |
| 115 | Ga0209673_1005024 | 3300025273 | Bacteria | 6831 |
| 116 | Ga0209130_1001418 | 3300025284 | Bacteria | 15969 |
| 117 | Ga0209675_1000811 | 3300025291 | Bacteria | 20589 |
| 118 | Ga0209676_1002690 | 3300025292 | Bacteria | 12026 |
| 119 | Ga0209564_1042314 | 3300025295 | Bacteria | 1210 |
| 120 | Ga0209758_1001874 | 3300025297 | Bacteria | 23048 |
| 121 | Ga0209050_1000029 | 3300025298 | Bacteria | 465801 |
| 122 | Ga0207426_1040619 | 3300025302 | Bacteria | 1448 |
| 123 | Ga0209051_1000172 | 3300025303 | Bacteria | 117180 |
| 124 | Ga0209051_1006266 | 3300025303 | Bacteria | 6742 |
| 125 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 126 | Ga0209257_1000108 | 3300025304 | Bacteria | 240229 |
| 127 | Ga0209257_1000493 | 3300025304 | Bacteria | 71002 |
| 128 | Ga0209257_1004206 | 3300025304 | Bacteria | 11418 |
| 129 | Ga0209257_1009628 | 3300025304 | Bacteria | 5117 |
| 130 | Ga0207656_10018663 | 3300025321 | Bacteria | 2734 |
| 131 | Ga0207688_10273497 | 3300025901 | Bacteria | 1028 |
| 132 | Ga0207680_10000416 | 3300025903 | Bacteria | 20261 |
| 133 | Ga0207645_10002645 | 3300025907 | Bacteria | 13947 |
| 134 | Ga0207645_10119018 | 3300025907 | Bacteria | 1713 |
| 135 | Ga0207643_10082035 | 3300025908 | Bacteria | 1869 |
| 136 | Ga0207705_10390906 | 3300025909 | Bacteria | 1075 |
| 137 | Ga0207684_10001213 | 3300025910 | Bacteria | 28693 |
| 138 | Ga0207662_10236151 | 3300025918 | Bacteria | 1195 |
| 139 | Ga0207646_10319592 | 3300025922 | Bacteria | 1403 |
| 140 | Ga0207681_10181500 | 3300025923 | Bacteria | 1603 |
| 141 | Ga0207694_10017443 | 3300025924 | Bacteria | 5427 |
| 142 | Ga0207694_10770589 | 3300025924 | Bacteria | 812 |
| 143 | Ga0207650_10019320 | 3300025925 | Bacteria | 4785 |
| 144 | Ga0207650_10200872 | 3300025925 | Bacteria | 1597 |
| 145 | Ga0207659_10000337 | 3300025926 | Bacteria | 28208 |
| 146 | Ga0207644_10000543 | 3300025931 | Bacteria | 24519 |
| 147 | Ga0207706_10125540 | 3300025933 | Bacteria | 2257 |
| 148 | Ga0207709_10014788 | 3300025935 | Bacteria | 4315 |
| 149 | Ga0207670_10181459 | 3300025936 | Bacteria | 1586 |
| 150 | Ga0207669_10177988 | 3300025937 | Bacteria | 1521 |
| 151 | Ga0207704_10414626 | 3300025938 | Bacteria | 1066 |
| 152 | Ga0207691_10014458 | 3300025940 | Bacteria | 7525 |
| 153 | Ga0207711_10000843 | 3300025941 | Bacteria | 29642 |
| 154 | Ga0207711_10299562 | 3300025941 | Bacteria | 1483 |
| 155 | Ga0207689_10084482 | 3300025942 | Bacteria | 2609 |
| 156 | Ga0207651_10005653 | 3300025960 | Bacteria | 6447 |
| 157 | Ga0207658_10018787 | 3300025986 | Bacteria | 4778 |
| 158 | Ga0207677_10012916 | 3300026023 | Bacteria | 4822 |
| 159 | Ga0207677_10429704 | 3300026023 | Bacteria | 1127 |
| 160 | Ga0207703_10000408 | 3300026035 | Bacteria | 45772 |
| 161 | Ga0207639_10558162 | 3300026041 | Bacteria | 1052 |
| 162 | Ga0207678_10187797 | 3300026067 | Bacteria | 1766 |
| 163 | Ga0207678_10343547 | 3300026067 | Bacteria | 1286 |
| 164 | Ga0207708_10034069 | 3300026075 | Bacteria | 3872 |
| 165 | Ga0207708_10135202 | 3300026075 | Bacteria | 1930 |
| 166 | Ga0207641_10002842 | 3300026088 | Bacteria | 15737 |
| 167 | Ga0207641_10031669 | 3300026088 | Bacteria | 4387 |
| 168 | Ga0207648_10006743 | 3300026089 | Bacteria | 11389 |
| 169 | Ga0207648_10055399 | 3300026089 | Bacteria | 3461 |
| 170 | Ga0207676_10000269 | 3300026095 | Bacteria | 45280 |
| 171 | Ga0207676_10081765 | 3300026095 | Bacteria | 2625 |
| 172 | Ga0207676_10277193 | 3300026095 | Bacteria | 1521 |
| 173 | Ga0207675_100035344 | 3300026118 | Bacteria | 4661 |
| 174 | Ga0207675_100093216 | 3300026118 | Bacteria | 2833 |
| 175 | Ga0207683_10001051 | 3300026121 | Bacteria | 25171 |
| 176 | Ga0207698_10017202 | 3300026142 | Bacteria | 4898 |
| 177 | Ga0209813_10004416 | 3300027866 | Bacteria | 3358 |
| 178 | Ga0209974_10001122 | 3300027876 | Bacteria | 9505 |
| 179 | Ga0268265_10501790 | 3300028380 | Bacteria | 1143 |
| 180 | Ga0268265_10674096 | 3300028380 | Bacteria | 996 |
| 181 | Ga0268264_10034183 | 3300028381 | Bacteria | 4180 |
| 182 | Ga0268264_10197095 | 3300028381 | Bacteria | 1839 |
| 183 | Ga0307515_10000013 | 3300028794 | Bacteria | 568456 |
| 184 | Ga0307515_10000239 | 3300028794 | Bacteria | 135971 |
| 185 | Ga0307515_10033953 | 3300028794 | Bacteria | 8376 |
| 186 | Ga0307515_10076790 | 3300028794 | Bacteria | 4423 |
| 187 | Ga0307511_10000001 | 3300030521 | Bacteria | 206079 |
| 188 | Ga0307511_10003076 | 3300030521 | Bacteria | 17215 |
| 189 | Ga0307513_10046191 | 3300031456 | Bacteria | 4752 |
| 190 | Ga0307509_10121081 | 3300031507 | Bacteria | 2594 |
| 191 | Ga0307408_100369941 | 3300031548 | Bacteria | 1222 |
| 192 | Ga0307408_100920432 | 3300031548 | Bacteria | 801 |
| 193 | Ga0307514_10001361 | 3300031649 | Bacteria | 30951 |
| 194 | Ga0307516_10000705 | 3300031730 | Bacteria | 45448 |
| 195 | Ga0307406_10000278 | 3300031901 | Bacteria | 30154 |
| 196 | Ga0307412_10377442 | 3300031911 | Bacteria | 1147 |
| 197 | Ga0307412_10578970 | 3300031911 | Bacteria | 947 |
| 198 | Ga0307416_100482162 | 3300032002 | Bacteria | 1300 |
| 199 | Ga0307411_10236305 | 3300032005 | Bacteria | 1428 |
| 200 | Ga0307510_10023712 | 3300033180 | Bacteria | 7108 |
| 201 | Ga0307510_10144733 | 3300033180 | Bacteria | 2012 |
| 202 | Ga0373932_0013941 | 3300035112 | Bacteria | 2011 |
| 203 | Ga0373931_0056689 | 3300035691 | Bacteria | 2100 |
| 204 | Ga0373935_0228773 | 3300035692 | Bacteria | 1294 |
| 205 | Ga0373927_0137564 | 3300035695 | Bacteria | 1597 |
