F426350

General Info

Members Datasets Scaffolds Average Seq Length
373 248 324 213

Family's Representative Sequence

Representative Sequence 3300009765|Ga0123341_1017831|Ga0123341_10178314
Length 232
Sequence VLSPDYSGGYGATTHKELPMAVRVDLMISLDGFATTTDQTPEVPFGEDWPRLVGAYVATRTFRERVFKDTSGAGTTGVDDDYAKDYFANVGAEIMGAGMFGLHNFPDDPNWRGWWGDEPPFRVPVFVLTNKPRPSIEMAGGTTFHFLNATLGDALQKAIRAANGKDVRIGGGATVARDFLRAGLVDRLHIAITPILLGRGIRLWDDLRGLEAGYTVKAETAPSGTIHLTFHR

Samples

Sample ID Description Type Environment
1 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
2 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
3 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
4 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
5 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
6 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
7 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
8 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
9 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
10 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
11 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
12 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
13 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
14 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
15 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
16 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
17 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
18 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
19 2643221557 Ensifer sp. Root558 Isolate Unclassified
20 2643221607 Rhizobium sp. Root73 Isolate Unclassified
21 2643221610 Ensifer sp. Root74 Isolate Unclassified
22 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
23 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
24 2643221668 Ensifer sp. Root423 Isolate Unclassified
25 2643221675 Ensifer sp. Root1298 Isolate Unclassified
26 2643221680 Ensifer sp. Root1312 Isolate Unclassified
27 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
28 2643221726 Ensifer sp. Root954 Isolate Unclassified
29 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
30 2738543024 Aminobacter sp. AP02 Isolate Unclassified
31 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
32 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
33 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
34 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
35 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
36 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
37 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
38 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
39 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
40 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
41 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
42 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
43 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
44 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
45 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
46 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
47 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
48 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
49 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
50 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
51 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
52 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
53 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
56 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
57 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
58 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
59 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
60 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
61 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
62 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
63 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
74 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
75 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
90 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
119 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
122 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
148 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
149 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
150 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
151 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
152 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
153 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
172 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
173 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
196 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
216 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
217 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
235 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
236 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
237 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
238 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
239 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
240 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
242 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
243 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
244 8005258706 Rhizobium sp. R693 Isolate Nodule
245 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
246 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
247 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
248 8054913762 Frankia gtarii Agncl-10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.6
