F426061

General Info

Members Datasets Scaffolds Average Seq Length
372 259 744 97

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10012544|Ga0213874_100125443
Length 106
Sequence MLDIPSGMHHIPRVIESFRDKRTVAIFRGEMPKGFPSGIARAARRKLRMLDAAGALEDLRSPPGNHLEALSGDRAGQHSIRVNDQWRLCFVWRDGGAHEVEITDYH

Samples

Sample ID Description Type Environment
1 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
2 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
95 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
100 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
101 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
104 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
105 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
106 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
114 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
119 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
120 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
121 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
139 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
140 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
220 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
221 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
222 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
223 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
226 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
227 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
228 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
229 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
230 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
231 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
232 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
233 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
234 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
235 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
236 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
237 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
240 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
241 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
244 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
245 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
246 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
247 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
248 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
249 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
250 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
251 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
252 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
255 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
256 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
257 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
258 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
259 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 0.81
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.01
Nodule 1.34
Rhizoplane 0.81
Rhizosphere 72.31
Stem 0
Stem Tuber 0
Unclassified 5.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213874_10012544 3300021377 Bacteria 2175
2 Ga0055543_1054918 3300004625 Bacteria 647
3 Ga0065165_1000141 3300005262 Bacteria 125536
4 Ga0070670_101804956 3300005331 Bacteria 563
5 Ga0070680_100033420 3300005336 Bacteria 4146
6 Ga0070660_100602474 3300005339 Bacteria 919
7 Ga0070691_10074432 3300005341 Bacteria 1652
8 Ga0070661_100202305 3300005344 Bacteria 1518
9 Ga0070709_10138062 3300005434 Bacteria 1672
10 Ga0070714_100544451 3300005435 Bacteria 1110
11 Ga0070714_102221862 3300005435 Unclassified 534
12 Ga0070710_10565725 3300005437 Bacteria 787
13 Ga0070711_100284745 3300005439 Bacteria 1309