| 206 | Ga0373925_0002569 | 3300037068 | Bacteria | 14454 |
| 207 | Ga0373925_0505469 | 3300037068 | Bacteria | 992 |
| 208 | Ga0395899_0006012 | 3300037312 | Bacteria | 9421 |
| 209 | Ga0395900_0020080 | 3300037418 | Bacteria | 6815 |
| 210 | Ga0395898_0206681 | 3300037466 | Bacteria | 1873 |
| 211 | Ga0395905_0014961 | 3300037471 | Bacteria | 7399 |
| 212 | Ga0395905_0062024 | 3300037471 | Bacteria | 3497 |
| 213 | Ga0395901_0406006 | 3300038443 | Bacteria | 1399 |
| 214 | Ga0395901_0790050 | 3300038443 | Bacteria | 939 |
| 215 | Ga0436360_1345034 | 3300039438 | Bacteria | 3538 |
| 216 | Ga0436361_0535480 | 3300039447 | Bacteria | 1333 |
| 217 | Ga0436363_1712103 | 3300039450 | Bacteria | 944 |
| 218 | Ga0439439_0024695 | 3300041406 | Bacteria | 1509 |
| 219 | Ga0451798_0407693 | 3300041458 | Bacteria | 996 |
| 220 | Ga0451853_1934982 | 3300041512 | Bacteria | 961 |
| 221 | Ga0439445_0006557 | 3300042004 | Bacteria | 2678 |
| 222 | Ga0439445_0124872 | 3300042004 | Bacteria | 740 |
| 223 | Ga0439449_0000091 | 3300042007 | Bacteria | 29348 |
| 224 | Ga0439462_0010996 | 3300042015 | Bacteria | 2300 |
| 225 | Ga0450911_000074 | 3300042115 | Bacteria | 41259 |
| 226 | Ga0450898_003764 | 3300042134 | Bacteria | 2199 |
| 227 | Ga0439434_0029557 | 3300042435 | Bacteria | 1661 |
| 228 | Ga0439464_0025663 | 3300042439 | Bacteria | 1632 |
| 229 | Ga0450893_0000665 | 3300042532 | Bacteria | 4944 |
| 230 | Ga0451577_0003070 | 3300042876 | Bacteria | 18890 |
| 231 | Ga0451577_0381673 | 3300042876 | Bacteria | 1279 |
| 232 | Ga0453683_0023502 | 3300044673 | Bacteria | 3928 |
| 233 | Ga0453684_0009366 | 3300044712 | Bacteria | 17157 |
| 234 | Ga0453684_0103234 | 3300044712 | Bacteria | 3484 |
| 235 | Ga0466957_0343700 | 3300044842 | Bacteria | 1011 |
| 236 | Ga0451576_0006443 | 3300045051 | Bacteria | 14393 |
| 237 | Ga0451576_0027515 | 3300045051 | Bacteria | 6105 |
| 238 | Ga0451576_0059345 | 3300045051 | Bacteria | 3994 |
| 239 | Ga0451576_0141870 | 3300045051 | Bacteria | 2505 |
| 240 | Ga0451576_0231287 | 3300045051 | Bacteria | 1931 |
| 241 | Ga0451576_0372790 | 3300045051 | Bacteria | 1496 |
| 242 | Ga0495629_0156247 | 3300046459 | Bacteria | 1585 |
| 243 | Ga0495638_0309992 | 3300046460 | Bacteria | 847 |
| 244 | Ga0495653_0001078 | 3300046463 | Bacteria | 21050 |
| 245 | Ga0495650_0002079 | 3300046471 | Bacteria | 17300 |
| 246 | Ga0495580_0007236 | 3300046472 | Bacteria | 8924 |
| 247 | Ga0495582_0001025 | 3300046473 | Bacteria | 15634 |
| 248 | Ga0495584_0028331 | 3300046491 | Bacteria | 2837 |
| 249 | Ga0495594_0015973 | 3300046499 | Bacteria | 3950 |
| 250 | Ga0495594_0021304 | 3300046499 | Bacteria | 3459 |
| 251 | Ga0495607_0000862 | 3300046501 | Bacteria | 28399 |
| 252 | Ga0495583_0023677 | 3300046506 | Bacteria | 3101 |
| 253 | Ga0495606_0221366 | 3300046507 | Bacteria | 1066 |
| 254 | Ga0495610_0000938 | 3300046512 | Bacteria | 27065 |
| 255 | Ga0495610_0002815 | 3300046512 | Bacteria | 14197 |
| 256 | Ga0495616_0000034 | 3300046513 | Bacteria | 129394 |
| 257 | Ga0495630_0021314 | 3300046517 | Bacteria | 4785 |
| 258 | Ga0495630_0027564 | 3300046517 | Bacteria | 4216 |
| 259 | Ga0495632_0000636 | 3300046519 | Bacteria | 32294 |
| 260 | Ga0495632_0000936 | 3300046519 | Bacteria | 25571 |
| 261 | Ga0495643_0000028 | 3300046522 | Bacteria | 262886 |
| 262 | Ga0495643_0000868 | 3300046522 | Bacteria | 32233 |
| 263 | Ga0495648_0010756 | 3300046524 | Bacteria | 6948 |
| 264 | Ga0495666_0007400 | 3300046526 | Bacteria | 5502 |
| 265 | Ga0495642_0005483 | 3300046528 | Bacteria | 4872 |
| 266 | Ga0495652_0012458 | 3300046529 | Bacteria | 7666 |
| 267 | Ga0495654_0046630 | 3300046530 | Bacteria | 2134 |
| 268 | Ga0495665_0003099 | 3300046531 | Bacteria | 8998 |
| 269 | Ga0495586_0008567 | 3300046535 | Bacteria | 5444 |
| 270 | Ga0495587_0016771 | 3300046536 | Bacteria | 4555 |
| 271 | Ga0495598_0019000 | 3300046537 | Bacteria | 1795 |
| 272 | Ga0495609_0005071 | 3300046538 | Bacteria | 7023 |
| 273 | Ga0495609_0014239 | 3300046538 | Bacteria | 3743 |
| 274 | Ga0495609_0064568 | 3300046538 | Bacteria | 1615 |
| 275 | Ga0495621_0159682 | 3300046539 | Bacteria | 891 |
| 276 | Ga0495597_0000072 | 3300046542 | Bacteria | 87914 |
| 277 | Ga0495597_0000694 | 3300046542 | Bacteria | 27099 |
| 278 | Ga0495656_0039008 | 3300046615 | Bacteria | 1971 |
| 279 | Ga0495668_0000452 | 3300046616 | Bacteria | 52507 |
| 280 | Ga0495668_0000590 | 3300046616 | Bacteria | 44130 |
| 281 | Ga0495668_0014425 | 3300046616 | Bacteria | 4633 |
| 282 | Ga0495634_0007168 | 3300046642 | Bacteria | 8406 |
| 283 | Ga0495625_0003267 | 3300046660 | Bacteria | 16384 |
| 284 | Ga0495625_0010699 | 3300046660 | Bacteria | 7558 |
| 285 | Ga0495625_0018651 | 3300046660 | Bacteria | 5408 |
| 286 | Ga0495661_0000082 | 3300046665 | Bacteria | 116600 |
| 287 | Ga0495661_0000569 | 3300046665 | Bacteria | 38310 |
| 288 | Ga0495588_0006854 | 3300046674 | Bacteria | 5160 |
| 289 | Ga0495623_0004565 | 3300046679 | Bacteria | 9097 |
| 290 | Ga0495646_0147134 | 3300046680 | Bacteria | 1313 |
| 291 | Ga0495658_0146265 | 3300046683 | Bacteria | 1448 |
| 292 | Ga0495669_0001658 | 3300046684 | Bacteria | 9137 |
| 293 | Ga0495649_0001399 | 3300046694 | Bacteria | 18205 |
| 294 | Ga0495589_0002690 | 3300046794 | Bacteria | 9828 |
| 295 | Ga0495581_0210226 | 3300047315 | Bacteria | 1138 |
| 296 | Ga0495604_0013449 | 3300047317 | Bacteria | 6521 |
| 297 | Ga0495672_0000212 | 3300047320 | Bacteria | 83026 |