Metatranscriptomes 0.27
Isolates 13.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.18
Nodule 7.77
Rhizoplane 8.04
Rhizosphere 40.48
Stem 0
Stem Tuber 0
Unclassified 22.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002940 3300001979 Bacteria 7573
2 JGI24740J21852_10004479 3300001979 Bacteria 6011
3 JGI25155J39150_1000032 3300002704 Bacteria 105511
4 JGI25156J39149_1000153 3300002705 Bacteria 50769
5 JGI25162J39368_1000442 3300002737 Bacteria 32936
6 JGI25162J39368_1000745 3300002737 Bacteria 22268
7 JGI25154J39366_1000152 3300002738 Bacteria 53779
8 JGI25158J39367_1001480 3300002739 Bacteria 4105
9 JGI25157J39369_1000061 3300002741 Bacteria 105511
10 JGI25152J39213_1001704 3300002773 Bacteria 9027
11 JGI25152J39213_1001791 3300002773 Bacteria 8718
12 JGI25152J39213_1006329 3300002773 Bacteria 3253
13 JGI25150J39212_1000390 3300002774 Bacteria 20897
14 JGI25159J45721_1001734 3300002987 Bacteria 8797
15 JGI25159J45721_1006392 3300002987 Bacteria 3532
16 JGI25151J46595_10000355 3300003187 Bacteria 48795
17 JGI25151J46595_10004478 3300003187 Bacteria 7389
18 JGI25151J46595_10079980 3300003187 Bacteria 951
19 JGI25165J46597_1000565 3300003214 Bacteria 33508
20 JGI25165J46597_1000639 3300003214 Bacteria 29032
21 JGI25153J46596_10001931 3300003215 Bacteria 12315
22 JGI25153J46596_10017863 3300003215 Bacteria 2776
23 rootH2_10051152 3300003320 Bacteria 10279
24 JGI25160J50197_1011554 3300003354 Bacteria 3123
25 JGI25161J50226_1002708 3300003374 Bacteria 4389
26 Ga0055526_1015641 3300003771 Bacteria 3034
27 Ga0055526_1061693 3300003771 Bacteria 797
28 Ga0055524_1005168 3300003775 Bacteria 5883
29 Ga0055524_1005170 3300003775 Bacteria 5881
30 Ga0055524_1006073 3300003775 Bacteria 5289
31 Ga0055524_1007593 3300003775 Bacteria 4585
32 Ga0055528_1000290 3300003790 Bacteria 42833
33 Ga0055528_1011373 3300003790 Bacteria 3542
34 Ga0055540_1012703 3300003792 Bacteria 2623
35 Ga0055540_1042823 3300003792 Bacteria 968
36 Ga0055543_1000208 3300004625 Bacteria 47499
37 Ga0070666_10063062 3300005335 Bacteria 2512
38 Ga0070659_100104552 3300005366 Bacteria 2281
39 Ga0070681_10809592 3300005458 Bacteria 854
40 Ga0070665_100243693 3300005548 Bacteria 1798
41 Ga0070665_100276012 3300005548 Bacteria 1683
42 Ga0068856_100024869 3300005614 Bacteria 5834
43 Ga0075367_10318531 3300006178 Bacteria 980
44 Ga0105251_10142887 3300009011 Bacteria 1082
45 Ga0105247_10214836 3300009101 Bacteria 1299
46 Ga0105243_10117094 3300009148 Bacteria 2239
47 Ga0105237_10101390 3300009545 Bacteria 2871
48 Ga0105237_10130997 3300009545 Bacteria 2502
49 Ga0123340_1000192 3300009763 Bacteria 32932
50 Ga0123340_1013425 3300009763 Bacteria 7294
51 Ga0123341_1000928 3300009765 Bacteria 20507
52 Ga0123341_1017831 3300009765 Bacteria 6195
53 Ga0123342_1014235 3300009766 Bacteria 7664
54 Ga0105239_10598165 3300010375 Bacteria 1258
55 Ga0157319_1004935 3300012497 Bacteria 898
56 Ga0157373_10135073 3300013100 Bacteria 1734
57 Ga0157369_10063873 3300013105 Bacteria 3966
58 Ga0157374_10003915 3300013296 Bacteria 12508
59 Ga0157374_10026225 3300013296 Bacteria 5243
60 Ga0157378_10210618 3300013297 Bacteria 1843
61 Ga0163162_10429200 3300013306 Bacteria 1454
62 Ga0157372_10071002 3300013307 Bacteria 3920
63 Ga0157375_10212267 3300013308 Bacteria 2093
64 Ga0163163_10089073 3300014325 Bacteria 3098
65 Ga0163163_10426256 3300014325 Bacteria 1386
66 Ga0157379_10055459 3300014968 Bacteria 3540
67 Ga0163161_10454521 3300017792 Bacteria 1036
68 Ga0224712_10109937 3300022467 Bacteria 1181
69 Ga0209435_100042 3300025206 Bacteria 105563
70 Ga0209436_100077 3300025208 Bacteria 49473
71 Ga0209437_100042 3300025233 Bacteria 444095
72 Ga0209437_100075 3300025233 Bacteria 297202
73 Ga0207425_1000052 3300025245 Bacteria 162123
74 Ga0209646_1000145 3300025246 Bacteria 105563
75 Ga0209026_1000160 3300025250 Bacteria 105563
76 Ga0209759_1000177 3300025256 Bacteria 105563
77 Ga0209129_1000141 3300025258 Bacteria 119150
78 Ga0209129_1000307 3300025258 Bacteria 44447
79 Ga0209129_1001060 3300025258 Bacteria 16231
80 Ga0209129_1004683 3300025258 Bacteria 5213
81 Ga0209233_1000054 3300025261 Bacteria 439669
82 Ga0209233_1000056 3300025261 Bacteria 438104
83 Ga0209565_1020827 3300025263 Bacteria 1379
84 Ga0209455_1009368 3300025272 Bacteria 2577
85 Ga0209673_1000010 3300025273 Bacteria 596656
86 Ga0209673_1001897 3300025273 Bacteria 16782
87 Ga0209673_1003858 3300025273 Bacteria 8461
88 Ga0209673_1007854 3300025273 Bacteria 4833
89 Ga0209673_1026901 3300025273 Bacteria 1880
90 Ga0209673_1029707 3300025273 Bacteria 1735
91 Ga0209130_1000015 3300025284 Bacteria 409631
92 Ga0209130_1047409 3300025284 Bacteria 797
93 Ga0209676_1035876 3300025292 Bacteria 1449
94 Ga0209025_1000144 3300025294 Bacteria 181446
95 Ga0209025_1005264 3300025294 Bacteria 10646
96 Ga0209025_1050027 3300025294 Bacteria 1675
97 Ga0209025_1064112 3300025294 Bacteria 1352
98 Ga0209564_1001802 3300025295 Bacteria 19770
99 Ga0209564_1014406 3300025295 Bacteria 3292
100 Ga0209564_1015808 3300025295 Bacteria 3048
101 Ga0209564_1032491 3300025295 Bacteria 1571
102 Ga0209564_1051576 3300025295 Bacteria 997
103 Ga0209758_1000229 3300025297 Bacteria 119657
104 Ga0209758_1000943 3300025297 Bacteria 39158
105 Ga0209256_1000342 3300025299 Bacteria 76053
106 Ga0209256_1000655 3300025299 Bacteria 47114
107 Ga0209256_1002285 3300025299 Bacteria 16167
108 Ga0209256_1006083 3300025299 Bacteria 6558
109 Ga0209256_1043315 3300025299 Bacteria 1131
110 Ga0207426_1000144 3300025302 Bacteria 191590
111 Ga0207426_1000601 3300025302 Bacteria 47086
112 Ga0209051_1001091 3300025303 Bacteria 25068
113 Ga0209051_1069696 3300025303 Bacteria 1064