14 Ga0070711_100376310 3300005439 Bacteria 1147
15 Ga0070663_100299701 3300005455 Bacteria 1286
16 Ga0070681_10202326 3300005458 Bacteria 1904
17 Ga0070685_10562383 3300005466 Bacteria 816
18 Ga0070706_100062789 3300005467 Bacteria 3433
19 Ga0070679_100341863 3300005530 Bacteria 1445
20 Ga0070679_100816623 3300005530 Bacteria 876
21 Ga0070679_101364075 3300005530 Bacteria 655
22 Ga0070679_101597917 3300005530 Bacteria 599
23 Ga0070684_100014987 3300005535 Bacteria 6296
24 Ga0070684_100205884 3300005535 Bacteria 1793
25 Ga0070697_100203835 3300005536 Bacteria 1682
26 Ga0068853_100170399 3300005539 Bacteria 1969
27 Ga0070696_101937717 3300005546 Unclassified 511
28 Ga0070665_100060118 3300005548 Bacteria 3809
29 Ga0070665_100571893 3300005548 Bacteria 1143
30 Ga0070665_102006147 3300005548 Bacteria 584
31 Ga0070704_102198337 3300005549 Bacteria 513
32 Ga0068855_100007899 3300005563 Bacteria 12853
33 Ga0068855_100370133 3300005563 Bacteria 1575
34 Ga0068857_100168514 3300005577 Bacteria 1990
35 Ga0068854_100143426 3300005578 Bacteria 1835
36 Ga0068856_101520568 3300005614 Unclassified 683
37 Ga0068852_100000027 3300005616 Bacteria 113819
38 Ga0068852_100157273 3300005616 Bacteria 2119
39 Ga0068864_101920871 3300005618 Unclassified 598
40 Ga0068851_10035898 3300005834 Bacteria 2480
41 Ga0068851_10344078 3300005834 Bacteria 866
42 Ga0068858_100588943 3300005842 Bacteria 1078
43 Ga0081539_10007976 3300005985 Bacteria 9414
44 Ga0070717_10829804 3300006028 Unclassified 841
45 Ga0075363_100559644 3300006048 Bacteria 683
46 Ga0070712_100141447 3300006175 Bacteria 1837
47 Ga0070712_100252572 3300006175 Bacteria 1410
48 Ga0075362_10276441 3300006177 Bacteria 830
49 Ga0075367_10007907 3300006178 Bacteria 5478
50 Ga0075366_11063536 3300006195 Bacteria 505
51 Ga0075370_10576809 3300006353 Bacteria 681
52 Ga0099794_10070682 3300007265 Bacteria 1709
53 Ga0099795_10001203 3300007788 Bacteria 5456
54 Ga0099795_10104796 3300007788 Bacteria 1114
55 Ga0105240_10000222 3300009093 Bacteria 113825
56 Ga0105240_10009253 3300009093 Bacteria 13971
57 Ga0105240_11475304 3300009093 Bacteria 714
58 Ga0105240_12094763 3300009093 Bacteria 587
59 Ga0111539_10185354 3300009094 Bacteria 2430
60 Ga0111539_12228960 3300009094 Bacteria 635
61 Ga0105241_11313930 3300009174 Bacteria 689
62 Ga0105241_11817345 3300009174 Unclassified 595
63 Ga0105248_11374726 3300009177 Bacteria 799
64 Ga0105237_10079094 3300009545 Bacteria 3278
65 Ga0105238_10014561 3300009551 Bacteria 7951
66 Ga0099796_10022474 3300010159 Unclassified 1957
67 Ga0099796_10067406 3300010159 Bacteria 1284
68 Ga0099796_10076194 3300010159 Bacteria 1221
69 Ga0105239_10409073 3300010375 Bacteria 1536
70 Ga0105239_10728285 3300010375 Bacteria 1135
71 Ga0105239_12777511 3300010375 Unclassified 571
72 Ga0157373_10139805 3300013100 Bacteria 1703
73 Ga0157373_10368703 3300013100 Bacteria 1026
74 Ga0157370_10000012 3300013104 Bacteria 201181
75 Ga0157370_10224327 3300013104 Bacteria 1740
76 Ga0157369_10000112 3300013105 Bacteria 114309
77 Ga0157369_10009809 3300013105 Bacteria 10954
78 Ga0171463_1005 3300013249 Bacteria 358236
79 Ga0157372_10000111 3300013307 Bacteria 86033
80 Ga0163163_11696553 3300014325 Unclassified 692
81 Ga0157380_10264970 3300014326 Bacteria 1563
82 Ga0182008_10197574 3300014497 Bacteria 1022
83 Ga0182008_10274118 3300014497 Bacteria 876
84 Ga0157379_11582775 3300014968 Bacteria 639
85 Ga0182007_10064252 3300015262 Bacteria 1203
86 Ga0183363_1074 3300015690 Bacteria 29970
87 Ga0213872_10053974 3300021361 Bacteria 1822
88 Ga0213875_10005510 3300021388 Bacteria 6786
89 Ga0209129_1017925 3300025258 Bacteria 1374
90 Ga0209130_1004194 3300025284 Bacteria 5630
91 Ga0209025_1087449 3300025294 Bacteria 1032
92 Ga0209564_1004750 3300025295 Bacteria 8125
93 Ga0207426_1018748 3300025302 Bacteria 2434
94 Ga0207656_10185383 3300025321 Bacteria 1000