| 298 | Ga0495680_0170792 | 3300047322 | Bacteria | 1574 |
| 299 | Ga0495675_0001518 | 3300047444 | Bacteria | 14026 |
| 300 | Ga0495675_0101313 | 3300047444 | Bacteria | 1802 |
| 301 | Ga0495677_0002989 | 3300047445 | Bacteria | 6576 |
| 302 | Ga0495593_0026762 | 3300047673 | Bacteria | 3181 |
| 303 | Ga0495615_0002514 | 3300048090 | Bacteria | 2949 |
| 304 | Ga0495615_0074492 | 3300048090 | Bacteria | 921 |
| 305 | Ga0495626_0002360 | 3300048091 | Bacteria | 13261 |
| 306 | Ga0496100_0474493 | 3300048903 | Bacteria | 961 |
| 307 | Ga0496104_0251153 | 3300048907 | Bacteria | 1681 |
| 308 | Ga0496106_0604314 | 3300048909 | Bacteria | 878 |
| 309 | Ga0496109_0155974 | 3300048912 | Bacteria | 2138 |
| 310 | Ga0496113_0022239 | 3300048916 | Bacteria | 4482 |
| 311 | Ga0496114_0534893 | 3300048917 | Bacteria | 1036 |
| 312 | Ga0496121_0003833 | 3300048924 | Bacteria | 20921 |
| 313 | Ga0496122_0000255 | 3300048925 | Bacteria | 120384 |
| 314 | Ga0496122_0103379 | 3300048925 | Bacteria | 1896 |
| 315 | Ga0496123_0001210 | 3300048926 | Bacteria | 37670 |
| 316 | Ga0496124_0073837 | 3300048927 | Bacteria | 2821 |
| 317 | Ga0496124_0094395 | 3300048927 | Bacteria | 2433 |
| 318 | Ga0496125_0002317 | 3300048928 | Bacteria | 25097 |
| 319 | Ga0496125_0016204 | 3300048928 | Bacteria | 7165 |
| 320 | Ga0496126_0019342 | 3300048929 | Bacteria | 6708 |
| 321 | Ga0495678_000029 | 3300049459 | Bacteria | 219803 |
| 322 | Ga0501292_002050 | 3300049515 | Bacteria | 2559 |
| 323 | Ga0501303_007357 | 3300049526 | Bacteria | 980 |
| 324 | Ga0501039_0544493 | 3300049575 | Bacteria | 911 |
| 325 | Ga0501043_0316810 | 3300049579 | Bacteria | 1190 |
| 326 | Ga0501252_000940 | 3300049682 | Bacteria | 2522 |
| 327 | Ga0501257_057085 | 3300049686 | Bacteria | 981 |
| 328 | Ga0501265_000976 | 3300049762 | Bacteria | 3221 |
| 329 | nmdc:mga03683_151002_c1 | 3300050489 | Bacteria | 1048 |
| 330 | nmdc:mga03683_211883_c1 | 3300050489 | Bacteria | 892 |
| 331 | nmdc:mga03683_64719_c1 | 3300050489 | Bacteria | 1552 |
| 332 | nmdc:mga03n38_64242_c1 | 3300050490 | Bacteria | 1680 |
| 333 | nmdc:mga00v17_139313_c1 | 3300050491 | Bacteria | 1555 |
| 334 | nmdc:mga0yw44_149560_c1 | 3300050492 | Bacteria | 1522 |
| 335 | nmdc:mga0k408_109962_c1 | 3300050493 | Bacteria | 1629 |
| 336 | nmdc:mga0k408_120296_c1 | 3300050493 | Bacteria | 1555 |
| 337 | nmdc:mga0k408_19795_c1 | 3300050493 | Bacteria | 3765 |
| 338 | nmdc:mga0k408_239158_c1 | 3300050493 | Bacteria | 1084 |
| 339 | nmdc:mga0k408_39442_c1 | 3300050493 | Bacteria | 2713 |
| 340 | nmdc:mga06z11_148706_c1 | 3300050494 | Bacteria | 1330 |
| 341 | nmdc:mga06z11_299741_c1 | 3300050494 | Bacteria | 955 |
| 342 | nmdc:mga04h51_11211_c1 | 3300050495 | Bacteria | 2483 |
| 343 | nmdc:mga07m45_101186_c1 | 3300050496 | Bacteria | 1655 |
| 344 | nmdc:mga07m45_118059_c1 | 3300050496 | Bacteria | 1531 |
| 345 | nmdc:mga07m45_5034_c1 | 3300050496 | Bacteria | 6530 |
| 346 | nmdc:mga07m45_6292_c1 | 3300050496 | Bacteria | 5995 |
| 347 | nmdc:mga0sz30_114926_c1 | 3300050516 | Bacteria | 1181 |
| 348 | Ga0500646_0032876 | 3300053090 | Bacteria | 1433 |
| 349 | Ga0500583_0003461 | 3300053092 | Bacteria | 4966 |
| 350 | Ga0500555_045387 | 3300053103 | Bacteria | 1215 |
| 351 | Ga0500562_046315 | 3300053108 | Bacteria | 1159 |
| 352 | Ga0500572_000112 | 3300053111 | Bacteria | 27077 |
| 353 | Ga0500593_000250 | 3300053117 | Bacteria | 22072 |
| 354 | Ga0500595_081467 | 3300053119 | Bacteria | 946 |
| 355 | Ga0500642_0003106 | 3300053130 | Bacteria | 4972 |
| 356 | Ga0500588_0069360 | 3300053146 | Bacteria | 1152 |
| 357 | Ga0500590_130443 | 3300053148 | Bacteria | 1164 |
| 358 | Ga0500604_0012007 | 3300053151 | Bacteria | 2334 |
| 359 | Ga0500616_0178166 | 3300053153 | Bacteria | 959 |
| 360 | Ga0500636_0019039 | 3300053177 | Bacteria | 4062 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031730 | Ga0307516_10000705 | Ga0307516_1000070525 | 196 |
| 2 | 3300037068 | Ga0373925_0002569 | Ga0373925_0002569_13076_13666 | 196 |
| 3 | 3300042004 | Ga0439445_0124872 | Ga0439445_0124872_136_726 | 196 |
| 4 | 3300046522 | Ga0495643_0000028 | Ga0495643_0000028_227659_228345 | 196 |
| 5 | 3300046683 | Ga0495658_0146265 | Ga0495658_0146265_561_1151 | 196 |
| 6 | 3300047320 | Ga0495672_0000212 | Ga0495672_0000212_79041_79727 | 196 |
| 7 | 3300049459 | Ga0495678_000029 | Ga0495678_000029_8624_9310 | 196 |
| 8 | 3300046460 | Ga0495638_0309992 | Ga0495638_0309992_20_706 | 197 |
| 9 | 3300046512 | Ga0495610_0000938 | Ga0495610_0000938_19821_20507 | 197 |
| 10 | 3300046524 | Ga0495648_0010756 | Ga0495648_0010756_4778_5464 | 197 |
| 11 | 3300046538 | Ga0495609_0005071 | Ga0495609_0005071_1758_2444 | 197 |
| 12 | 3300046660 | Ga0495625_0018651 | Ga0495625_0018651_2909_3595 | 197 |
| 13 | 3300046694 | Ga0495649_0001399 | Ga0495649_0001399_12424_13110 | 197 |
| 14 | 3300009545 | Ga0105237_11039493 | Ga0105237_110394932 | 205 |
| 15 | 3300046539 | Ga0495621_0159682 | Ga0495621_0159682_35_652 | 205 |
| 16 | 3300046616 | Ga0495668_0000590 | Ga0495668_0000590_37640_38263 | 206 |
| 17 | 3300005434 | Ga0070709_10445303 | Ga0070709_104453032 | 207 |
| 18 | 3300053103 | Ga0500555_045387 | Ga0500555_045387_29_715 | 207 |
| 19 | 3300053108 | Ga0500562_046315 | Ga0500562_046315_203_919 | 207 |
| 20 | 3300053151 | Ga0500604_0012007 | Ga0500604_0012007_1491_2177 | 207 |
| 21 | 3300026023 | Ga0207677_10429704 | Ga0207677_104297043 | 208 |