114 Ga0207680_10265053 3300025903 Bacteria 1190
115 Ga0207707_10777288 3300025912 Bacteria 799
116 Ga0207671_10265598 3300025914 Bacteria 1351
117 Ga0207677_10780154 3300026023 Bacteria 854
118 Ga0207678_10204987 3300026067 Bacteria 1687
119 Ga0207702_10062381 3300026078 Bacteria 3183
120 Ga0207702_10481251 3300026078 Bacteria 1208
121 Ga0207674_10957465 3300026116 Bacteria 825
122 Ga0207675_100216872 3300026118 Bacteria 1842
123 Ga0207698_11148012 3300026142 Bacteria 790
124 Ga0265337_1018217 3300028556 Bacteria 2235
125 Ga0265319_1037726 3300028563 Bacteria 1645
126 Ga0265318_10031780 3300028577 Bacteria 2045
127 Ga0265318_10036706 3300028577 Bacteria 1879
128 Ga0265318_10057370 3300028577 Bacteria 1455
129 Ga0265322_10012796 3300028654 Bacteria 2430
130 Ga0265336_10014434 3300028666 Bacteria 2618
131 Ga0307515_10011766 3300028794 Bacteria 16559
132 Ga0307515_10037144 3300028794 Bacteria 7846
133 Ga0265338_10045744 3300028800 Bacteria 4020
134 Ga0265338_10082197 3300028800 Bacteria 2698
135 Ga0265324_10005894 3300029957 Bacteria 5206
136 Ga0265332_10108515 3300031238 Bacteria 1170
137 Ga0265320_10002961 3300031240 Bacteria 11613
138 Ga0265329_10027038 3300031242 Bacteria 1887
139 Ga0265340_10001221 3300031247 Bacteria 14714
140 Ga0265339_10048498 3300031249 Bacteria 2328
141 Ga0265316_10040234 3300031344 Bacteria 3749
142 Ga0265316_10199705 3300031344 Bacteria 1483
143 Ga0265316_10423913 3300031344 Bacteria 956
144 Ga0307513_10163301 3300031456 Bacteria 2116
145 Ga0307408_100457181 3300031548 Bacteria 1109
146 Ga0265313_10232286 3300031595 Bacteria 757
147 Ga0265314_10001141 3300031711 Bacteria 30771
148 Ga0265314_10019958 3300031711 Bacteria 5182
149 Ga0307516_10096847 3300031730 Bacteria 2771
150 Ga0307405_10000214 3300031731 Bacteria 20972
151 Ga0307406_10002484 3300031901 Bacteria 10053
152 Ga0373945_0141039 3300035116 Bacteria 972
153 Ga0373927_0004964 3300035695 Bacteria 9222
154 Ga0395899_0003986 3300037312 Bacteria 11635
155 Ga0395900_0026645 3300037418 Bacteria 5919
156 Ga0395900_0092780 3300037418 Bacteria 3102
157 Ga0395900_0500349 3300037418 Bacteria 1166
158 Ga0395898_0131357 3300037466 Bacteria 2398
159 Ga0395905_0000708 3300037471 Bacteria 44246
160 Ga0395905_0010415 3300037471 Bacteria 9047
161 Ga0395901_0001383 3300038443 Bacteria 25376
162 Ga0436361_0826924 3300039447 Bacteria 2340
163 Ga0451833_0116448 3300041491 Bacteria 10406
164 Ga0451837_1489494 3300041494 Bacteria 1109
165 Ga0451837_1539295 3300041494 Bacteria 817
166 Ga0451839_1431035 3300041496 Bacteria 1286
167 Ga0451841_0727743 3300041498 Bacteria 903
168 Ga0451847_0556126 3300041503 Bacteria 2219
169 Ga0451849_0580103 3300041505 Bacteria 1501
170 Ga0451855_1673567 3300041511 Bacteria 2135
171 Ga0451853_0074249 3300041512 Bacteria 1435
172 Ga0451577_0456448 3300042876 Bacteria 1160
173 Ga0466972_0013883 3300044658 Bacteria 4042
174 Ga0466966_0042483 3300044684 Bacteria 2918
175 Ga0466961_0041911 3300044693 Bacteria 2935
176 Ga0466961_0204262 3300044693 Bacteria 1221
177 Ga0466963_0003834 3300044694 Bacteria 8672
178 Ga0466963_0021382 3300044694 Bacteria 4081
179 Ga0466964_0012693 3300044706 Bacteria 3189
180 Ga0466971_0075803 3300044719 Bacteria 1530
181 Ga0466971_0215215 3300044719 Bacteria 909
182 Ga0466970_0000048 3300044765 Bacteria 44814
183 Ga0466970_0005521 3300044765 Bacteria 6279
184 Ga0466957_0256908 3300044842 Bacteria 1163
185 Ga0466960_0007422 3300044901 Bacteria 4453
186 Ga0466958_0036125 3300045836 Bacteria 2956
187 Ga0466958_0125303 3300045836 Bacteria 1610
188 Ga0466967_0035963 3300045976 Bacteria 4223
189 Ga0495592_0089454 3300046454 Bacteria 2211
190 Ga0495629_0347913 3300046459 Bacteria 1011
191 Ga0495651_0437694 3300046462 Bacteria 847
192 Ga0495662_0283455 3300046476 Bacteria 815
193 Ga0495585_0039529 3300046492 Bacteria 2651
194 Ga0495585_0080131 3300046492 Bacteria 1770
195 Ga0495607_0056812 3300046501 Bacteria 2245
196 Ga0495583_0057664 3300046506 Bacteria 1745
197 Ga0495606_0003512 3300046507 Bacteria 16572
198 Ga0495606_0177289 3300046507 Bacteria 1232
199 Ga0495608_0217507 3300046511 Bacteria 1200
200 Ga0495610_0000605 3300046512 Bacteria 35518
201 Ga0495620_0103331 3300046515 Bacteria 1134
202 Ga0495628_0303308 3300046516 Bacteria 1182
203 Ga0495630_0319521 3300046517 Bacteria 1187
204 Ga0495631_0057037 3300046518 Bacteria 1700
205 Ga0495631_0100642 3300046518 Bacteria 1244
206 Ga0495632_0002527 3300046519 Bacteria 13861
207 Ga0495643_0039821 3300046522 Bacteria 2569
208 Ga0495648_0036383 3300046524 Bacteria 3178
209 Ga0495587_0090294 3300046536 Bacteria 1770
210 Ga0495633_0062401 3300046558 Bacteria 1745
211 Ga0495633_0147670 3300046558 Bacteria 1086
212 Ga0495656_0028691 3300046615 Bacteria 2234
213 Ga0495625_0041929 3300046660 Bacteria 3329
214 Ga0495625_0054328 3300046660 Bacteria 2861
215 Ga0495625_0062680 3300046660 Bacteria 2627
216 Ga0495635_0211922 3300046663 Bacteria 1312
217 Ga0495661_0111539 3300046665 Bacteria 1524
218 Ga0495588_0057050 3300046674 Bacteria 2017
219 Ga0495588_0067965 3300046674 Bacteria 1850
220 Ga0495588_0082782 3300046674 Bacteria 1676
221 Ga0495657_0073438 3300046675 Bacteria 2228
222 Ga0495623_0450407 3300046679 Bacteria 685
223 Ga0495658_0045773 3300046683 Bacteria 2457
224 Ga0495670_0319283 3300046691 Bacteria 834
225 Ga0495671_0053893 3300046692 Bacteria 1995
226 Ga0495589_0058532 3300046794 Bacteria 1895
227 Ga0495600_0130565 3300046809 Bacteria 1633
228 Ga0495604_0020586 3300047317 Bacteria 5268
229 Ga0495681_0064955 3300047470 Bacteria 1670
230 Ga0495686_0001023 3300047472 Bacteria 33801
231 Ga0495686_0096641 3300047472 Bacteria 1787
232 Ga0495686_0247885 3300047472 Bacteria 1002
233 Ga0496100_0345828 3300048903 Bacteria 1122