95 Ga0207692_10149144 3300025898 Bacteria 1338
96 Ga0207692_10268039 3300025898 Bacteria 1029
97 Ga0207692_10339955 3300025898 Bacteria 923
98 Ga0207699_10175186 3300025906 Bacteria 1438
99 Ga0207705_10065934 3300025909 Bacteria 2618
100 Ga0207684_10132601 3300025910 Bacteria 2139
101 Ga0207707_10016468 3300025912 Bacteria 6446
102 Ga0207707_10190545 3300025912 Bacteria 1789
103 Ga0207695_10000028 3300025913 Bacteria 551835
104 Ga0207695_10697428 3300025913 Bacteria 896
105 Ga0207671_10008104 3300025914 Bacteria 8969
106 Ga0207671_11000234 3300025914 Unclassified 659
107 Ga0207693_10153333 3300025915 Bacteria 1813
108 Ga0207663_10234004 3300025916 Bacteria 1344
109 Ga0207663_10238627 3300025916 Bacteria 1332
110 Ga0207660_10307969 3300025917 Bacteria 1262
111 Ga0207657_10007989 3300025919 Bacteria 10786
112 Ga0207649_10600908 3300025920 Bacteria 846
113 Ga0207652_10178370 3300025921 Bacteria 1908
114 Ga0207652_10268635 3300025921 Bacteria 1538
115 Ga0207694_10055713 3300025924 Bacteria 3069
116 Ga0207650_10322557 3300025925 Bacteria 1265
117 Ga0207690_10189743 3300025932 Bacteria 1554
118 Ga0207669_10207278 3300025937 Bacteria 1428
119 Ga0207665_11165655 3300025939 Bacteria 615
120 Ga0207661_10232466 3300025944 Bacteria 1633
121 Ga0207661_10425067 3300025944 Bacteria 1207
122 Ga0207667_10034896 3300025949 Bacteria 5399
123 Ga0207667_10146873 3300025949 Bacteria 2427
124 Ga0207640_10082330 3300025981 Bacteria 2204
125 Ga0207640_10560124 3300025981 Unclassified 962
126 Ga0207703_10445342 3300026035 Bacteria 1209
127 Ga0207639_10031737 3300026041 Bacteria 3884
128 Ga0207639_10717920 3300026041 Bacteria 928
129 Ga0207702_10407509 3300026078 Bacteria 1312
130 Ga0207702_11142587 3300026078 Unclassified 773
131 Ga0207698_10000021 3300026142 Bacteria 133280
132 Ga0207698_10463972 3300026142 Bacteria 1225
133 Ga0209281_1013887 3300027111 Bacteria 1722
134 Ga0209179_1036933 3300027512 Bacteria 1019
135 Ga0209588_1072920 3300027671 Bacteria 1109
136 Ga0209813_10130119 3300027866 Bacteria 885
137 Ga0268266_10055963 3300028379 Bacteria 3392
138 Ga0268266_10626452 3300028379 Bacteria 1034
139 Ga0265337_1006330 3300028556 Bacteria 4582
140 Ga0265326_10000801 3300028558 Bacteria 11638
141 Ga0265319_1026850 3300028563 Bacteria 2047
142 Ga0265334_10002669 3300028573 Bacteria 8251
143 Ga0265318_10111362 3300028577 Bacteria 1006
144 Ga0265323_10001311 3300028653 Bacteria 12382
145 Ga0265323_10014347 3300028653 Bacteria 3143
146 Ga0265322_10030143 3300028654 Bacteria 1549
147 Ga0265336_10000188 3300028666 Bacteria 43129
148 Ga0307517_10001121 3300028786 Bacteria 45217
149 Ga0307515_10104177 3300028794 Bacteria 3393
150 Ga0265338_10000393 3300028800 Bacteria 78303
151 Ga0265324_10000885 3300029957 Bacteria 19065
152 Ga0265328_10063452 3300031239 Bacteria 1357
153 Ga0265316_10188314 3300031344 Bacteria 1534
154 Ga0265316_10277829 3300031344 Bacteria 1224
155 Ga0316575_10021342 3300031665 Bacteria 2492
156 Ga0316579_10042627 3300031691 Bacteria 2108
157 Ga0316579_10090679 3300031691 Bacteria 1460
158 Ga0316576_10160464 3300031727 Bacteria 1696
159 Ga0316576_11055050 3300031727 Bacteria 577
160 Ga0316576_11083561 3300031727 Bacteria 569
161 Ga0316576_11223526 3300031727 Bacteria 530
162 Ga0316578_10067375 3300031728 Bacteria 2116
163 Ga0307516_10065312 3300031730 Bacteria 3515
164 Ga0316577_10068088 3300031733 Bacteria 1987
165 Ga0316585_10005289 3300032137 Bacteria 3639
166 Ga0316585_10175037 3300032137 Bacteria 709
167 Ga0316580_10233920 3300032139 Bacteria 567
168 Ga0316593_10158754 3300032168 Bacteria 825
169 Ga0316588_1125242 3300033528 Bacteria 651
170 Ga0373956_0247196 3300035119 Bacteria 848
171 Ga0316574_0087618 3300035398 Bacteria 1982
172 Ga0316574_0103212 3300035398 Bacteria 1825
173 Ga0316574_0245822 3300035398 Bacteria 1143
174 Ga0373924_0221298 3300035410 Bacteria 836
175 Ga0373927_0191959 3300035695 Bacteria 1340
176 Ga0373933_0211088 3300035724 Bacteria 1244
177 Ga0373933_0726224 3300035724 Bacteria 653
178 Ga0373933_1174738 3300035724 Bacteria 506
179 Ga0373937_0167907 3300036401 Bacteria 2058
180 Ga0373937_0238759 3300036401 Bacteria 1712
181 Ga0373937_0875294 3300036401 Bacteria 847
182 Ga0316582_0001968 3300036647 Bacteria 9400
183 Ga0316582_0388121 3300036647 Bacteria 961
184 Ga0316584_0003644 3300036712 Bacteria 10082
185 Ga0316584_0291631 3300036712 Bacteria 1183
186 Ga0316584_0382444 3300036712 Bacteria 1006
187 Ga0373925_0942119 3300037068 Bacteria 711
188 Ga0395899_0022777 3300037312 Bacteria 4747
189 Ga0395900_0075500 3300037418 Bacteria 3465
190 Ga0395900_0217862 3300037418 Bacteria 1925
191 Ga0395905_0089724 3300037471 Bacteria 2881
192 Ga0395905_0762435 3300037471 Bacteria 870
193 Ga0316581_0043568 3300037588 Bacteria 1370
194 Ga0436364_0521990 3300037853 Bacteria 17097
195 Ga0436364_0705989 3300037853 Bacteria 1585
196 Ga0436364_0987438 3300037853 Bacteria 1382
197 Ga0395901_0071862 3300038443 Bacteria 3606
198 Ga0395901_1015396 3300038443 Bacteria 804
199 Ga0400485_07838 3300038735 Unclassified 1375
200 Ga0400483_099421 3300039062 Bacteria 18441
201 Ga0400483_220314 3300039062 Bacteria 3592
202 Ga0400487_33030 3300039110 Bacteria 33139
203 Ga0436365_0152558 3300039437 Bacteria 2858
204 Ga0436365_1207243 3300039437 Unclassified 2047
205 Ga0436365_1347806 3300039437 Bacteria 3089
206 Ga0436360_0302503 3300039438 Bacteria 929
207 Ga0436360_0737264 3300039438 Bacteria 3399
208 Ga0436361_0690680 3300039447 Bacteria 902
209 Ga0436361_0704047 3300039447 Bacteria 682
210 Ga0436361_0984684 3300039447 Bacteria 2192
211 Ga0436363_0503585 3300039450 Bacteria 869
212 Ga0436363_1414789 3300039450 Bacteria 1256
213 Ga0436362_0203431 3300039453 Bacteria 648
214 Ga0436362_0471584 3300039453 Unclassified 509
215 Ga0436362_0522980 3300039453 Unclassified 1609
216 Ga0439465_0016307 3300041413 Bacteria 2318
217 Ga0466967_2522803 3300045976 Bacteria 509
218 Ga0495617_106235 3300046452 Bacteria 910
219 Ga0495638_0000622 3300046460 Bacteria 39303
220 Ga0495638_0441265 3300046460 Bacteria 666
221 Ga0495605_0016192 3300046474 Bacteria 4039
222 Ga0495585_0014282 3300046492 Bacteria 4631
223 Ga0495583_0036104 3300046506 Bacteria 2354
224 Ga0495610_0151372 3300046512 Bacteria 989
225 Ga0495616_0067089 3300046513 Bacteria 1745
226 Ga0495620_0082494 3300046515 Bacteria 1299
227 Ga0495631_0009756 3300046518 Bacteria 4782
228 Ga0495631_0029296 3300046518 Bacteria 2505
229 Ga0495632_0013186 3300046519 Bacteria 4728
230 Ga0495632_0159692 3300046519 Bacteria 1039
231 Ga0495637_0046043 3300046520 Bacteria 1847
232 Ga0495643_0056234 3300046522 Bacteria 2101
233 Ga0495648_0037692 3300046524 Bacteria 3103
234 Ga0495654_0026078 3300046530 Bacteria 3008
235 Ga0495668_0016626 3300046616 Bacteria 4277
236 Ga0495668_0173687 3300046616 Bacteria 1181
237 Ga0495611_0007528 3300046648 Bacteria 4622
238 Ga0495611_0159782 3300046648 Bacteria 1053
239 Ga0495625_0026834 3300046660 Bacteria 4344
240 Ga0495625_0041195 3300046660 Bacteria 3363
241 Ga0495635_0931234 3300046663 Bacteria 555
242 Ga0495661_0044936 3300046665 Bacteria 2704
243 Ga0495588_0045143 3300046674 Bacteria 2259
244 Ga0495670_0022409 3300046691 Bacteria 3118
245 Ga0495670_0193991 3300046691 Bacteria 1074
246 Ga0495671_0181123 3300046692 Bacteria 1023
247 Ga0495660_0153304 3300046810 Bacteria 1136
248 Ga0495636_0030534 3300047318 Bacteria 2204
249 Ga0495672_0013461 3300047320 Bacteria 5644
250 Ga0495687_052720 3300047443 Bacteria 1718
251 Ga0495684_0131860 3300047471 Bacteria 1877
252 Ga0495686_0259412 3300047472 Bacteria 973
253 Ga0495686_0329025 3300047472 Bacteria 836
254 Ga0495602_0569119 3300048088 Bacteria 783
255 Ga0495602_0841609 3300048088 Unclassified 614
256 Ga0495626_0117766 3300048091 Bacteria 1145
257 Ga0496100_0640167 3300048903 Bacteria 827
258 Ga0496102_1730874 3300048905 Bacteria 543
259 Ga0496112_0307033 3300048915 Bacteria 1532
260 Ga0496116_0124474 3300048919 Bacteria 1484
261 Ga0496117_0108831 3300048920 Bacteria 1732
262 Ga0496118_0042272 3300048921 Bacteria 3597
263 Ga0496121_0022968 3300048924 Bacteria 6026
264 Ga0496122_0318505 3300048925 Bacteria 828
265 Ga0496123_0185041 3300048926 Bacteria 1083
266 Ga0496125_0199246 3300048928 Bacteria 1313
267 Ga0496125_0341424 3300048928 Bacteria 898
268 Ga0496126_0188418 3300048929 Bacteria 1748
269 Ga0495678_050954 3300049459 Bacteria 1602
270 Ga0495678_107012 3300049459 Bacteria 960
271 Ga0501031_0194066 3300049568 Bacteria 1325
272 Ga0501032_0032514 3300049569 Bacteria 3575
273 Ga0501033_0194231 3300049570 Bacteria 1451
274 Ga0501033_0594386 3300049570 Bacteria 759
275 Ga0501036_0075214 3300049572 Bacteria 2856
276 Ga0501037_0055866 3300049573 Bacteria 2885
277 Ga0501038_0298151 3300049574 Bacteria 1266
278 Ga0501039_0374498 3300049575 Bacteria 1118
279 Ga0501040_0132055 3300049576 Bacteria 1756
280 Ga0501042_0271136 3300049578 Bacteria 1225
281 Ga0501043_0507230 3300049579 Bacteria 900
282 Ga0501046_0191862 3300049580 Bacteria 1523
283 Ga0501047_0017553 3300049581 Bacteria 6856
284 Ga0501047_0673752 3300049581 Bacteria 853
285 Ga0501048_0027128 3300049582 Bacteria 4165
286 Ga0501067_0088083 3300049583 Bacteria 1723
287 Ga0501067_0162865 3300049583 Unclassified 1242
288 Ga0501068_0211163 3300049584 Bacteria 1232
289 Ga0501069_0045005 3300049585 Unclassified 2444
290 Ga0501070_0025442 3300049586 Bacteria 4964
291 Ga0501070_0070258 3300049586 Bacteria 2899
292 Ga0501070_0176058 3300049586 Unclassified 1761
293 Ga0501070_0189699 3300049586 Bacteria 1690
294 Ga0501071_0078247 3300049587 Bacteria 2417
295 Ga0501072_0442173 3300049588 Bacteria 1030
296 Ga0501074_0765871 3300049590 Bacteria 680
297 Ga0501080_0167444 3300049742 Bacteria 2028
298 Ga0501080_0372367 3300049742 Bacteria 1288
299 Ga0501080_0698945 3300049742 Bacteria 894
300 Ga0501083_0001215 3300049744 Bacteria 17446
301 Ga0501083_0121405 3300049744 Bacteria 1714
302 Ga0501035_0044971 3300049822 Bacteria 3973
303 Ga0501035_0121819 3300049822 Bacteria 2279
304 Ga0501044_0131483 3300049823 Bacteria 2496
305 Ga0501044_0163510 3300049823 Bacteria 2201
306 Ga0501044_0464937 3300049823 Bacteria 1170
307 Ga0501044_0544685 3300049823 Bacteria 1058
308 Ga0501045_0023954 3300049824 Bacteria 4381
309 nmdc:mga03683_292789_c1 3300050489 Bacteria 762
310 nmdc:mga0yw44_206091_c1 3300050492 Bacteria 1300
311 nmdc:mga06z11_424501_c1 3300050494 Bacteria 802
312 nmdc:mga08y16_496643_c1 3300050511 Bacteria 1240
313 Ga0500610_0121623 3300053079 Bacteria 1334
314 Ga0500578_0209100 3300053086 Bacteria 1191
315 Ga0500643_013312 3300053087 Bacteria 2910
316 Ga0500643_054025 3300053087 Bacteria 1141
317 Ga0500644_0088401 3300053088 Bacteria 1154
318 Ga0500644_0484985 3300053088 Bacteria 543
319 Ga0500646_0024151 3300053090 Bacteria 1635
320 Ga0500646_0272628 3300053090 Bacteria 601
321 Ga0500651_0021939 3300053093 Bacteria 3985
322 Ga0500651_0484323 3300053093 Bacteria 684
323 Ga0500641_0030502 3300053096 Bacteria 2119
324 Ga0500641_0221965 3300053096 Bacteria 801
325 Ga0500650_0016521 3300053098 Bacteria 3168
326 Ga0500650_0180033 3300053098 Bacteria 969
327 Ga0500555_137039 3300053103 Bacteria 605
328 Ga0500556_0025608 3300053104 Bacteria 1951
329 Ga0500556_0161349 3300053104 Bacteria 885
330 Ga0500557_002781 3300053105 Bacteria 3306
331 Ga0500557_138619 3300053105 Bacteria 804
332 Ga0500562_005245 3300053108 Bacteria 3255
333 Ga0500562_088207 3300053108 Bacteria 841
334 Ga0500569_042491 3300053109 Bacteria 1338
335 Ga0500569_155065 3300053109 Bacteria 773
336 Ga0500592_001472 3300053116 Bacteria 3822
337 Ga0500593_090672 3300053117 Bacteria 1294
338 Ga0500594_0016763 3300053118 Bacteria 1784
339 Ga0500594_0027044 3300053118 Bacteria 1482
340 Ga0500642_0000279 3300053130 Bacteria 18931
341 Ga0500652_008162 3300053131 Bacteria 3475
342 Ga0500652_193582 3300053131 Bacteria 828
343 Ga0500658_0308901 3300053134 Bacteria 727
344 Ga0500658_0419291 3300053134 Bacteria 611
345 Ga0500568_0000833 3300053139 Bacteria 21699
346 Ga0500568_0003647 3300053139 Bacteria 8473
347 Ga0500577_0149213 3300053142 Bacteria 991
348 Ga0500588_0127177 3300053146 Bacteria 904
349 Ga0500604_0025471 3300053151 Bacteria 1700
350 Ga0500616_0000429 3300053153 Bacteria 56093
351 Ga0500619_188290 3300053154 Unclassified 695
352 Ga0500622_0006536 3300053156 Bacteria 6736
353 Ga0500627_0201099 3300053158 Bacteria 893
354 Ga0500627_0359797 3300053158 Bacteria 626
355 Ga0500633_0007779 3300053160 Bacteria 2722
356 Ga0500633_0266515 3300053160 Bacteria 635
357 Ga0500634_0254651 3300053161 Bacteria 727
358 Ga0500636_0040257 3300053177 Bacteria 2764
359 Ga0500611_004912 3300053727 Bacteria 1842
360 Ga0500611_072733 3300053727 Bacteria 841
361 Ga0500645_025479 3300053730 Bacteria 1805
362 Ga0500645_034131 3300053730 Bacteria 1519
363 Ga0500609_027029 3300053731 Bacteria 786
364 Ga0587072_077483 3300059643 Bacteria 712
365 Ga0501082_0044322 3300060353 Bacteria 3837
366 Ga0501082_0329720 3300060353 Unclassified 1330
367 2553004619 2551306416 Bacteria 6152985
368 2819616991 2818991449 Bacteria 5518009
369 2915990927 2915986958 Bacteria 6739310
370 2970085680 2970082768 Bacteria 6183754
371 8003992913 8003992118 Bacteria 7266902
372 8007001974 8006994254 Bacteria 8309700
373 Ga0213874_10012544
374 Ga0055543_1054918
375 Ga0065165_1000141
376 Ga0070670_101804956
377 Ga0070680_100033420
378 Ga0070660_100602474
379 Ga0070691_10074432
380 Ga0070661_100202305
381 Ga0070709_10138062
382 Ga0070714_100544451
383 Ga0070714_102221862
384 Ga0070710_10565725
385 Ga0070711_100284745
386 Ga0070711_100376310
387 Ga0070663_100299701
388 Ga0070681_10202326
389 Ga0070685_10562383
390 Ga0070706_100062789
391 Ga0070679_100341863
392 Ga0070679_100816623
393 Ga0070679_101364075
394 Ga0070679_101597917
395 Ga0070684_100014987
396 Ga0070684_100205884
397 Ga0070697_100203835
398 Ga0068853_100170399
399 Ga0070696_101937717
400 Ga0070665_100060118
401 Ga0070665_100571893
402 Ga0070665_102006147
403 Ga0070704_102198337
404 Ga0068855_100007899
405 Ga0068855_100370133
406 Ga0068857_100168514
407 Ga0068854_100143426
408 Ga0068856_101520568
409 Ga0068852_100000027
410 Ga0068852_100157273
411 Ga0068864_101920871
412 Ga0068851_10035898
413 Ga0068851_10344078
414 Ga0068858_100588943
415 Ga0081539_10007976
416 Ga0070717_10829804
417 Ga0075363_100559644
418 Ga0070712_100141447
419 Ga0070712_100252572
420 Ga0075362_10276441
421 Ga0075367_10007907
422 Ga0075366_11063536
423 Ga0075370_10576809
424 Ga0099794_10070682
425 Ga0099795_10001203
426 Ga0099795_10104796
427 Ga0105240_10000222
428 Ga0105240_10009253
429 Ga0105240_11475304
430 Ga0105240_12094763
431 Ga0111539_10185354
432 Ga0111539_12228960
433 Ga0105241_11313930
434 Ga0105241_11817345
435 Ga0105248_11374726
436 Ga0105237_10079094
437 Ga0105238_10014561
438 Ga0099796_10022474
439 Ga0099796_10067406
440 Ga0099796_10076194
441 Ga0105239_10409073
442 Ga0105239_10728285
443 Ga0105239_12777511
444 Ga0157373_10139805
445 Ga0157373_10368703
446 Ga0157370_10000012
447 Ga0157370_10224327
448 Ga0157369_10000112
449 Ga0157369_10009809
450 Ga0171463_1005
451 Ga0157372_10000111
452 Ga0163163_11696553
453 Ga0157380_10264970
454 Ga0182008_10197574
455 Ga0182008_10274118
456 Ga0157379_11582775
457 Ga0182007_10064252
458 Ga0183363_1074
459 Ga0213872_10053974
460 Ga0213875_10005510
461 Ga0209129_1017925
462 Ga0209130_1004194
463 Ga0209025_1087449
464 Ga0209564_1004750
465 Ga0207426_1018748
466 Ga0207656_10185383
467 Ga0207692_10149144
468 Ga0207692_10268039
469 Ga0207692_10339955
470 Ga0207699_10175186
471 Ga0207705_10065934
472 Ga0207684_10132601
473 Ga0207707_10016468
474 Ga0207707_10190545
475 Ga0207695_10000028
476 Ga0207695_10697428
477 Ga0207671_10008104
478 Ga0207671_11000234
479 Ga0207693_10153333
480 Ga0207663_10234004
481 Ga0207663_10238627
482 Ga0207660_10307969
483 Ga0207657_10007989
484 Ga0207649_10600908
485 Ga0207652_10178370
486 Ga0207652_10268635
487 Ga0207694_10055713
488 Ga0207650_10322557
489 Ga0207690_10189743
490 Ga0207669_10207278
491 Ga0207665_11165655
492 Ga0207661_10232466
493 Ga0207661_10425067
494 Ga0207667_10034896
495 Ga0207667_10146873
496 Ga0207640_10082330
497 Ga0207640_10560124
498 Ga0207703_10445342
499 Ga0207639_10031737
500 Ga0207639_10717920
501 Ga0207702_10407509
502 Ga0207702_11142587
503 Ga0207698_10000021
504 Ga0207698_10463972
505 Ga0209281_1013887
506 Ga0209179_1036933
507 Ga0209588_1072920
508 Ga0209813_10130119
509 Ga0268266_10055963
510 Ga0268266_10626452
511 Ga0265337_1006330
512 Ga0265326_10000801
513 Ga0265319_1026850
514 Ga0265334_10002669
515 Ga0265318_10111362
516 Ga0265323_10001311
517 Ga0265323_10014347
518 Ga0265322_10030143
519 Ga0265336_10000188
520 Ga0307517_10001121
521 Ga0307515_10104177
522 Ga0265338_10000393
523 Ga0265324_10000885
524 Ga0265328_10063452
525 Ga0265316_10188314
526 Ga0265316_10277829
527 Ga0316575_10021342
528 Ga0316579_10042627
529 Ga0316579_10090679
530 Ga0316576_10160464
531 Ga0316576_11055050
532 Ga0316576_11083561
533 Ga0316576_11223526
534 Ga0316578_10067375
535 Ga0307516_10065312
536 Ga0316577_10068088
537 Ga0316585_10005289
538 Ga0316585_10175037
539 Ga0316580_10233920
540 Ga0316593_10158754
541 Ga0316588_1125242
542 Ga0373956_0247196
543 Ga0316574_0087618
544 Ga0316574_0103212
545 Ga0316574_0245822
546 Ga0373924_0221298
547 Ga0373927_0191959
548 Ga0373933_0211088
549 Ga0373933_0726224
550 Ga0373933_1174738
551 Ga0373937_0167907
552 Ga0373937_0238759
553 Ga0373937_0875294
554 Ga0316582_0001968
555 Ga0316582_0388121
556 Ga0316584_0003644
557 Ga0316584_0291631
558 Ga0316584_0382444
559 Ga0373925_0942119
560 Ga0395899_0022777
561 Ga0395900_0075500
562 Ga0395900_0217862
563 Ga0395905_0089724
564 Ga0395905_0762435
565 Ga0316581_0043568
566 Ga0436364_0521990
567 Ga0436364_0705989
568 Ga0436364_0987438
569 Ga0395901_0071862
570 Ga0395901_1015396
571 Ga0400485_07838
572 Ga0400483_099421
573 Ga0400483_220314
574 Ga0400487_33030
575 Ga0436365_0152558
576 Ga0436365_1207243
577 Ga0436365_1347806
578 Ga0436360_0302503
579 Ga0436360_0737264
580 Ga0436361_0690680
581 Ga0436361_0704047
582 Ga0436361_0984684
583 Ga0436363_0503585
584 Ga0436363_1414789
585 Ga0436362_0203431
586 Ga0436362_0471584
587 Ga0436362_0522980
588 Ga0439465_0016307
589 Ga0466967_2522803
590 Ga0495617_106235
591 Ga0495638_0000622
592 Ga0495638_0441265
593 Ga0495605_0016192
594 Ga0495585_0014282
595 Ga0495583_0036104
596 Ga0495610_0151372
597 Ga0495616_0067089
598 Ga0495620_0082494
599 Ga0495631_0009756
600 Ga0495631_0029296
601 Ga0495632_0013186
602 Ga0495632_0159692
603 Ga0495637_0046043
604 Ga0495643_0056234
605 Ga0495648_0037692
606 Ga0495654_0026078
607 Ga0495668_0016626
608 Ga0495668_0173687
609 Ga0495611_0007528
610 Ga0495611_0159782
611 Ga0495625_0026834
612 Ga0495625_0041195
613 Ga0495635_0931234
614 Ga0495661_0044936
615 Ga0495588_0045143
616 Ga0495670_0022409
617 Ga0495670_0193991
618 Ga0495671_0181123
619 Ga0495660_0153304
620 Ga0495636_0030534
621 Ga0495672_0013461
622 Ga0495687_052720
623 Ga0495684_0131860
624 Ga0495686_0259412
625 Ga0495686_0329025
626 Ga0495602_0569119
627 Ga0495602_0841609
628 Ga0495626_0117766
629 Ga0496100_0640167
630 Ga0496102_1730874
631 Ga0496112_0307033
632 Ga0496116_0124474
633 Ga0496117_0108831
634 Ga0496118_0042272
635 Ga0496121_0022968
636 Ga0496122_0318505
637 Ga0496123_0185041
638 Ga0496125_0199246
639 Ga0496125_0341424
640 Ga0496126_0188418
641 Ga0495678_050954
642 Ga0495678_107012
643 Ga0501031_0194066
644 Ga0501032_0032514
645 Ga0501033_0194231
646 Ga0501033_0594386
647 Ga0501036_0075214
648 Ga0501037_0055866
649 Ga0501038_0298151
650 Ga0501039_0374498
651 Ga0501040_0132055
652 Ga0501042_0271136
653 Ga0501043_0507230
654 Ga0501046_0191862
655 Ga0501047_0017553
656 Ga0501047_0673752
657 Ga0501048_0027128
658 Ga0501067_0088083
659 Ga0501067_0162865
660 Ga0501068_0211163
661 Ga0501069_0045005
662 Ga0501070_0025442
663 Ga0501070_0070258
664 Ga0501070_0176058
665 Ga0501070_0189699
666 Ga0501071_0078247
667 Ga0501072_0442173
668 Ga0501074_0765871
669 Ga0501080_0167444
670 Ga0501080_0372367
671 Ga0501080_0698945
672 Ga0501083_0001215
673 Ga0501083_0121405
674 Ga0501035_0044971
675 Ga0501035_0121819
676 Ga0501044_0131483
677 Ga0501044_0163510
678 Ga0501044_0464937
679 Ga0501044_0544685
680 Ga0501045_0023954
681 nmdc:mga03683_292789_c1
682 nmdc:mga0yw44_206091_c1
683 nmdc:mga06z11_424501_c1
684 nmdc:mga08y16_496643_c1
685 Ga0500610_0121623
686 Ga0500578_0209100
687 Ga0500643_013312
688 Ga0500643_054025
689 Ga0500644_0088401
690 Ga0500644_0484985
691 Ga0500646_0024151
692 Ga0500646_0272628
693 Ga0500651_0021939
694 Ga0500651_0484323
695 Ga0500641_0030502
696 Ga0500641_0221965
697 Ga0500650_0016521
698 Ga0500650_0180033
699 Ga0500555_137039
700 Ga0500556_0025608
701 Ga0500556_0161349
702 Ga0500557_002781
703 Ga0500557_138619
704 Ga0500562_005245
705 Ga0500562_088207
706 Ga0500569_042491
707 Ga0500569_155065
708 Ga0500592_001472
709 Ga0500593_090672
710 Ga0500594_0016763
711 Ga0500594_0027044
712 Ga0500642_0000279
713 Ga0500652_008162
714 Ga0500652_193582
715 Ga0500658_0308901
716 Ga0500658_0419291
717 Ga0500568_0000833
718 Ga0500568_0003647
719 Ga0500577_0149213
720 Ga0500588_0127177
721 Ga0500604_0025471
722 Ga0500616_0000429
723 Ga0500619_188290
724 Ga0500622_0006536
725 Ga0500627_0201099
726 Ga0500627_0359797
727 Ga0500633_0007779
728 Ga0500633_0266515
729 Ga0500634_0254651
730 Ga0500636_0040257
731 Ga0500611_004912
732 Ga0500611_072733
733 Ga0500645_025479
734 Ga0500645_034131
735 Ga0500609_027029
736 Ga0587072_077483
737 Ga0501082_0044322
738 Ga0501082_0329720
739 2553004619
740 2819616991
741 2915990927
742 2970085680
743 8003992913
744 8007001974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05015

HigB-like_toxin

RelE-like toxin of type II toxin-antitoxin system HigB

16

106

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yzv-assembly2.cif.gz_XY precleavage 70s structure of the p. vulgaris higb deltah92 toxin bound to the aca codon 0.9345 1 95
4yzv-assembly2.cif.gz_XY precleavage 70s structure of the p. vulgaris higb deltah92 toxin bound to the aca codon 0.9249 1 95
5iwh-assembly1.cif.gz_A structure of p. vulgaris higb toxin delta h92 0.9206 1 98
4px8-assembly1.cif.gz_A structure of p. vulgaris higb toxin 0.8969 1 98
5ixl-assembly7.cif.gz_G structure of p. vulgaris higb toxin y91a variant 0.8909 1 98
ID Description Score Start End Superfamily
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9281 1 94 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8986 4 94 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8708 4 94 3.30.2310.20
af_Q6L4S0_354_647_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8075 65 95 2.130.10.10
af_D3ZWJ9_346_624_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7516 65 94 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A7W7Z6A0-F1-model_v4 Proteic killer suppression protein 0.9906 2 98
AF-Q1NMY5-F1-model_v4 deleted 0.9833 1 98
AF-A0A7Y3Q3Z7-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.98 2 97
AF-A0A6I4KN03-F1-model_v4 deleted 0.9797 1 89
AF-A0A1M3MGA4-F1-model_v4 Plasmid maintenance system killer protein 0.9753 1 98

Map