| 22 | 3300030521 | Ga0307511_10000001 | Ga0307511_1000000129 | 208 |
| 23 | 3300047322 | Ga0495680_0170792 | Ga0495680_0170792_11_643 | 208 |
| 24 | 3300050496 | nmdc:mga07m45_118059_c1 | nmdc:mga07m45_118059_c1_648_1337 | 208 |
| 25 | 3300053092 | Ga0500583_0003461 | Ga0500583_0003461_633_1319 | 208 |
| 26 | 3300006038 | Ga0075365_10465851 | Ga0075365_104658511 | 209 |
| 27 | 3300006195 | Ga0075366_10107824 | Ga0075366_101078242 | 209 |
| 28 | 3300035692 | Ga0373935_0228773 | Ga0373935_0228773_82_741 | 209 |
| 29 | 3300035695 | Ga0373927_0137564 | Ga0373927_0137564_828_1487 | 209 |
| 30 | 3300050493 | nmdc:mga0k408_109962_c1 | nmdc:mga0k408_109962_c1_507_1208 | 209 |
| 31 | iso_pu_bacteria | 3003665799 | 3003672609 | 209 |
| 32 | 3300003215 | JGI25153J46596_10027494 | JGI25153J46596_100274942 | 210 |
| 33 | 3300003791 | Ga0055530_10002389 | Ga0055530_100023897 | 210 |
| 34 | 3300003794 | Ga0055531_10008193 | Ga0055531_100081935 | 210 |
| 35 | 3300005262 | Ga0065165_1000192 | Ga0065165_100019255 | 210 |
| 36 | 3300005544 | Ga0070686_100584508 | Ga0070686_1005845081 | 210 |
| 37 | 3300006195 | Ga0075366_10027807 | Ga0075366_100278074 | 210 |
| 38 | 3300006353 | Ga0075370_10009589 | Ga0075370_100095895 | 210 |
| 39 | 3300025297 | Ga0209758_1001874 | Ga0209758_10018745 | 210 |
| 40 | 3300025298 | Ga0209050_1000029 | Ga0209050_1000029406 | 210 |
| 41 | 3300025304 | Ga0209257_1000493 | Ga0209257_100049356 | 210 |
| 42 | 3300037418 | Ga0395900_0020080 | Ga0395900_0020080_2621_3265 | 210 |
| 43 | 3300037471 | Ga0395905_0014961 | Ga0395905_0014961_2847_3491 | 210 |
| 44 | 3300038443 | Ga0395901_0790050 | Ga0395901_0790050_272_916 | 210 |
| 45 | 3300050493 | nmdc:mga0k408_19795_c1 | nmdc:mga0k408_19795_c1_787_1431 | 210 |
| 46 | 3300050496 | nmdc:mga07m45_5034_c1 | nmdc:mga07m45_5034_c1_2108_2752 | 210 |
| 47 | 3300006038 | Ga0075365_10219618 | Ga0075365_102196182 | 211 |
| 48 | 3300006042 | Ga0075368_10002604 | Ga0075368_100026043 | 211 |
| 49 | 3300006048 | Ga0075363_100030292 | Ga0075363_1000302923 | 211 |
| 50 | 3300006051 | Ga0075364_10064254 | Ga0075364_100642542 | 211 |
| 51 | 3300006177 | Ga0075362_10102556 | Ga0075362_101025562 | 211 |
| 52 | 3300006178 | Ga0075367_10010157 | Ga0075367_100101574 | 211 |
| 53 | 3300006186 | Ga0075369_10150011 | Ga0075369_101500112 | 211 |
| 54 | 3300006353 | Ga0075370_10031735 | Ga0075370_100317352 | 211 |
| 55 | 3300027866 | Ga0209813_10004416 | Ga0209813_100044163 | 211 |
| 56 | 3300050490 | nmdc:mga03n38_64242_c1 | nmdc:mga03n38_64242_c1_418_1083 | 211 |
| 57 | 3300050491 | nmdc:mga00v17_139313_c1 | nmdc:mga00v17_139313_c1_737_1402 | 211 |
| 58 | 3300050495 | nmdc:mga04h51_11211_c1 | nmdc:mga04h51_11211_c1_1581_2246 | 211 |
| 59 | 3300050496 | nmdc:mga07m45_6292_c1 | nmdc:mga07m45_6292_c1_1334_1999 | 211 |
| 60 | 3300050516 | nmdc:mga0sz30_114926_c1 | nmdc:mga0sz30_114926_c1_242_907 | 211 |
| 61 | iso_pu_bacteria | 2821131069 | 2821132165 | 211 |
| 62 | 3300006353 | Ga0075370_10118570 | Ga0075370_101185702 | 212 |
| 63 | 3300046471 | Ga0495650_0002079 | Ga0495650_0002079_12642_13343 | 212 |
| 64 | 3300046660 | Ga0495625_0003267 | Ga0495625_0003267_510_1211 | 212 |
| 65 | 3300050494 | nmdc:mga06z11_299741_c1 | nmdc:mga06z11_299741_c1_272_928 | 212 |
| 66 | 3300025304 | Ga0209257_1009628 | Ga0209257_10096284 | 213 |
| 67 | 3300028794 | Ga0307515_10000239 | Ga0307515_1000023964 | 213 |
| 68 | iso_pu_bacteria | 2842733646 | 2842735515 | 213 |
| 69 | 3300053146 | Ga0500588_0069360 | Ga0500588_0069360_54_725 | 214 |
| 70 | 3300053153 | Ga0500616_0178166 | Ga0500616_0178166_103_774 | 214 |
| 71 | 3300053177 | Ga0500636_0019039 | Ga0500636_0019039_1458_2135 | 214 |
| 72 | 3300005467 | Ga0070706_100000680 | Ga0070706_1000006807 | 215 |
| 73 | 3300005468 | Ga0070707_100182560 | Ga0070707_1001825603 | 215 |
| 74 | 3300006178 | Ga0075367_10094112 | Ga0075367_100941123 | 215 |
| 75 | 3300025910 | Ga0207684_10001213 | Ga0207684_100012135 | 215 |
| 76 | 3300025922 | Ga0207646_10319592 | Ga0207646_103195922 | 215 |
| 77 | 3300046463 | Ga0495653_0001078 | Ga0495653_0001078_13696_14346 | 215 |
| 78 | 3300046472 | Ga0495580_0007236 | Ga0495580_0007236_3054_3704 | 215 |
| 79 | 3300046473 | Ga0495582_0001025 | Ga0495582_0001025_10095_10745 | 215 |
| 80 | 3300046491 | Ga0495584_0028331 | Ga0495584_0028331_1489_2139 | 215 |
| 81 | 3300046499 | Ga0495594_0015973 | Ga0495594_0015973_1310_1960 | 215 |
| 82 | 3300046499 | Ga0495594_0021304 | Ga0495594_0021304_197_847 | 215 |
| 83 | 3300046506 | Ga0495583_0023677 | Ga0495583_0023677_213_863 | 215 |
| 84 | 3300046507 | Ga0495606_0221366 | Ga0495606_0221366_398_1048 | 215 |
| 85 | 3300046513 | Ga0495616_0000034 | Ga0495616_0000034_91510_92160 | 215 |
| 86 | 3300046517 | Ga0495630_0021314 | Ga0495630_0021314_949_1599 | 215 |
| 87 | 3300046519 | Ga0495632_0000636 | Ga0495632_0000636_23563_24213 | 215 |
| 88 | 3300046522 | Ga0495643_0000868 | Ga0495643_0000868_3286_3936 | 215 |
| 89 | 3300046526 | Ga0495666_0007400 | Ga0495666_0007400_2212_2862 | 215 |
| 90 | 3300046528 | Ga0495642_0005483 | Ga0495642_0005483_484_1134 | 215 |
| 91 | 3300046529 | Ga0495652_0012458 | Ga0495652_0012458_1865_2515 | 215 |
| 92 | 3300046530 | Ga0495654_0046630 | Ga0495654_0046630_670_1320 | 215 |
| 93 | 3300046531 | Ga0495665_0003099 | Ga0495665_0003099_7387_8037 | 215 |
| 94 | 3300046535 | Ga0495586_0008567 | Ga0495586_0008567_696_1346 | 215 |
| 95 | 3300046538 | Ga0495609_0014239 | Ga0495609_0014239_1954_2604 | 215 |