234 Ga0496101_0165992 3300048904 Bacteria 1695
235 Ga0496102_0058643 3300048905 Bacteria 3518
236 Ga0496102_0628128 3300048905 Bacteria 997
237 Ga0496104_0020766 3300048907 Bacteria 6023
238 Ga0496104_0021117 3300048907 Bacteria 5973
239 Ga0496104_0129639 3300048907 Bacteria 2422
240 Ga0496104_0378449 3300048907 Bacteria 1328
241 Ga0496105_0005498 3300048908 Bacteria 9615
242 Ga0496105_0036698 3300048908 Bacteria 4039
243 Ga0496105_0099900 3300048908 Bacteria 2396
244 Ga0496105_0112939 3300048908 Bacteria 2242
245 Ga0496106_0261580 3300048909 Bacteria 1384
246 Ga0496107_0246588 3300048910 Bacteria 1329
247 Ga0496108_0000963 3300048911 Bacteria 22402
248 Ga0496108_0002032 3300048911 Bacteria 16203
249 Ga0496109_0015040 3300048912 Bacteria 6734
250 Ga0496109_0103110 3300048912 Bacteria 2647
251 Ga0496109_0272860 3300048912 Bacteria 1594
252 Ga0496110_0088942 3300048913 Bacteria 2759
253 Ga0496110_0384559 3300048913 Bacteria 1279
254 Ga0496111_0016000 3300048914 Bacteria 5162
255 Ga0496112_0020940 3300048915 Bacteria 6209
256 Ga0496112_0024533 3300048915 Bacteria 5776
257 Ga0496112_0028009 3300048915 Bacteria 5435
258 Ga0496113_0034233 3300048916 Bacteria 3704
259 Ga0496113_0230945 3300048916 Bacteria 1475
260 Ga0496115_0000065 3300048918 Bacteria 98148
261 Ga0496115_0015655 3300048918 Bacteria 5757
262 Ga0496116_0001740 3300048919 Bacteria 23718
263 Ga0496116_0024172 3300048919 Bacteria 4500
264 Ga0496116_0138625 3300048919 Bacteria 1372
265 Ga0496116_0139771 3300048919 Bacteria 1364
266 Ga0496117_0002986 3300048920 Bacteria 20375
267 Ga0496117_0015958 3300048920 Bacteria 6364
268 Ga0496117_0225365 3300048920 Bacteria 1040
269 Ga0496117_0267226 3300048920 Bacteria 923
270 Ga0496118_0015451 3300048921 Bacteria 7065
271 Ga0496118_0022692 3300048921 Bacteria 5476
272 Ga0496118_0106975 3300048921 Bacteria 1869
273 Ga0496119_0021212 3300048922 Bacteria 4704
274 Ga0496119_0030880 3300048922 Bacteria 3603
275 Ga0496119_0052777 3300048922 Bacteria 2488
276 Ga0496119_0257256 3300048922 Bacteria 878
277 Ga0496121_0002116 3300048924 Bacteria 31203
278 Ga0496121_0020106 3300048924 Bacteria 6630
279 Ga0496121_0054282 3300048924 Bacteria 3350
280 Ga0496121_0079881 3300048924 Bacteria 2595
281 Ga0496121_0130742 3300048924 Bacteria 1879
282 Ga0496121_0174318 3300048924 Bacteria 1559
283 Ga0496121_0586944 3300048924 Bacteria 690
284 Ga0496122_0026329 3300048925 Bacteria 5017
285 Ga0496122_0038631 3300048925 Bacteria 3819
286 Ga0496122_0137222 3300048925 Bacteria 1538
287 Ga0496122_0238537 3300048925 Bacteria 1027
288 Ga0496122_0259529 3300048925 Bacteria 965
289 Ga0496123_0003809 3300048926 Bacteria 16476
290 Ga0496123_0025451 3300048926 Bacteria 4461
291 Ga0496123_0034791 3300048926 Bacteria 3601
292 Ga0496123_0117113 3300048926 Bacteria 1507
293 Ga0496123_0188946 3300048926 Bacteria 1067
294 Ga0496123_0210194 3300048926 Bacteria 990
295 Ga0496124_0001895 3300048927 Bacteria 28742
296 Ga0496124_0004930 3300048927 Bacteria 15320
297 Ga0496124_0014181 3300048927 Bacteria 7722
298 Ga0496124_0080554 3300048927 Bacteria 2679
299 Ga0496124_0248786 3300048927 Bacteria 1316
300 Ga0496125_0003999 3300048928 Bacteria 17339
301 Ga0496125_0217721 3300048928 Bacteria 1233
302 Ga0496125_0372127 3300048928 Bacteria 845
303 Ga0496125_0399677 3300048928 Bacteria 803
304 Ga0496126_0000185 3300048929 Bacteria 140051
305 Ga0496126_0046348 3300048929 Bacteria 3988
306 Ga0501033_0000644 3300049570 Bacteria 32304
307 Ga0501033_0156117 3300049570 Bacteria 1644
308 Ga0501034_0876353 3300049571 Bacteria 787
309 Ga0501042_0000840 3300049578 Bacteria 17087
310 Ga0501047_0500309 3300049581 Bacteria 1042
311 Ga0501238_003960 3300049671 Bacteria 1836
312 Ga0501083_0000042 3300049744 Bacteria 92618
313 Ga0501035_0402180 3300049822 Bacteria 1139
314 Ga0501044_0073469 3300049823 Bacteria 3476
315 Ga0495601_0501088 3300053077 Bacteria 784
316 Ga0500608_044672 3300053122 Bacteria 2127
317 Ga0500614_066403 3300053123 Bacteria 981
318 Ga0500568_0058081 3300053139 Bacteria 1504
319 Ga0500590_015246 3300053148 Bacteria 3966
320 Ga0500622_0098807 3300053156 Bacteria 1440
321 Ga0500627_0133460 3300053158 Bacteria 1121
322 Ga0500627_0186977 3300053158 Bacteria 931
323 Ga0500636_0016649 3300053177 Bacteria 4336
324 Ga0466962_0150606 3300061719 Bacteria 1128

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025912 Ga0207707_10777288 Ga0207707_107772881 195
2 iso_pu_bacteria 8024486573 8024489131 195
3 3300005366 Ga0070659_100104552 Ga0070659_1001045522 196
4 3300048915 Ga0496112_0028009 Ga0496112_0028009_3877_4701 196
5 3300035695 Ga0373927_0004964 Ga0373927_0004964_1755_2396 199
6 3300048912 Ga0496109_0015040 Ga0496109_0015040_1601_2242 201
7 3300003771 Ga0055526_1061693 Ga0055526_10616931 203
8 3300013105 Ga0157369_10063873 Ga0157369_100638733 204
9 3300026116 Ga0207674_10957465 Ga0207674_109574651 204
10 3300001979 JGI24740J21852_10004479 JGI24740J21852_100044795 205
11 3300005335 Ga0070666_10063062 Ga0070666_100630623 205
12 3300013100 Ga0157373_10135073 Ga0157373_101350731 205
13 3300025903 Ga0207680_10265053 Ga0207680_102650531 205
14 3300026118 Ga0207675_100216872 Ga0207675_1002168722 205
15 3300037418 Ga0395900_0500349 Ga0395900_0500349_38_676 205
16 3300049822 Ga0501035_0402180 Ga0501035_0402180_334_978 205
17 3300001979 JGI24740J21852_10002940 JGI24740J21852_100029405 206
18 3300002704 JGI25155J39150_1000032 JGI25155J39150_100003264 206
19 3300002705 JGI25156J39149_1000153 JGI25156J39149_100015313 206
20 3300002737 JGI25162J39368_1000442 JGI25162J39368_100044221 206
21 3300002737 JGI25162J39368_1000745 JGI25162J39368_10007459 206
22 3300002738 JGI25154J39366_1000152 JGI25154J39366_100015216 206
23 3300002739 JGI25158J39367_1001480 JGI25158J39367_10014806 206
24 3300002741 JGI25157J39369_1000061 JGI25157J39369_100006164 206
25 3300002773 JGI25152J39213_1001704 JGI25152J39213_10017045 206
26 3300002773 JGI25152J39213_1001791 JGI25152J39213_10017915 206
27 3300002773 JGI25152J39213_1006329 JGI25152J39213_10063293 206
28 3300002774 JGI25150J39212_1000390 JGI25150J39212_10003906 206
29 3300002987 JGI25159J45721_1001734 JGI25159J45721_10017343 206
30 3300002987 JGI25159J45721_1006392 JGI25159J45721_10063923 206
31 3300003187 JGI25151J46595_10000355 JGI25151J46595_1000035536 206
32 3300003187 JGI25151J46595_10004478 JGI25151J46595_100044787 206
33 3300003187 JGI25151J46595_10079980 JGI25151J46595_100799801 206
34 3300003214 JGI25165J46597_1000565 JGI25165J46597_10005657 206
35 3300003214 JGI25165J46597_1000639 JGI25165J46597_100063917 206
36 3300003215 JGI25153J46596_10001931 JGI25153J46596_1000193110 206
37 3300003215 JGI25153J46596_10017863 JGI25153J46596_100178633 206
38 3300003320 rootH2_10051152 rootH2_100511526 206
39 3300003354 JGI25160J50197_1011554 JGI25160J50197_10115544 206
40 3300003374 JGI25161J50226_1002708 JGI25161J50226_10027083 206
41 3300003771 Ga0055526_1015641 Ga0055526_10156414 206
42 3300003775 Ga0055524_1005168 Ga0055524_10051687 206
43 3300003775 Ga0055524_1005170 Ga0055524_10051706 206
44 3300003775 Ga0055524_1006073 Ga0055524_10060735 206
45 3300003775 Ga0055524_1007593 Ga0055524_10075935 206
46 3300003790 Ga0055528_1000290 Ga0055528_100029024 206
47 3300003790 Ga0055528_1011373 Ga0055528_10113735 206
48 3300003792 Ga0055540_1012703 Ga0055540_10127032 206
49 3300003792 Ga0055540_1042823 Ga0055540_10428232 206
50 3300004625 Ga0055543_1000208 Ga0055543_100020820 206
51 3300005458 Ga0070681_10809592 Ga0070681_108095921 206
52 3300005548 Ga0070665_100243693 Ga0070665_1002436933 206
53 3300005548 Ga0070665_100276012 Ga0070665_1002760123 206
54 3300005614 Ga0068856_100024869 Ga0068856_1000248694 206
55 3300006178 Ga0075367_10318531 Ga0075367_103185311 206
56 3300009011 Ga0105251_10142887 Ga0105251_101428872 206
57 3300009101 Ga0105247_10214836 Ga0105247_102148363 206
58 3300009148 Ga0105243_10117094 Ga0105243_101170942 206
59 3300009545 Ga0105237_10101390 Ga0105237_101013902 206
60 3300009545 Ga0105237_10130997 Ga0105237_101309972 206
61 3300009763 Ga0123340_1000192 Ga0123340_100019214 206
62 3300009763 Ga0123340_1013425 Ga0123340_10134255 206
63 3300009765 Ga0123341_1000928 Ga0123341_100092824 206
64 3300009765 Ga0123341_1017831 Ga0123341_10178314 206
65 3300009766 Ga0123342_1014235 Ga0123342_10142357 206
66 3300010375 Ga0105239_10598165 Ga0105239_105981652 206
67 3300012497 Ga0157319_1004935 Ga0157319_10049351 206
68 3300013296 Ga0157374_10003915 Ga0157374_100039155 206
69 3300013296 Ga0157374_10026225 Ga0157374_100262251 206
70 3300013297 Ga0157378_10210618 Ga0157378_102106182 206
71 3300013306 Ga0163162_10429200 Ga0163162_104292003 206
72 3300013307 Ga0157372_10071002 Ga0157372_100710024 206
73 3300013308 Ga0157375_10212267 Ga0157375_102122672 206
74 3300014325 Ga0163163_10089073 Ga0163163_100890732 206
75 3300014325 Ga0163163_10426256 Ga0163163_104262561 206
76 3300014968 Ga0157379_10055459 Ga0157379_100554593 206
77 3300017792 Ga0163161_10454521 Ga0163161_104545211 206
78 3300022467 Ga0224712_10109937 Ga0224712_101099371 206
79 3300025206 Ga0209435_100042 Ga0209435_10004265 206
80 3300025208 Ga0209436_100077 Ga0209436_10007719 206
81 3300025233 Ga0209437_100042 Ga0209437_100042393 206
82 3300025233 Ga0209437_100075 Ga0209437_100075245 206
83 3300025245 Ga0207425_1000052 Ga0207425_1000052108 206
84 3300025246 Ga0209646_1000145 Ga0209646_100014565 206
85 3300025250 Ga0209026_1000160 Ga0209026_100016065 206
86 3300025256 Ga0209759_1000177 Ga0209759_100017765 206
87 3300025258 Ga0209129_1000141 Ga0209129_100014138 206
88 3300025258 Ga0209129_1000307 Ga0209129_100030712 206
89 3300025258 Ga0209129_1001060 Ga0209129_100106011 206
90 3300025258 Ga0209129_1004683 Ga0209129_10046834 206
91 3300025261 Ga0209233_1000054 Ga0209233_1000054268 206
92 3300025261 Ga0209233_1000056 Ga0209233_100005670 206
93 3300025263 Ga0209565_1020827 Ga0209565_10208271 206
94 3300025272 Ga0209455_1009368 Ga0209455_10093681 206
95 3300025273 Ga0209673_1000010 Ga0209673_1000010438 206
96 3300025273 Ga0209673_1001897 Ga0209673_100189717 206
97 3300025273 Ga0209673_1003858 Ga0209673_10038585 206
98 3300025273 Ga0209673_1007854 Ga0209673_10078544 206
99 3300025273 Ga0209673_1026901 Ga0209673_10269012 206
100 3300025273 Ga0209673_1029707 Ga0209673_10297072 206
101 3300025284 Ga0209130_1000015 Ga0209130_1000015402 206
102 3300025284 Ga0209130_1047409 Ga0209130_10474091 206
103 3300025292 Ga0209676_1035876 Ga0209676_10358762 206
104 3300025294 Ga0209025_1000144 Ga0209025_100014488 206
105 3300025294 Ga0209025_1005264 Ga0209025_10052648 206
106 3300025294 Ga0209025_1050027 Ga0209025_10500272 206
107 3300025294 Ga0209025_1064112 Ga0209025_10641122 206
108 3300025295 Ga0209564_1001802 Ga0209564_100180219 206
109 3300025295 Ga0209564_1014406 Ga0209564_10144065 206
110 3300025295 Ga0209564_1015808 Ga0209564_10158085 206
111 3300025295 Ga0209564_1032491 Ga0209564_10324911 206
112 3300025295 Ga0209564_1051576 Ga0209564_10515762 206
113 3300025297 Ga0209758_1000229 Ga0209758_100022988 206
114 3300025297 Ga0209758_1000943 Ga0209758_10009433 206
115 3300025299 Ga0209256_1000342 Ga0209256_100034236 206
116 3300025299 Ga0209256_1000655 Ga0209256_100065512 206
117 3300025299 Ga0209256_1002285 Ga0209256_100228511 206
118 3300025299 Ga0209256_1006083 Ga0209256_10060834 206
119 3300025299 Ga0209256_1043315 Ga0209256_10433152 206