| 96 | 3300046538 | Ga0495609_0064568 | Ga0495609_0064568_263_913 | 215 |
| 97 | 3300046542 | Ga0495597_0000694 | Ga0495597_0000694_20269_20919 | 215 |
| 98 | 3300046616 | Ga0495668_0014425 | Ga0495668_0014425_2091_2741 | 215 |
| 99 | 3300046642 | Ga0495634_0007168 | Ga0495634_0007168_5302_5952 | 215 |
| 100 | 3300046660 | Ga0495625_0010699 | Ga0495625_0010699_5351_6001 | 215 |
| 101 | 3300046665 | Ga0495661_0000082 | Ga0495661_0000082_66888_67535 | 215 |
| 102 | 3300046674 | Ga0495588_0006854 | Ga0495588_0006854_3502_4152 | 215 |
| 103 | 3300046679 | Ga0495623_0004565 | Ga0495623_0004565_7418_8068 | 215 |
| 104 | 3300046684 | Ga0495669_0001658 | Ga0495669_0001658_581_1231 | 215 |
| 105 | 3300046794 | Ga0495589_0002690 | Ga0495589_0002690_8600_9250 | 215 |
| 106 | 3300047317 | Ga0495604_0013449 | Ga0495604_0013449_2971_3621 | 215 |
| 107 | 3300047444 | Ga0495675_0001518 | Ga0495675_0001518_9479_10129 | 215 |
| 108 | 3300048091 | Ga0495626_0002360 | Ga0495626_0002360_11157_11807 | 215 |
| 109 | 3300048903 | Ga0496100_0474493 | Ga0496100_0474493_290_937 | 215 |
| 110 | 3300048912 | Ga0496109_0155974 | Ga0496109_0155974_83_730 | 215 |
| 111 | 3300048916 | Ga0496113_0022239 | Ga0496113_0022239_3230_3877 | 215 |
| 112 | 3300048925 | Ga0496122_0000255 | Ga0496122_0000255_69878_70525 | 215 |
| 113 | 3300048925 | Ga0496122_0103379 | Ga0496122_0103379_22_669 | 215 |
| 114 | 3300048926 | Ga0496123_0001210 | Ga0496123_0001210_15431_16078 | 215 |
| 115 | 3300048927 | Ga0496124_0073837 | Ga0496124_0073837_1793_2440 | 215 |
| 116 | 3300048927 | Ga0496124_0094395 | Ga0496124_0094395_430_1077 | 215 |
| 117 | 3300048928 | Ga0496125_0002317 | Ga0496125_0002317_12424_13071 | 215 |
| 118 | iso_pu_bacteria | 2881101125 | 2881103684 | 215 |
| 119 | 3300005618 | Ga0068864_100195282 | Ga0068864_1001952822 | 216 |
| 120 | 3300005937 | Ga0081455_10039295 | Ga0081455_100392955 | 216 |
| 121 | 3300009545 | Ga0105237_10560959 | Ga0105237_105609592 | 216 |
| 122 | 3300014325 | Ga0163163_10235992 | Ga0163163_102359921 | 216 |
| 123 | 3300025907 | Ga0207645_10002645 | Ga0207645_100026453 | 216 |
| 124 | 3300026095 | Ga0207676_10277193 | Ga0207676_102771932 | 216 |
| 125 | 3300031507 | Ga0307509_10121081 | Ga0307509_101210812 | 216 |
| 126 | 3300031911 | Ga0307412_10578970 | Ga0307412_105789701 | 216 |
| 127 | 3300032002 | Ga0307416_100482162 | Ga0307416_1004821621 | 216 |
| 128 | 3300035112 | Ga0373932_0013941 | Ga0373932_0013941_546_1196 | 216 |
| 129 | 3300035691 | Ga0373931_0056689 | Ga0373931_0056689_659_1309 | 216 |
| 130 | 3300037068 | Ga0373925_0505469 | Ga0373925_0505469_315_965 | 216 |
| 131 | 3300039450 | Ga0436363_1712103 | Ga0436363_1712103_34_687 | 216 |
| 132 | 3300046517 | Ga0495630_0027564 | Ga0495630_0027564_2573_3223 | 216 |
| 133 | 3300046536 | Ga0495587_0016771 | Ga0495587_0016771_2098_2754 | 216 |
| 134 | 3300046680 | Ga0495646_0147134 | Ga0495646_0147134_556_1212 | 216 |
| 135 | 3300047315 | Ga0495581_0210226 | Ga0495581_0210226_469_1125 | 216 |
| 136 | 3300047444 | Ga0495675_0101313 | Ga0495675_0101313_586_1242 | 216 |
| 137 | 3300047673 | Ga0495593_0026762 | Ga0495593_0026762_2363_3013 | 216 |
| 138 | 3300021441 | Ga0213871_10007129 | Ga0213871_100071292 | 217 |
| 139 | 3300030521 | Ga0307511_10003076 | Ga0307511_100030769 | 217 |
| 140 | 3300033180 | Ga0307510_10023712 | Ga0307510_100237125 | 217 |
| 141 | 3300039438 | Ga0436360_1345034 | Ga0436360_1345034_1648_2355 | 217 |
| 142 | 3300039447 | Ga0436361_0535480 | Ga0436361_0535480_32_739 | 217 |
| 143 | 3300053119 | Ga0500595_081467 | Ga0500595_081467_223_921 | 217 |
| 144 | iso_pu_bacteria | 2928115317 | 2928119775 | 217 |
| 145 | 3300005616 | Ga0068852_100062268 | Ga0068852_1000622682 | 218 |
| 146 | 3300046542 | Ga0495597_0000072 | Ga0495597_0000072_32493_33188 | 218 |
| 147 | 3300053111 | Ga0500572_000112 | Ga0500572_000112_12745_13413 | 218 |
| 148 | 3300053130 | Ga0500642_0003106 | Ga0500642_0003106_1640_2311 | 218 |
| 149 | 3300006038 | Ga0075365_10102304 | Ga0075365_101023042 | 219 |
| 150 | 3300009177 | Ga0105248_10001412 | Ga0105248_1000141222 | 219 |
| 151 | 3300013297 | Ga0157378_10388759 | Ga0157378_103887592 | 219 |
| 152 | 3300028794 | Ga0307515_10033953 | Ga0307515_100339535 | 219 |
| 153 | 3300031548 | Ga0307408_100920432 | Ga0307408_1009204321 | 219 |
| 154 | 3300041458 | Ga0451798_0407693 | Ga0451798_0407693_181_879 | 219 |
| 155 | 3300046512 | Ga0495610_0002815 | Ga0495610_0002815_3371_4045 | 219 |
| 156 | 3300046616 | Ga0495668_0000452 | Ga0495668_0000452_44786_45460 | 219 |
| 157 | 3300053117 | Ga0500593_000250 | Ga0500593_000250_19550_20251 | 219 |
| 158 | 3300053148 | Ga0500590_130443 | Ga0500590_130443_258_932 | 219 |
| 159 | iso_pu_bacteria | 2919704043 | 2919704392 | 219 |
| 160 | 3300005441 | Ga0070700_100037542 | Ga0070700_1000375423 | 220 |
| 161 | 3300005459 | Ga0068867_100006149 | Ga0068867_10000614910 | 220 |
| 162 | 3300005543 | Ga0070672_100093084 | Ga0070672_1000930841 | 220 |
| 163 | 3300005617 | Ga0068859_100246634 | Ga0068859_1002466341 | 220 |
| 164 | 3300005719 | Ga0068861_100037832 | Ga0068861_1000378323 | 220 |
| 165 | 3300005844 | Ga0068862_100127558 | Ga0068862_1001275583 | 220 |
| 166 | 3300006195 | Ga0075366_10043131 | Ga0075366_100431313 | 220 |
| 167 | 3300006881 | Ga0068865_100003419 | Ga0068865_1000034192 | 220 |
| 168 | 3300006931 | Ga0097620_100246616 | Ga0097620_1002466161 | 220 |
| 169 | 3300009148 | Ga0105243_10416603 | Ga0105243_104166032 | 220 |
| 170 | 3300009551 | Ga0105238_10005024 | Ga0105238_100050245 | 220 |
| 171 | 3300013297 | Ga0157378_10001679 | Ga0157378_100016794 | 220 |
| 172 | 3300013306 | Ga0163162_10001712 | Ga0163162_1000171213 | 220 |
| 173 | 3300014326 | Ga0157380_10058691 | Ga0157380_100586913 | 220 |
| 174 | 3300014968 | Ga0157379_10119072 | Ga0157379_101190723 | 220 |
| 175 | 3300025901 | Ga0207688_10273497 | Ga0207688_102734971 | 220 |
| 176 | 3300025907 | Ga0207645_10119018 | Ga0207645_101190182 | 220 |
| 177 | 3300025924 | Ga0207694_10017443 | Ga0207694_100174432 | 220 |
| 178 | 3300025935 | Ga0207709_10014788 | Ga0207709_100147885 | 220 |
| 179 | 3300025938 | Ga0207704_10414626 | Ga0207704_104146261 | 220 |
| 180 | 3300025940 | Ga0207691_10014458 | Ga0207691_100144586 | 220 |
| 181 | 3300025941 | Ga0207711_10000843 | Ga0207711_1000084324 | 220 |
| 182 | 3300026075 | Ga0207708_10034069 | Ga0207708_100340693 | 220 |
| 183 | 3300026089 | Ga0207648_10055399 | Ga0207648_100553992 | 220 |
| 184 | 3300026118 | Ga0207675_100093216 | Ga0207675_1000932163 | 220 |
| 185 | 3300028380 | Ga0268265_10501790 | Ga0268265_105017902 | 220 |
| 186 | 3300028381 | Ga0268264_10034183 | Ga0268264_100341833 | 220 |
| 187 | 3300031649 | Ga0307514_10001361 | Ga0307514_1000136117 | 220 |
| 188 | 3300045051 | Ga0451576_0231287 | Ga0451576_0231287_695_1366 | 220 |
| 189 | 3300050489 | nmdc:mga03683_64719_c1 | nmdc:mga03683_64719_c1_701_1414 | 220 |
| 190 | 3300050492 | nmdc:mga0yw44_149560_c1 | nmdc:mga0yw44_149560_c1_543_1241 | 220 |
| 191 | 3300050493 | nmdc:mga0k408_39442_c1 | nmdc:mga0k408_39442_c1_1049_1732 | 220 |
| 192 | iso_pu_bacteria | 2738543013 | 2739251559 | 220 |
| 193 | 3300041512 | Ga0451853_1934982 | Ga0451853_1934982_81_824 | 221 |
| 194 | 3300046501 | Ga0495607_0000862 | Ga0495607_0000862_26601_27281 | 221 |
| 195 | 3300046519 | Ga0495632_0000936 | Ga0495632_0000936_15782_16462 | 221 |
| 196 | 3300046665 | Ga0495661_0000569 | Ga0495661_0000569_12451_13131 | 221 |
| 197 | 3300047445 | Ga0495677_0002989 | Ga0495677_0002989_5353_6033 | 221 |
| 198 | iso_pu_bacteria | 2547132374 | 2548500437 | 221 |
| 199 | iso_pu_bacteria | 2643221596 | 2643992845 | 221 |
| 200 | iso_pu_bacteria | 2643221717 | 2644647016 | 221 |
| 201 | 3300028794 | Ga0307515_10000013 | Ga0307515_10000013423 | 222 |
| 202 | 3300028794 | Ga0307515_10076790 | Ga0307515_100767903 | 222 |
| 203 | 3300031911 | Ga0307412_10377442 | Ga0307412_103774422 | 222 |
| 204 | 3300042134 | Ga0450898_003764 | Ga0450898_003764_595_1278 | 222 |
| 205 | 3300042435 | Ga0439434_0029557 | Ga0439434_0029557_893_1576 | 222 |
| 206 | 3300042439 | Ga0439464_0025663 | Ga0439464_0025663_839_1522 | 222 |
| 207 | 3300044673 | Ga0453683_0023502 | Ga0453683_0023502_312_1001 | 222 |
| 208 | 3300045051 | Ga0451576_0027515 | Ga0451576_0027515_1502_2191 | 222 |
| 209 | 3300045051 | Ga0451576_0059345 | Ga0451576_0059345_1866_2558 | 222 |
| 210 | 3300049515 | Ga0501292_002050 | Ga0501292_002050_1369_2055 | 222 |
| 211 | 3300049526 | Ga0501303_007357 | Ga0501303_007357_63_749 | 222 |
| 212 | 3300049686 | Ga0501257_057085 | Ga0501257_057085_121_807 | 222 |
| 213 | 3300049762 | Ga0501265_000976 | Ga0501265_000976_843_1529 | 222 |
| 214 | 3300050493 | nmdc:mga0k408_239158_c1 | nmdc:mga0k408_239158_c1_400_1074 | 222 |
| 215 | 3300003322 | rootL2_10116331 | rootL2_101163312 | 223 |
| 216 | 3300003792 | Ga0055540_1006756 | Ga0055540_10067565 | 223 |
| 217 | 3300003794 | Ga0055531_10000281 | Ga0055531_1000028145 | 223 |
| 218 | 3300005262 | Ga0065165_1011135 | Ga0065165_10111352 | 223 |
| 219 | 3300005331 | Ga0070670_100242257 | Ga0070670_1002422571 | 223 |
| 220 | 3300005841 | Ga0068863_100029648 | Ga0068863_1000296484 | 223 |
| 221 | 3300006177 | Ga0075362_10173773 | Ga0075362_101737732 | 223 |
| 222 | 3300006195 | Ga0075366_10121419 | Ga0075366_101214192 | 223 |
| 223 | 3300006195 | Ga0075366_10245859 | Ga0075366_102458592 | 223 |
| 224 | 3300006846 | Ga0075430_100119424 | Ga0075430_1001194243 | 223 |
| 225 | 3300006880 | Ga0075429_100180358 | Ga0075429_1001803583 | 223 |
| 226 | 3300009177 | Ga0105248_10272844 | Ga0105248_102728443 | 223 |
| 227 | 3300025273 | Ga0209673_1005024 | Ga0209673_10050247 | 223 |
| 228 | 3300025302 | Ga0207426_1040619 | Ga0207426_10406192 | 223 |
| 229 | 3300025303 | Ga0209051_1000172 | Ga0209051_100017297 | 223 |
| 230 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015490 | 223 |
| 231 | 3300025304 | Ga0209257_1000108 | Ga0209257_1000108220 | 223 |
| 232 | 3300025925 | Ga0207650_10200872 | Ga0207650_102008721 | 223 |
| 233 | 3300026067 | Ga0207678_10187797 | Ga0207678_101877972 | 223 |
| 234 | 3300026088 | Ga0207641_10031669 | Ga0207641_100316693 | 223 |
| 235 | 3300026089 | Ga0207648_10006743 | Ga0207648_100067432 | 223 |
| 236 | 3300026095 | Ga0207676_10081765 | Ga0207676_100817652 | 223 |
| 237 | 3300031548 | Ga0307408_100369941 | Ga0307408_1003699412 | 223 |
| 238 | 3300033180 | Ga0307510_10144733 | Ga0307510_101447332 | 223 |
| 239 | 3300037312 | Ga0395899_0006012 | Ga0395899_0006012_6927_7613 | 223 |
| 240 | 3300037466 | Ga0395898_0206681 | Ga0395898_0206681_287_973 | 223 |
| 241 | 3300041406 | Ga0439439_0024695 | Ga0439439_0024695_609_1304 | 223 |
| 242 | 3300042004 | Ga0439445_0006557 | Ga0439445_0006557_1725_2423 | 223 |
| 243 | 3300042007 | Ga0439449_0000091 | Ga0439449_0000091_3447_4142 | 223 |
| 244 | 3300042015 | Ga0439462_0010996 | Ga0439462_0010996_1070_1759 | 223 |
| 245 | 3300042115 | Ga0450911_000074 | Ga0450911_000074_37013_37711 | 223 |