120 3300025302 Ga0207426_1000144 Ga0207426_1000144172 206
121 3300025302 Ga0207426_1000601 Ga0207426_100060144 206
122 3300025303 Ga0209051_1001091 Ga0209051_10010919 206
123 3300025303 Ga0209051_1069696 Ga0209051_10696961 206
124 3300025914 Ga0207671_10265598 Ga0207671_102655982 206
125 3300026023 Ga0207677_10780154 Ga0207677_107801541 206
126 3300026067 Ga0207678_10204987 Ga0207678_102049872 206
127 3300026078 Ga0207702_10062381 Ga0207702_100623813 206
128 3300026078 Ga0207702_10481251 Ga0207702_104812512 206
129 3300026142 Ga0207698_11148012 Ga0207698_111480121 206
130 3300028556 Ga0265337_1018217 Ga0265337_10182173 206
131 3300028563 Ga0265319_1037726 Ga0265319_10377262 206
132 3300028577 Ga0265318_10031780 Ga0265318_100317803 206
133 3300028577 Ga0265318_10036706 Ga0265318_100367064 206
134 3300028577 Ga0265318_10057370 Ga0265318_100573702 206
135 3300028654 Ga0265322_10012796 Ga0265322_100127961 206
136 3300028666 Ga0265336_10014434 Ga0265336_100144342 206
137 3300028794 Ga0307515_10011766 Ga0307515_100117663 206
138 3300028794 Ga0307515_10037144 Ga0307515_100371449 206
139 3300028800 Ga0265338_10045744 Ga0265338_100457441 206
140 3300028800 Ga0265338_10082197 Ga0265338_100821973 206
141 3300029957 Ga0265324_10005894 Ga0265324_100058945 206
142 3300031238 Ga0265332_10108515 Ga0265332_101085151 206
143 3300031240 Ga0265320_10002961 Ga0265320_100029619 206
144 3300031242 Ga0265329_10027038 Ga0265329_100270383 206
145 3300031247 Ga0265340_10001221 Ga0265340_1000122111 206
146 3300031249 Ga0265339_10048498 Ga0265339_100484983 206
147 3300031344 Ga0265316_10040234 Ga0265316_100402342 206
148 3300031344 Ga0265316_10199705 Ga0265316_101997051 206
149 3300031344 Ga0265316_10423913 Ga0265316_104239132 206
150 3300031456 Ga0307513_10163301 Ga0307513_101633013 206
151 3300031548 Ga0307408_100457181 Ga0307408_1004571811 206
152 3300031595 Ga0265313_10232286 Ga0265313_102322861 206
153 3300031711 Ga0265314_10001141 Ga0265314_100011415 206
154 3300031711 Ga0265314_10019958 Ga0265314_100199582 206
155 3300031730 Ga0307516_10096847 Ga0307516_100968472 206
156 3300031731 Ga0307405_10000214 Ga0307405_100002145 206
157 3300031901 Ga0307406_10002484 Ga0307406_100024848 206
158 3300035116 Ga0373945_0141039 Ga0373945_0141039_200_841 206
159 3300037312 Ga0395899_0003986 Ga0395899_0003986_9262_9909 206
160 3300037418 Ga0395900_0026645 Ga0395900_0026645_4657_5301 206
161 3300037418 Ga0395900_0092780 Ga0395900_0092780_2295_2942 206
162 3300037466 Ga0395898_0131357 Ga0395898_0131357_1727_2374 206
163 3300037471 Ga0395905_0000708 Ga0395905_0000708_27344_28000 206
164 3300037471 Ga0395905_0010415 Ga0395905_0010415_4054_4695 206
165 3300038443 Ga0395901_0001383 Ga0395901_0001383_20608_21300 206
166 3300039447 Ga0436361_0826924 Ga0436361_0826924_338_979 206
167 3300041491 Ga0451833_0116448 Ga0451833_0116448_1253_1894 206
168 3300041494 Ga0451837_1489494 Ga0451837_1489494_97_738 206
169 3300041494 Ga0451837_1539295 Ga0451837_1539295_80_721 206
170 3300041496 Ga0451839_1431035 Ga0451839_1431035_97_738 206
171 3300041498 Ga0451841_0727743 Ga0451841_0727743_249_890 206
172 3300041503 Ga0451847_0556126 Ga0451847_0556126_1218_1859 206
173 3300041505 Ga0451849_0580103 Ga0451849_0580103_764_1405 206
174 3300041511 Ga0451855_1673567 Ga0451855_1673567_97_738 206
175 3300041512 Ga0451853_0074249 Ga0451853_0074249_31_672 206
176 3300042876 Ga0451577_0456448 Ga0451577_0456448_119_760 206
177 3300044658 Ga0466972_0013883 Ga0466972_0013883_2595_3236 206
178 3300044684 Ga0466966_0042483 Ga0466966_0042483_1309_1950 206
179 3300044693 Ga0466961_0041911 Ga0466961_0041911_77_718 206
180 3300044693 Ga0466961_0204262 Ga0466961_0204262_25_666 206
181 3300044694 Ga0466963_0003834 Ga0466963_0003834_3976_4596 206
182 3300044694 Ga0466963_0021382 Ga0466963_0021382_1799_2440 206
183 3300044706 Ga0466964_0012693 Ga0466964_0012693_1476_2117 206
184 3300044719 Ga0466971_0075803 Ga0466971_0075803_593_1234 206
185 3300044719 Ga0466971_0215215 Ga0466971_0215215_146_787 206
186 3300044765 Ga0466970_0000048 Ga0466970_0000048_15073_15720 206
187 3300044765 Ga0466970_0005521 Ga0466970_0005521_4008_4628 206
188 3300044842 Ga0466957_0256908 Ga0466957_0256908_285_905 206
189 3300044901 Ga0466960_0007422 Ga0466960_0007422_2667_3308 206
190 3300045836 Ga0466958_0036125 Ga0466958_0036125_1489_2109 206
191 3300045836 Ga0466958_0125303 Ga0466958_0125303_426_1067 206
192 3300045976 Ga0466967_0035963 Ga0466967_0035963_2731_3351 206
193 3300046454 Ga0495592_0089454 Ga0495592_0089454_360_980 206
194 3300046459 Ga0495629_0347913 Ga0495629_0347913_86_706 206
195 3300046462 Ga0495651_0437694 Ga0495651_0437694_78_698 206
196 3300046476 Ga0495662_0283455 Ga0495662_0283455_37_657 206
197 3300046492 Ga0495585_0039529 Ga0495585_0039529_474_1115 206
198 3300046492 Ga0495585_0080131 Ga0495585_0080131_667_1308 206
199 3300046501 Ga0495607_0056812 Ga0495607_0056812_182_823 206
200 3300046506 Ga0495583_0057664 Ga0495583_0057664_694_1335 206
201 3300046507 Ga0495606_0003512 Ga0495606_0003512_10329_10970 206
202 3300046507 Ga0495606_0177289 Ga0495606_0177289_207_848 206
203 3300046511 Ga0495608_0217507 Ga0495608_0217507_171_812 206
204 3300046512 Ga0495610_0000605 Ga0495610_0000605_34452_35093 206
205 3300046515 Ga0495620_0103331 Ga0495620_0103331_103_744 206
206 3300046516 Ga0495628_0303308 Ga0495628_0303308_71_712 206
207 3300046517 Ga0495630_0319521 Ga0495630_0319521_202_822 206
208 3300046518 Ga0495631_0057037 Ga0495631_0057037_1018_1659 206
209 3300046518 Ga0495631_0100642 Ga0495631_0100642_51_692 206
210 3300046519 Ga0495632_0002527 Ga0495632_0002527_10794_11435 206
211 3300046522 Ga0495643_0039821 Ga0495643_0039821_452_1093 206