| 246 | 3300042876 | Ga0451577_0381673 | Ga0451577_0381673_401_1084 | 223 |
| 247 | 3300044712 | Ga0453684_0103234 | Ga0453684_0103234_464_1147 | 223 |
| 248 | 3300045051 | Ga0451576_0006443 | Ga0451576_0006443_10365_11048 | 223 |
| 249 | 3300048090 | Ga0495615_0074492 | Ga0495615_0074492_183_869 | 223 |
| 250 | 3300048924 | Ga0496121_0003833 | Ga0496121_0003833_17516_18214 | 223 |
| 251 | 3300048928 | Ga0496125_0016204 | Ga0496125_0016204_4612_5310 | 223 |
| 252 | 3300049682 | Ga0501252_000940 | Ga0501252_000940_1423_2106 | 223 |
| 253 | 3300050489 | nmdc:mga03683_151002_c1 | nmdc:mga03683_151002_c1_247_933 | 223 |
| 254 | 3300050489 | nmdc:mga03683_211883_c1 | nmdc:mga03683_211883_c1_39_725 | 223 |
| 255 | 3300053090 | Ga0500646_0032876 | Ga0500646_0032876_508_1278 | 223 |
| 256 | 2162886012 | MBSR1b_contig_8477249 | MBSR1b_0907.00000570 | 224 |
| 257 | 3300002987 | JGI25159J45721_1013944 | JGI25159J45721_10139443 | 224 |
| 258 | 3300003781 | Ga0055536_1028981 | Ga0055536_10289812 | 224 |
| 259 | 3300003784 | Ga0055534_1000530 | Ga0055534_10005308 | 224 |
| 260 | 3300005262 | Ga0065165_1027648 | Ga0065165_10276482 | 224 |
| 261 | 3300005293 | Ga0065715_10319995 | Ga0065715_103199952 | 224 |
| 262 | 3300005327 | Ga0070658_10452261 | Ga0070658_104522612 | 224 |
| 263 | 3300005330 | Ga0070690_100043980 | Ga0070690_1000439802 | 224 |
| 264 | 3300005331 | Ga0070670_100029231 | Ga0070670_1000292312 | 224 |
| 265 | 3300005334 | Ga0068869_100024432 | Ga0068869_1000244323 | 224 |
| 266 | 3300005335 | Ga0070666_10004700 | Ga0070666_100047004 | 224 |
| 267 | 3300005340 | Ga0070689_100216918 | Ga0070689_1002169182 | 224 |
| 268 | 3300005343 | Ga0070687_100165341 | Ga0070687_1001653412 | 224 |
| 269 | 3300005347 | Ga0070668_100049584 | Ga0070668_1000495842 | 224 |
| 270 | 3300005353 | Ga0070669_100026225 | Ga0070669_1000262252 | 224 |
| 271 | 3300005354 | Ga0070675_100000772 | Ga0070675_1000007723 | 224 |
| 272 | 3300005355 | Ga0070671_100003449 | Ga0070671_1000034495 | 224 |
| 273 | 3300005356 | Ga0070674_100330193 | Ga0070674_1003301932 | 224 |
| 274 | 3300005364 | Ga0070673_100007674 | Ga0070673_1000076747 | 224 |
| 275 | 3300005365 | Ga0070688_100011377 | Ga0070688_1000113774 | 224 |
| 276 | 3300005367 | Ga0070667_100007507 | Ga0070667_1000075078 | 224 |
| 277 | 3300005445 | Ga0070708_100028056 | Ga0070708_1000280566 | 224 |
| 278 | 3300005455 | Ga0070663_100365192 | Ga0070663_1003651922 | 224 |
| 279 | 3300005456 | Ga0070678_100001367 | Ga0070678_1000013676 | 224 |
| 280 | 3300005457 | Ga0070662_100084585 | Ga0070662_1000845852 | 224 |
| 281 | 3300005466 | Ga0070685_10019694 | Ga0070685_100196943 | 224 |
| 282 | 3300005471 | Ga0070698_100546082 | Ga0070698_1005460821 | 224 |
| 283 | 3300005544 | Ga0070686_100058661 | Ga0070686_1000586612 | 224 |
| 284 | 3300005564 | Ga0070664_100390120 | Ga0070664_1003901201 | 224 |
| 285 | 3300005615 | Ga0070702_100065538 | Ga0070702_1000655382 | 224 |
| 286 | 3300005616 | Ga0068852_100045658 | Ga0068852_1000456583 | 224 |
| 287 | 3300005617 | Ga0068859_100006800 | Ga0068859_1000068005 | 224 |
| 288 | 3300005618 | Ga0068864_100000270 | Ga0068864_10000027019 | 224 |
| 289 | 3300005718 | Ga0068866_10397951 | Ga0068866_103979511 | 224 |
| 290 | 3300005719 | Ga0068861_100193452 | Ga0068861_1001934522 | 224 |
| 291 | 3300005834 | Ga0068851_10033125 | Ga0068851_100331252 | 224 |
| 292 | 3300005841 | Ga0068863_100000679 | Ga0068863_10000067917 | 224 |
| 293 | 3300005842 | Ga0068858_100000225 | Ga0068858_10000022519 | 224 |
| 294 | 3300005844 | Ga0068862_100265059 | Ga0068862_1002650592 | 224 |
| 295 | 3300006177 | Ga0075362_10218154 | Ga0075362_102181542 | 224 |
| 296 | 3300006195 | Ga0075366_10006288 | Ga0075366_100062886 | 224 |
| 297 | 3300006237 | Ga0097621_100014089 | Ga0097621_1000140894 | 224 |
| 298 | 3300006881 | Ga0068865_100434033 | Ga0068865_1004340331 | 224 |
| 299 | 3300006931 | Ga0097620_100006800 | Ga0097620_1000068007 | 224 |
| 300 | 3300009177 | Ga0105248_10052904 | Ga0105248_100529043 | 224 |
| 301 | 3300009553 | Ga0105249_10291018 | Ga0105249_102910181 | 224 |
| 302 | 3300013296 | Ga0157374_10098434 | Ga0157374_100984342 | 224 |
| 303 | 3300013306 | Ga0163162_10006036 | Ga0163162_100060365 | 224 |
| 304 | 3300013308 | Ga0157375_10004784 | Ga0157375_100047842 | 224 |
| 305 | 3300013308 | Ga0157375_10510818 | Ga0157375_105108182 | 224 |
| 306 | 3300014325 | Ga0163163_10004407 | Ga0163163_100044072 | 224 |
| 307 | 3300014326 | Ga0157380_10106623 | Ga0157380_101066232 | 224 |
| 308 | 3300014968 | Ga0157379_10082372 | Ga0157379_100823722 | 224 |
| 309 | 3300014969 | Ga0157376_10104115 | Ga0157376_101041153 | 224 |
| 310 | 3300014969 | Ga0157376_10883307 | Ga0157376_108833071 | 224 |
| 311 | 3300025284 | Ga0209130_1001418 | Ga0209130_10014186 | 224 |
| 312 | 3300025291 | Ga0209675_1000811 | Ga0209675_100081112 | 224 |
| 313 | 3300025292 | Ga0209676_1002690 | Ga0209676_10026907 | 224 |
| 314 | 3300025295 | Ga0209564_1042314 | Ga0209564_10423141 | 224 |
| 315 | 3300025303 | Ga0209051_1006266 | Ga0209051_10062667 | 224 |
| 316 | 3300025304 | Ga0209257_1004206 | Ga0209257_100420613 | 224 |
| 317 | 3300025321 | Ga0207656_10018663 | Ga0207656_100186632 | 224 |
| 318 | 3300025903 | Ga0207680_10000416 | Ga0207680_100004165 | 224 |
| 319 | 3300025908 | Ga0207643_10082035 | Ga0207643_100820352 | 224 |
| 320 | 3300025909 | Ga0207705_10390906 | Ga0207705_103909062 | 224 |