212 3300046524 Ga0495648_0036383 Ga0495648_0036383_214_855 206
213 3300046536 Ga0495587_0090294 Ga0495587_0090294_1113_1733 206
214 3300046558 Ga0495633_0062401 Ga0495633_0062401_177_818 206
215 3300046558 Ga0495633_0147670 Ga0495633_0147670_256_897 206
216 3300046615 Ga0495656_0028691 Ga0495656_0028691_904_1545 206
217 3300046660 Ga0495625_0041929 Ga0495625_0041929_505_1146 206
218 3300046660 Ga0495625_0054328 Ga0495625_0054328_2174_2815 206
219 3300046660 Ga0495625_0062680 Ga0495625_0062680_1914_2555 206
220 3300046663 Ga0495635_0211922 Ga0495635_0211922_224_844 206
221 3300046665 Ga0495661_0111539 Ga0495661_0111539_608_1249 206
222 3300046674 Ga0495588_0057050 Ga0495588_0057050_296_937 206
223 3300046674 Ga0495588_0067965 Ga0495588_0067965_870_1511 206
224 3300046674 Ga0495588_0082782 Ga0495588_0082782_211_831 206
225 3300046675 Ga0495657_0073438 Ga0495657_0073438_1199_1819 206
226 3300046679 Ga0495623_0450407 Ga0495623_0450407_31_651 206
227 3300046683 Ga0495658_0045773 Ga0495658_0045773_94_783 206
228 3300046691 Ga0495670_0319283 Ga0495670_0319283_58_699 206
229 3300046692 Ga0495671_0053893 Ga0495671_0053893_1249_1890 206
230 3300046794 Ga0495589_0058532 Ga0495589_0058532_198_839 206
231 3300046809 Ga0495600_0130565 Ga0495600_0130565_466_1155 206
232 3300047317 Ga0495604_0020586 Ga0495604_0020586_565_1185 206
233 3300047470 Ga0495681_0064955 Ga0495681_0064955_754_1395 206
234 3300047472 Ga0495686_0001023 Ga0495686_0001023_27376_28017 206
235 3300047472 Ga0495686_0096641 Ga0495686_0096641_451_1092 206
236 3300047472 Ga0495686_0247885 Ga0495686_0247885_198_839 206
237 3300048903 Ga0496100_0345828 Ga0496100_0345828_339_980 206
238 3300048904 Ga0496101_0165992 Ga0496101_0165992_50_691 206
239 3300048905 Ga0496102_0058643 Ga0496102_0058643_1544_2185 206
240 3300048905 Ga0496102_0628128 Ga0496102_0628128_158_799 206
241 3300048907 Ga0496104_0020766 Ga0496104_0020766_1541_2182 206
242 3300048907 Ga0496104_0021117 Ga0496104_0021117_152_793 206
243 3300048907 Ga0496104_0129639 Ga0496104_0129639_133_774 206
244 3300048907 Ga0496104_0378449 Ga0496104_0378449_493_1134 206
245 3300048908 Ga0496105_0005498 Ga0496105_0005498_1426_2067 206
246 3300048908 Ga0496105_0036698 Ga0496105_0036698_63_704 206
247 3300048908 Ga0496105_0099900 Ga0496105_0099900_1680_2321 206
248 3300048908 Ga0496105_0112939 Ga0496105_0112939_1486_2127 206
249 3300048909 Ga0496106_0261580 Ga0496106_0261580_303_944 206
250 3300048910 Ga0496107_0246588 Ga0496107_0246588_202_843 206
251 3300048911 Ga0496108_0000963 Ga0496108_0000963_78_719 206
252 3300048911 Ga0496108_0002032 Ga0496108_0002032_10549_11190 206
253 3300048912 Ga0496109_0103110 Ga0496109_0103110_548_1189 206
254 3300048912 Ga0496109_0272860 Ga0496109_0272860_886_1527 206
255 3300048913 Ga0496110_0088942 Ga0496110_0088942_1704_2345 206
256 3300048913 Ga0496110_0384559 Ga0496110_0384559_185_826 206
257 3300048914 Ga0496111_0016000 Ga0496111_0016000_1889_2530 206
258 3300048915 Ga0496112_0020940 Ga0496112_0020940_4006_4647 206
259 3300048915 Ga0496112_0024533 Ga0496112_0024533_3605_4246 206
260 3300048916 Ga0496113_0034233 Ga0496113_0034233_2498_3139 206
261 3300048916 Ga0496113_0230945 Ga0496113_0230945_182_823 206
262 3300048918 Ga0496115_0000065 Ga0496115_0000065_58087_58740 206
263 3300048918 Ga0496115_0015655 Ga0496115_0015655_3607_4248 206
264 3300048919 Ga0496116_0001740 Ga0496116_0001740_1508_2128 206
265 3300048919 Ga0496116_0024172 Ga0496116_0024172_109_750 206
266 3300048919 Ga0496116_0138625 Ga0496116_0138625_557_1198 206
267 3300048919 Ga0496116_0139771 Ga0496116_0139771_557_1198 206
268 3300048920 Ga0496117_0002986 Ga0496117_0002986_3887_4528 206
269 3300048920 Ga0496117_0015958 Ga0496117_0015958_1934_2575 206
270 3300048920 Ga0496117_0225365 Ga0496117_0225365_198_845 206
271 3300048920 Ga0496117_0267226 Ga0496117_0267226_184_825 206
272 3300048921 Ga0496118_0015451 Ga0496118_0015451_2438_3079 206
273 3300048921 Ga0496118_0022692 Ga0496118_0022692_2709_3350 206
274 3300048921 Ga0496118_0106975 Ga0496118_0106975_678_1325 206
275 3300048922 Ga0496119_0021212 Ga0496119_0021212_459_1079 206
276 3300048922 Ga0496119_0030880 Ga0496119_0030880_313_954 206
277 3300048922 Ga0496119_0052777 Ga0496119_0052777_795_1436 206
278 3300048922 Ga0496119_0257256 Ga0496119_0257256_210_851 206
279 3300048924 Ga0496121_0002116 Ga0496121_0002116_15248_15889 206
280 3300048924 Ga0496121_0020106 Ga0496121_0020106_412_1053 206
281 3300048924 Ga0496121_0054282 Ga0496121_0054282_2672_3313 206
282 3300048924 Ga0496121_0079881 Ga0496121_0079881_1458_2078 206
283 3300048924 Ga0496121_0130742 Ga0496121_0130742_153_794 206
284 3300048924 Ga0496121_0174318 Ga0496121_0174318_783_1403 206
285 3300048924 Ga0496121_0586944 Ga0496121_0586944_59_679 206
286 3300048925 Ga0496122_0026329 Ga0496122_0026329_885_1505 206
287 3300048925 Ga0496122_0038631 Ga0496122_0038631_121_762 206
288 3300048925 Ga0496122_0137222 Ga0496122_0137222_305_946 206
289 3300048925 Ga0496122_0238537 Ga0496122_0238537_357_998 206
290 3300048925 Ga0496122_0259529 Ga0496122_0259529_112_753 206
291 3300048926 Ga0496123_0003809 Ga0496123_0003809_578_1219 206
292 3300048926 Ga0496123_0025451 Ga0496123_0025451_2140_2760 206
293 3300048926 Ga0496123_0034791 Ga0496123_0034791_2549_3190 206
294 3300048926 Ga0496123_0117113 Ga0496123_0117113_332_973 206
295 3300048926 Ga0496123_0188946 Ga0496123_0188946_175_816 206
296 3300048926 Ga0496123_0210194 Ga0496123_0210194_80_763 206
297 3300048927 Ga0496124_0001895 Ga0496124_0001895_22419_23060 206
298 3300048927 Ga0496124_0004930 Ga0496124_0004930_12955_13575 206
299 3300048927 Ga0496124_0014181 Ga0496124_0014181_3078_3719 206
300 3300048927 Ga0496124_0080554 Ga0496124_0080554_1668_2288 206
301 3300048927 Ga0496124_0248786 Ga0496124_0248786_263_904 206
302 3300048928 Ga0496125_0003999 Ga0496125_0003999_175_816 206
303 3300048928 Ga0496125_0217721 Ga0496125_0217721_167_808 206
304 3300048928 Ga0496125_0372127 Ga0496125_0372127_165_806 206
305 3300048928 Ga0496125_0399677 Ga0496125_0399677_166_786 206
306 3300048929 Ga0496126_0000185 Ga0496126_0000185_77603_78256 206
307 3300048929 Ga0496126_0046348 Ga0496126_0046348_1565_2206 206
308 3300049570 Ga0501033_0000644 Ga0501033_0000644_26634_27275 206
309 3300049570 Ga0501033_0156117 Ga0501033_0156117_777_1421 206
310 3300049571 Ga0501034_0876353 Ga0501034_0876353_86_727 206
311 3300049578 Ga0501042_0000840 Ga0501042_0000840_7662_8303 206
312 3300049581 Ga0501047_0500309 Ga0501047_0500309_299_943 206
313 3300049671 Ga0501238_003960 Ga0501238_003960_971_1591 206
314 3300049744 Ga0501083_0000042 Ga0501083_0000042_13424_14065 206
315 3300049823 Ga0501044_0073469 Ga0501044_0073469_220_864 206
316 3300053077 Ga0495601_0501088 Ga0495601_0501088_151_771 206
317 3300053122 Ga0500608_044672 Ga0500608_044672_1094_1735 206
318 3300053123 Ga0500614_066403 Ga0500614_066403_83_703 206
319 3300053139 Ga0500568_0058081 Ga0500568_0058081_574_1194 206
320 3300053148 Ga0500590_015246 Ga0500590_015246_1367_2056 206
321 3300053156 Ga0500622_0098807 Ga0500622_0098807_323_943 206
322 3300053158 Ga0500627_0133460 Ga0500627_0133460_356_976 206
323 3300053158 Ga0500627_0186977 Ga0500627_0186977_250_870 206
324 3300053177 Ga0500636_0016649 Ga0500636_0016649_415_1056 206
325 3300061719 Ga0466962_0150606 Ga0466962_0150606_339_980 206
326 iso_pu_bacteria 2510065019 2510131898 206
327 iso_pu_bacteria 2510461076 2510897505 206
328 iso_pu_bacteria 2513237084 2513568718 206
329 iso_pu_bacteria 2513237088 2513596576 206
330 iso_pu_bacteria 2513237103 2513709595 206
331 iso_pu_bacteria 2513237144 2513910455 206
332 iso_pu_bacteria 2513237162 2514020507 206
333 iso_pu_bacteria 2515075009 2515110864 206
334 iso_pu_bacteria 2515154113 2515638123 206
335 iso_pu_bacteria 2515154114 2515647232 206
336 iso_pu_bacteria 2515154116 2515656938 206
337 iso_pu_bacteria 2517287029 2517409270 206
338 iso_pu_bacteria 2582581283 2585168949 206
339 iso_pu_bacteria 2582581294 2585204294 206
340 iso_pu_bacteria 2582581299 2585230855 206
341 iso_pu_bacteria 2585427594 2585843662 206
342 iso_pu_bacteria 2585427633 2585994918 206
343 iso_pu_bacteria 2585427634 2585999457 206
344 iso_pu_bacteria 2643221557 2643805371 206
345 iso_pu_bacteria 2643221607 2644049622 206
346 iso_pu_bacteria 2643221610 2644066951 206
347 iso_pu_bacteria 2643221636 2644203970 206
348 iso_pu_bacteria 2643221636 2644205824 206
349 iso_pu_bacteria 2643221643 2644240776 206
350 iso_pu_bacteria 2643221668 2644379111 206
351 iso_pu_bacteria 2643221675 2644420313 206
352 iso_pu_bacteria 2643221680 2644453839 206
353 iso_pu_bacteria 2643221686 2644482655 206
354 iso_pu_bacteria 2643221726 2644686387 206
355 iso_pu_bacteria 2667528174 2671115321 206
356 iso_pu_bacteria 2738543024 2739310870 206
357 iso_pu_bacteria 2775507266 2778174569 206
358 iso_pu_bacteria 2838029111 2838031412 206
359 iso_pu_bacteria 2842217011 2842220965 206
360 iso_pu_bacteria 2842475841 2842477993 206
361 iso_pu_bacteria 2842482326 2842485602 206
362 iso_pu_bacteria 2842502639 2842504802 206
363 iso_pu_bacteria 2844533157 2844537788 206
364 iso_pu_bacteria 2852387548 2852390178 206
365 iso_pu_bacteria 2919051321 2919051908 206
366 iso_pu_bacteria 2919408235 2919409294 206
367 iso_pu_bacteria 2958064165 2958065375 206
368 iso_pu_bacteria 639633055 639647097 206
369 iso_pu_bacteria 8004025490 8004027158 206
370 iso_pu_bacteria 8005258706 8005260687 206
371 iso_pu_bacteria 8005460587 8005461502 206
372 iso_pu_bacteria 8046767195 8046773019 206
373 iso_pu_bacteria 8054913762 8054920013 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

20

226

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ixy-assembly1.cif.gz_A x-ray structure of major pilin from c. perfringens sm101 0.8904 188 204
5anm-assembly2.cif.gz_E crystal structure of ige fc in complex with a neutralizing antibody 0.8759 188 204
5xcb-assembly1.cif.gz_A x-ray structure of domains d1 and d2 of clostridium perfringens pili protein cppa 0.8538 188 205
6gjh-assembly1.cif.gz_A human hsp27 (hspb1) alpha-crystallin domain in complex with a peptide mimic of its phosphorylatable n-terminal region 0.8449 190 205
5xcc-assembly2.cif.gz_B x-ray structure of clostridium perfringens pili protein cppa 0.8428 188 205
ID Description Score Start End Superfamily
af_Q2FXU1_650_729_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8579 189 204 3.30.70.260
af_Q19227_25_133_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8502 190 206 2.60.40.790
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8465 2 206 3.40.430.10
af_P45442_1_125_2.60.40.1460 Mainly Beta;Sandwich;Immunoglobulin-like;Integrin domains. Chain A, domain 2 0.8464 188 206 2.60.40.1460
af_I1N552_108_193_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8447 189 205 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A259STM9-F1-model_v4 Deaminase 0.9819 56 206 GO:0008703
GO:0009231
AF-A0A0K2RI46-F1-model_v4 5-Amino-6-(5-Phosphoribosylamino)Uracil reductase 0.9709 2 106
AF-D0LET3-F1-model_v4 Bifunctional deaminase-reductase domain protein 0.9692 3 206 GO:0008703
GO:0009231
AF-A0A6P0DTT3-F1-model_v4 Deaminase 0.9668 99 206 GO:0008703
GO:0009231
AF-A0A1J5R3Q4-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9663 2 206 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
91.05 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map