| 321 | 3300025918 | Ga0207662_10236151 | Ga0207662_102361512 | 224 |
| 322 | 3300025923 | Ga0207681_10181500 | Ga0207681_101815002 | 224 |
| 323 | 3300025924 | Ga0207694_10770589 | Ga0207694_107705891 | 224 |
| 324 | 3300025925 | Ga0207650_10019320 | Ga0207650_100193204 | 224 |
| 325 | 3300025926 | Ga0207659_10000337 | Ga0207659_100003378 | 224 |
| 326 | 3300025931 | Ga0207644_10000543 | Ga0207644_1000054311 | 224 |
| 327 | 3300025933 | Ga0207706_10125540 | Ga0207706_101255402 | 224 |
| 328 | 3300025936 | Ga0207670_10181459 | Ga0207670_101814591 | 224 |
| 329 | 3300025937 | Ga0207669_10177988 | Ga0207669_101779882 | 224 |
| 330 | 3300025941 | Ga0207711_10299562 | Ga0207711_102995622 | 224 |
| 331 | 3300025942 | Ga0207689_10084482 | Ga0207689_100844822 | 224 |
| 332 | 3300025960 | Ga0207651_10005653 | Ga0207651_100056537 | 224 |
| 333 | 3300025986 | Ga0207658_10018787 | Ga0207658_100187872 | 224 |
| 334 | 3300026023 | Ga0207677_10012916 | Ga0207677_100129163 | 224 |
| 335 | 3300026035 | Ga0207703_10000408 | Ga0207703_1000040827 | 224 |
| 336 | 3300026041 | Ga0207639_10558162 | Ga0207639_105581622 | 224 |
| 337 | 3300026067 | Ga0207678_10343547 | Ga0207678_103435472 | 224 |
| 338 | 3300026075 | Ga0207708_10135202 | Ga0207708_101352022 | 224 |
| 339 | 3300026088 | Ga0207641_10002842 | Ga0207641_100028422 | 224 |
| 340 | 3300026095 | Ga0207676_10000269 | Ga0207676_1000026927 | 224 |
| 341 | 3300026118 | Ga0207675_100035344 | Ga0207675_1000353443 | 224 |
| 342 | 3300026121 | Ga0207683_10001051 | Ga0207683_100010516 | 224 |
| 343 | 3300026142 | Ga0207698_10017202 | Ga0207698_100172022 | 224 |
| 344 | 3300027876 | Ga0209974_10001122 | Ga0209974_100011227 | 224 |
| 345 | 3300028380 | Ga0268265_10674096 | Ga0268265_106740962 | 224 |
| 346 | 3300028381 | Ga0268264_10197095 | Ga0268264_101970952 | 224 |
| 347 | 3300031456 | Ga0307513_10046191 | Ga0307513_100461914 | 224 |
| 348 | 3300031901 | Ga0307406_10000278 | Ga0307406_1000027821 | 224 |
| 349 | 3300032005 | Ga0307411_10236305 | Ga0307411_102363052 | 224 |
| 350 | 3300037471 | Ga0395905_0062024 | Ga0395905_0062024_2539_3237 | 224 |
| 351 | 3300038443 | Ga0395901_0406006 | Ga0395901_0406006_350_1048 | 224 |
| 352 | 3300042532 | Ga0450893_0000665 | Ga0450893_0000665_1066_1764 | 224 |
| 353 | 3300042876 | Ga0451577_0003070 | Ga0451577_0003070_5765_6463 | 224 |
| 354 | 3300044712 | Ga0453684_0009366 | Ga0453684_0009366_6763_7461 | 224 |
| 355 | 3300044842 | Ga0466957_0343700 | Ga0466957_0343700_111_809 | 224 |
| 356 | 3300045051 | Ga0451576_0141870 | Ga0451576_0141870_263_961 | 224 |
| 357 | 3300045051 | Ga0451576_0372790 | Ga0451576_0372790_758_1432 | 224 |
| 358 | 3300046459 | Ga0495629_0156247 | Ga0495629_0156247_172_846 | 224 |
| 359 | 3300046537 | Ga0495598_0019000 | Ga0495598_0019000_124_798 | 224 |
| 360 | 3300046615 | Ga0495656_0039008 | Ga0495656_0039008_383_1075 | 224 |
| 361 | 3300048090 | Ga0495615_0002514 | Ga0495615_0002514_340_1032 | 224 |
| 362 | 3300048907 | Ga0496104_0251153 | Ga0496104_0251153_922_1596 | 224 |
| 363 | 3300048909 | Ga0496106_0604314 | Ga0496106_0604314_117_791 | 224 |
| 364 | 3300048917 | Ga0496114_0534893 | Ga0496114_0534893_313_987 | 224 |
| 365 | 3300048929 | Ga0496126_0019342 | Ga0496126_0019342_3050_3751 | 224 |
| 366 | 3300049575 | Ga0501039_0544493 | Ga0501039_0544493_58_747 | 224 |
| 367 | 3300049579 | Ga0501043_0316810 | Ga0501043_0316810_31_726 | 224 |
| 368 | 3300050493 | nmdc:mga0k408_120296_c1 | nmdc:mga0k408_120296_c1_718_1401 | 224 |
| 369 | 3300050494 | nmdc:mga06z11_148706_c1 | nmdc:mga06z11_148706_c1_151_834 | 224 |
| 370 | 3300050496 | nmdc:mga07m45_101186_c1 | nmdc:mga07m45_101186_c1_704_1387 | 224 |
| 371 | iso_pu_bacteria | 2643221570 | 2643864543 | 224 |
| 372 | iso_pu_bacteria | 2643221652 | 2644291768 | 224 |
| 373 | iso_pu_bacteria | 2990710928 | 2990715122 | 224 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3npi-assembly1.cif.gz_B | crystal structure of a tetr family regulatory protein (dip1788) from corynebacterium diphtheriae at 2.96 a resolution | 0.8768 | 30 | 222 |
| 3him-assembly1.cif.gz_A | the crystal structure of a bacterial regulatory protein in the tetr family from rhodococcus rha1 to 2.2a | 0.8399 | 27 | 222 |
| 6zui-assembly1.cif.gz_A | crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid | 0.8234 | 28 | 111 |
| 7amt-assembly1.cif.gz_A | structure of luxr with dna (activation) | 0.821 | 26 | 217 |
| 4x1e-assembly1.cif.gz_B | crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant | 0.8169 | 31 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jykB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9762 | 28 | 77 | 1.10.10.60 |
| 1pb6B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9687 | 25 | 77 | 1.10.10.60 |
| 4x1eB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9668 | 31 | 77 | 1.10.10.60 |
| 4xk4A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9642 | 28 | 77 | 1.10.10.60 |
| 4xk4B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.964 | 28 | 77 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J8RZG5-F1-model_v4 | deleted | 0.984 | 64 | 224 |
|
| AF-A0A7C8TQP1-F1-model_v4 | deleted | 0.9745 | 30 | 223 |
|
| AF-A0A1V3YWI0-F1-model_v4 | deleted | 0.9738 | 33 | 224 |
|
| AF-A0A7C4E3B7-F1-model_v4 | TetR family transcriptional regulator | 0.9737 | 24 | 224 |
GO:0003677
|
| AF-A0A127F2G6-F1-model_v4 | TetR family transcriptional regulator | 0.9642 | 25 | 224 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar