F426018

General Info

Members Datasets Scaffolds Average Seq Length
372 220 744 189

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100040217|Ga0075429_1000402173
Length 215
Sequence MGGDPDTGRLALTVNTQQDDLMAITDSRVTIHMAASLDGFIARKDGSVDWLETSDEFAGGETMDPEFIAAFLKTIDCYVMGSRTYETALGFEAKGFGWSYGDKPTFVLTSRKLPRIRETVEFHSGDLAQFVNGRLRPKFRSIWFVGGGAVAAECLRLELADEVRYSILPVLIGDGIQFFEKLDRDVALHLAEVKAYKNGMVELRYEVRKHRDESR

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
131 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
139 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
152 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 5.38
Rhizosphere 94.09
Stem 0
Stem Tuber 0
Unclassified 12.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100040217 3300006880 Bacteria 4070
2 CNXas_1000194 3300000545 Bacteria 8992
3 JGI24746J21847_1010083 3300001977 Bacteria 1400
4 Ga0065704_10238596 3300005289 Bacteria 1022
5 Ga0065712_10020526 3300005290 Bacteria 2053
6 Ga0065712_10084699 3300005290 Unclassified 2735
7 Ga0065715_10096735 3300005293 Unclassified 3830
8 Ga0065715_10150349 3300005293 Bacteria 1737
9 Ga0065715_10385152 3300005293 Bacteria 902
10 Ga0065715_10464146 3300005293 Unclassified 813
11 Ga0065707_10023480 3300005295 Bacteria 1621
12 Ga0065707_10083432 3300005295 Bacteria 9212
13 Ga0070676_10018276 3300005328 Bacteria 3882
14 Ga0070676_10196577 3300005328 Bacteria 1320
15 Ga0070683_100002707 3300005329 Bacteria 14154
16 Ga0070683_100389389 3300005329 Bacteria 1329
17 Ga0070670_100076872 3300005331 Bacteria 2868
18 Ga0070670_100092662 3300005331 Bacteria 2598
19 Ga0070670_100548946 3300005331 Bacteria 1031
20 Ga0070670_100753495 3300005331 Bacteria 878
21 Ga0068869_100448927 3300005334 Bacteria 1069
22 Ga0070666_10001435 3300005335 Bacteria 14439
23 Ga0070680_100040449 3300005336 Unclassified 3775
24 Ga0070680_100290652 3300005336 Bacteria 1385
25 Ga0070660_100085718 3300005339 Bacteria 2478
26 Ga0070689_100089054 3300005340 Bacteria 2431
27 Ga0070689_100115144 3300005340 Bacteria 2142
28 Ga0070687_100002501 3300005343 Bacteria 6917
29 Ga0070668_100020875 3300005347 Bacteria 4947
30 Ga0070669_100004571 3300005353 Bacteria 9992
31 Ga0070669_100121989 3300005353 Bacteria 1989
32 Ga0070669_100606288 3300005353 Bacteria 917
33 Ga0070675_100001318 3300005354 Bacteria 18141
34 Ga0070675_100358374 3300005354 Bacteria 1294
35 Ga0070675_100388756 3300005354 Bacteria 1243
36 Ga0070674_100068065 3300005356 Bacteria 2507
37 Ga0070674_100108480 3300005356 Bacteria 2034
38 Ga0070673_100428042 3300005364 Bacteria 1187
39 Ga0070673_100849285 3300005364 Bacteria 845
40 Ga0070688_100094037 3300005365 Bacteria 1964
41 Ga0070688_100207382 3300005365 Bacteria 1374
42 Ga0070688_100223261 3300005365 Bacteria 1329
43 Ga0070667_100052716 3300005367 Bacteria 3433
44 Ga0070667_100070087 3300005367 Bacteria 2984
45 Ga0070667_100086944 3300005367 Bacteria 2683
46 Ga0070714_100303254 3300005435 Bacteria 1489
47 Ga0070714_100329397 3300005435 Bacteria 1430
48 Ga0070713_100063815 3300005436 Bacteria 3090
49 Ga0070713_100296920 3300005436 Bacteria 1486
50 Ga0070711_100148297 3300005439 Bacteria 1766
51 Ga0070711_100192898 3300005439 Bacteria 1567
52 Ga0070700_100568119 3300005441 Bacteria 884
53 Ga0070678_100038748 3300005456 Unclassified 3357
54 Ga0070662_100003687 3300005457 Bacteria 9578
55 Ga0070681_10001308 3300005458 Bacteria 21732
56 Ga0070681_10610369 3300005458 Unclassified 1005
57 Ga0068867_100049451 3300005459 Bacteria 3095
58 Ga0070707_100037387 3300005468 Bacteria 4632
59 Ga0070698_100239420 3300005471 Unclassified 1748
60 Ga0070699_100000005 3300005518 Bacteria 384287
61 Ga0070699_100000036 3300005518 Bacteria 133816
62 Ga0070699_100056578 3300005518 Bacteria 3396
63 Ga0070699_100172316 3300005518 Bacteria 1918
64 Ga0070699_100235246 3300005518 Bacteria 1634
65 Ga0070684_100478107 3300005535 Bacteria 1153
66 Ga0070697_100530138 3300005536 Bacteria 1032
67 Ga0070672_100215386 3300005543 Bacteria 1610
68 Ga0070695_100256678 3300005545 Unclassified 1275
69 Ga0070696_100101539 3300005546 Bacteria 2062
70 Ga0070704_100031942 3300005549 Bacteria 3546
71 Ga0070664_100655346 3300005564 Bacteria 976
72 Ga0068856_100101177 3300005614 Bacteria 2875
73 Ga0068859_100028951 3300005617 Bacteria 5557
74 Ga0068859_100131742 3300005617 Bacteria 2572
75 Ga0068859_100360425 3300005617 Unclassified 1549
76 Ga0068864_100844947 3300005618 Bacteria 902
77 Ga0068861_100105163 3300005719 Bacteria 2253
78 Ga0068861_100228453 3300005719 Bacteria 1577
79 Ga0068861_100566158 3300005719 Bacteria 1038
80 Ga0068863_100945679 3300005841 Unclassified 863
81 Ga0068860_100076902 3300005843 Bacteria 3174
82 Ga0068860_100190989 3300005843 Bacteria 1982
83 Ga0068862_100005497 3300005844 Bacteria 10588
84 Ga0068862_100011204 3300005844 Bacteria 7404
85 Ga0068862_100014975 3300005844 Bacteria 6442
86 Ga0068862_100401305 3300005844 Bacteria 1282
87 Ga0081455_10032907 3300005937 Bacteria 4665
88 Ga0081539_10000544 3300005985 Bacteria 77895
89 Ga0081539_10006479 3300005985 Bacteria 11209
90 Ga0070717_10336309 3300006028 Bacteria 1347
91 Ga0070716_100031834 3300006173 Bacteria 2871
92 Ga0097621_100229597 3300006237 Unclassified 1620
93 Ga0097621_100540158 3300006237 Unclassified 1060
94 Ga0068871_100502322 3300006358 Bacteria 1093
95 Ga0068871_101223425 3300006358 Bacteria 705
96 Ga0075428_100521515 3300006844 Bacteria 1271
97 Ga0075431_100015067 3300006847 Bacteria 7829
98 Ga0075431_100047736 3300006847 Plasmid 4415
99 Ga0075431_100638941 3300006847 Unclassified 1045
100 Ga0075434_100235357 3300006871 Bacteria 1851
101 Ga0075434_100367946 3300006871 Unclassified 1459
102 Ga0075434_101126180 3300006871 Bacteria 798
103 Ga0075429_100210247 3300006880 Bacteria 1705
104 Ga0075429_100240539 3300006880 Bacteria 1586
105 Ga0068865_100098086 3300006881 Bacteria 2140
106 Ga0097620_100028952 3300006931 Bacteria 5557
107 Ga0097620_100131739 3300006931 Bacteria 2572
108 Ga0097620_100360452 3300006931 Unclassified 1549
109 Ga0099795_10026348 3300007788 Bacteria 1958
110 Ga0105240_11070369 3300009093 Bacteria 859
111 Ga0111539_10235686 3300009094 Bacteria 2131
112 Ga0111539_10759493 3300009094 Bacteria 1128
113 Ga0111539_11030811 3300009094 Bacteria 956
114 Ga0111539_11190566 3300009094 Bacteria 885
115 Ga0111539_11420015 3300009094 Unclassified 805
116 Ga0105245_10141974 3300009098 Bacteria 2263
117 Ga0105245_10215449 3300009098 Bacteria 1850
118 Ga0105245_11071859 3300009098 Unclassified 852
119 Ga0105247_10288822 3300009101 Bacteria 1134
120 Ga0114129_10020497 3300009147 Bacteria 9403
121 Ga0114129_10050068 3300009147 Bacteria 5869
122 Ga0114129_10210025 3300009147 Bacteria 2632
123 Ga0114129_10438550 3300009147 Bacteria 1715
124 Ga0114129_11014526 3300009147 Unclassified 1044
125 Ga0105243_10720831 3300009148 Bacteria 974
126 Ga0105242_10013660 3300009176 Bacteria 6280
127 Ga0105242_11122067 3300009176 Bacteria 801
128 Ga0105248_10089823 3300009177 Bacteria 3459
129 Ga0105248_11009951 3300009177 Bacteria 940
130 Ga0105237_10295674 3300009545 Bacteria 1622
131 Ga0105238_10387876 3300009551 Bacteria 1389
132 Ga0105249_10001454 3300009553 Bacteria 20753
133 Ga0105249_10010608 3300009553 Bacteria 8094
134 Ga0105249_10161415 3300009553 Bacteria 2166
135 Ga0105249_10169332 3300009553 Bacteria 2117
136 Ga0105239_10020114 3300010375 Bacteria 7364
137 Ga0105246_10033512 3300011119 Bacteria 3415
138 Ga0157371_10450007 3300013102 Bacteria 947
139 Ga0157369_10590222 3300013105 Unclassified 1147
140 Ga0157374_10113810 3300013296 Bacteria 2604
141 Ga0157374_10137254 3300013296 Bacteria 2372
142 Ga0157378_10002681 3300013297 Bacteria 15862
143 Ga0157378_10013776 3300013297 Bacteria 7073
144 Ga0157378_10364086 3300013297 Bacteria 1416
145 Ga0163162_10025240 3300013306 Bacteria 5872
146 Ga0157372_10253596 3300013307 Unclassified 2043
147 Ga0157375_10005483 3300013308 Bacteria 11032
148 Ga0157375_10170556 3300013308 Unclassified 2323
149 Ga0157375_10421748 3300013308 Bacteria 1500
150 Ga0157375_10423433 3300013308 Bacteria 1497
151 Ga0163163_10013173 3300014325 Bacteria 7556
152 Ga0163163_10625484 3300014325 Bacteria 1140
153 Ga0157380_10454575 3300014326 Bacteria 1231
154 Ga0182008_10442649 3300014497 Unclassified 705
155 Ga0157379_10139636 3300014968 Bacteria 2184
156 Ga0157379_11069654 3300014968 Bacteria 772
157 Ga0157376_10044117 3300014969 Bacteria 3663
158 Ga0157376_10342612 3300014969 Bacteria 1428
159 Ga0182005_1076897 3300015265 Bacteria 919
160 Ga0163161_10322264 3300017792 Bacteria 1222
161 Ga0209233_1011629 3300025261 Bacteria 2589
162 Ga0207673_1011642 3300025290 Bacteria 1140
163 Ga0207697_10000305 3300025315 Bacteria 27530
164 Ga0207682_10012559 3300025893 Bacteria 3305
165 Ga0207688_10364461 3300025901 Bacteria 892
166 Ga0207680_10012327 3300025903 Bacteria 4350
167 Ga0207645_10010498 3300025907 Bacteria 6359
168 Ga0207645_10461409 3300025907 Bacteria 858
169 Ga0207643_10018185 3300025908 Bacteria 3850
170 Ga0207643_10032270 3300025908 Bacteria 2924
171 Ga0207643_10295568 3300025908 Unclassified 1007
172 Ga0207707_10002589 3300025912 Bacteria 16204
173 Ga0207707_10006362 3300025912 Bacteria 10312
174 Ga0207695_10691747 3300025913 Bacteria 900
175 Ga0207660_10026049 3300025917 Unclassified 3978
176 Ga0207660_10230576 3300025917 Bacteria 1456
177 Ga0207662_10006117 3300025918 Bacteria 6474
178 Ga0207657_10046484 3300025919 Bacteria 3801
179 Ga0207652_10016072 3300025921 Bacteria 6104
180 Ga0207646_10021710 3300025922 Bacteria 5926
181 Ga0207646_10067931 3300025922 Bacteria 3183
182 Ga0207681_10002664 3300025923 Bacteria 11317
183 Ga0207681_10323177 3300025923 Bacteria 1228
184 Ga0207659_10012019 3300025926 Bacteria 5486
185 Ga0207687_10165207 3300025927 Bacteria 1702
186 Ga0207687_10390827 3300025927 Bacteria 1142
187 Ga0207700_10045773 3300025928 Bacteria 3232
188 Ga0207700_10567588 3300025928 Bacteria 1008
189 Ga0207706_10000989 3300025933 Bacteria 28922
190 Ga0207709_10429300 3300025935 Bacteria 1017
191 Ga0207670_10120171 3300025936 Bacteria 1908
192 Ga0207704_10028979 3300025938 Bacteria 3080
193 Ga0207704_10097886 3300025938 Bacteria 1947
194 Ga0207704_10384609 3300025938 Bacteria 1102
195 Ga0207665_10113394 3300025939 Bacteria 1907
196 Ga0207691_10049446 3300025940 Bacteria 3852
197 Ga0207711_10141466 3300025941 Bacteria 2165
198 Ga0207689_10031736 3300025942 Bacteria 4395
199 Ga0207679_10586273 3300025945 Bacteria 1003
200 Ga0207679_10753279 3300025945 Bacteria 886
201 Ga0207667_10295587 3300025949 Bacteria 1654
202 Ga0207667_10825298 3300025949 Unclassified 923
203 Ga0207651_11032599 3300025960 Bacteria 735
204 Ga0207712_10002241 3300025961 Bacteria 12587
205 Ga0207712_10038368 3300025961 Bacteria 3275
206 Ga0207712_10049814 3300025961 Bacteria 2921
207 Ga0207712_10095621 3300025961 Bacteria 2197
208 Ga0207712_10138125 3300025961 Bacteria 1867
209 Ga0207668_10002954 3300025972 Bacteria 9963
210 Ga0207668_10354513 3300025972 Bacteria 1228
211 Ga0207658_10015716 3300025986 Bacteria 5196
212 Ga0207658_10168940 3300025986 Bacteria 1800
213 Ga0207658_10580895 3300025986 Bacteria 1005
214 Ga0207677_10123727 3300026023 Bacteria 1951
215 Ga0207677_10151188 3300026023 Bacteria 1791
216 Ga0207641_10090796 3300026088 Bacteria 2672
217 Ga0207641_10254724 3300026088 Bacteria 1641
218 Ga0207641_10332570 3300026088 Bacteria 1444
219 Ga0207675_100114036 3300026118 Bacteria 2552
220 Ga0207675_100276003 3300026118 Bacteria 1632
221 Ga0207675_100316638 3300026118 Bacteria 1523
222 Ga0209995_1033434 3300027471 Bacteria 863
223 Ga0209971_1017619 3300027682 Unclassified 1693
224 Ga0268265_10001321 3300028380 Bacteria 21265
225 Ga0268265_10020643 3300028380 Bacteria 4601
226 Ga0268265_10125834 3300028380 Bacteria 2120
227 Ga0268265_10159173 3300028380 Bacteria 1915
228 Ga0268265_10230507 3300028380 Bacteria 1627
229 Ga0268264_10014861 3300028381 Bacteria 6393
230 Ga0268264_10039218 3300028381 Bacteria 3913
231 Ga0265319_1017283 3300028563 Bacteria 2744
232 Ga0265318_10009406 3300028577 Bacteria 4298
233 Ga0265336_10005776 3300028666 Bacteria 4530
234 Ga0265330_10063328 3300031235 Bacteria 1607
235 Ga0265320_10004014 3300031240 Bacteria 9684
236 Ga0307509_10000044 3300031507 Bacteria 176718
237 Ga0307410_10030358 3300031852 Unclassified 3454
238 Ga0307407_10134260 3300031903 Bacteria 1588
239 Ga0307416_100749609 3300032002 Bacteria 1069
240 Ga0307414_10639308 3300032004 Unclassified 958
241 Ga0373929_0031242 3300035085 Unclassified 1140
242 Ga0373934_0006925 3300035086 Bacteria 4208
243 Ga0373945_0070354 3300035116 Bacteria 1323
244 Ga0373953_0033520 3300035117 Bacteria 2010
245 Ga0373954_0043061 3300035118 Bacteria 2105
246 Ga0373954_0289380 3300035118 Bacteria 808
247 Ga0373924_0456533 3300035410 Unclassified 573
248 Ga0373931_0041917 3300035691 Bacteria 2406
249 Ga0373935_0001703 3300035692 Bacteria 12294
250 Ga0373933_0051093 3300035724 Bacteria 2470
251 Ga0373933_0064112 3300035724 Bacteria 2222
252 Ga0373947_0000021 3300035725 Bacteria 89576
253 Ga0373937_0020413 3300036401 Bacteria 5940
254 Ga0373937_0065874 3300036401 Bacteria 3335
255 Ga0373925_0000404 3300037068 Bacteria 43931
256 Ga0395901_0704841 3300038443 Bacteria 1007
257 Ga0395901_0912412 3300038443 Bacteria 860
258 Ga0451797_1220613 3300041453 Bacteria 836
259 Ga0439435_0035002 3300042436 Bacteria 1383
260 Ga0439435_0062353 3300042436 Bacteria 1088
261 Ga0451577_0153292 3300042876 Bacteria 2074
262 Ga0453683_0015506 3300044673 Bacteria 4935
263 Ga0453683_0350579 3300044673 Bacteria 948
264 Ga0466957_0505755 3300044842 Unclassified 838
265 Ga0451576_0018307 3300045051 Bacteria 7682
266 Ga0451576_0072048 3300045051 Bacteria 3596
267 Ga0466967_0047089 3300045976 Bacteria 3758
268 Ga0495592_0097748 3300046454 Bacteria 2096
269 Ga0495603_0008641 3300046455 Bacteria 6156
270 Ga0495629_0043107 3300046459 Bacteria 3169
271 Ga0495651_0024303 3300046462 Bacteria 4715
272 Ga0495653_0012365 3300046463 Bacteria 6967
273 Ga0495653_0413141 3300046463 Unclassified 855
274 Ga0495653_0575117 3300046463 Bacteria 695
275 Ga0495580_0002768 3300046472 Bacteria 15104
276 Ga0495582_0000297 3300046473 Bacteria 27434
277 Ga0495582_0008015 3300046473 Bacteria 5831
278 Ga0495639_0000027 3300046475 Bacteria 68298
279 Ga0495662_0225989 3300046476 Bacteria 923
280 Ga0495608_0055366 3300046511 Bacteria 2621
281 Ga0495608_0210140 3300046511 Bacteria 1224
282 Ga0495618_0023325 3300046514 Bacteria 3825
283 Ga0495628_0037755 3300046516 Bacteria 3871
284 Ga0495630_0212015 3300046517 Bacteria 1478
285 Ga0495630_0218560 3300046517 Unclassified 1455
286 Ga0495652_0021309 3300046529 Bacteria 5762
287 Ga0495652_0315741 3300046529 Bacteria 1131
288 Ga0495665_0000010 3300046531 Bacteria 71277
289 Ga0495586_0472596 3300046535 Bacteria 723
290 Ga0495587_0005374 3300046536 Bacteria 8377
291 Ga0495587_0289443 3300046536 Unclassified 917
292 Ga0495645_0020527 3300046543 Bacteria 4768
293 Ga0495633_0228288 3300046558 Bacteria 851
294 Ga0495635_0067044 3300046663 Bacteria 2462
295 Ga0495635_0116209 3300046663 Bacteria 1826
296 Ga0495659_0100418 3300046664 Bacteria 1120
297 Ga0495588_0000379 3300046674 Bacteria 25812
298 Ga0495599_0009813 3300046678 Bacteria 5860
299 Ga0495623_0044234 3300046679 Bacteria 2830
300 Ga0495658_0000072 3300046683 Bacteria 52083
301 Ga0495613_0031155 3300046689 Bacteria 3961
302 Ga0495613_0607621 3300046689 Unclassified 727
303 Ga0495670_0196072 3300046691 Bacteria 1069
304 Ga0495600_0153061 3300046809 Bacteria 1493
305 Ga0495600_0292421 3300046809 Bacteria 1029
306 Ga0495600_0491731 3300046809 Bacteria 755
307 Ga0495581_0000086 3300047315 Bacteria 37647
308 Ga0495581_0024400 3300047315 Plasmid 3504
309 Ga0495581_0285540 3300047315 Bacteria 965
310 Ga0495604_0017293 3300047317 Bacteria 5771
311 Ga0495676_0242300 3300047321 Bacteria 1234
312 Ga0495676_0728512 3300047321 Bacteria 641
313 Ga0495675_0027791 3300047444 Bacteria 3605
314 Ga0495675_0121066 3300047444 Bacteria 1630
315 Ga0495684_0018138 3300047471 Bacteria 5424
316 Ga0495684_0026957 3300047471 Bacteria 4415
317 Ga0495684_0484587 3300047471 Bacteria 853
318 Ga0495593_0000651 3300047673 Bacteria 19979
319 Ga0495602_0048313 3300048088 Bacteria 3825
320 Ga0495602_0644543 3300048088 Unclassified 724
321 Ga0495614_0000022 3300048089 Bacteria 44200
322 Ga0496100_0229729 3300048903 Bacteria 1365
323 Ga0496100_0644439 3300048903 Unclassified 825
324 Ga0496101_0472114 3300048904 Bacteria 990
325 Ga0496102_0151270 3300048905 Bacteria 2181
326 Ga0496102_0265630 3300048905 Unclassified 1618
327 Ga0496104_0072731 3300048907 Bacteria 3270
328 Ga0496105_0131309 3300048908 Bacteria 2065
329 Ga0496105_0297966 3300048908 Unclassified 1297
330 Ga0496105_0690419 3300048908 Bacteria 784
331 Ga0496107_0281531 3300048910 Bacteria 1238
332 Ga0496108_0617848 3300048911 Bacteria 944
333 Ga0496109_0000027 3300048912 Bacteria 169870
334 Ga0496109_0760245 3300048912 Bacteria 907
335 Ga0496112_0194447 3300048915 Bacteria 1990
336 Ga0496112_0346825 3300048915 Bacteria 1428
337 Ga0496112_1139542 3300048915 Bacteria 698
338 Ga0496115_0217371 3300048918 Bacteria 1577
339 Ga0496115_0387113 3300048918 Bacteria 1136
340 Ga0496115_0398541 3300048918 Bacteria 1117
341 Ga0501039_0413754 3300049575 Bacteria 1059
342 Ga0501067_0239556 3300049583 Unclassified 1010
343 Ga0501247_001963 3300049677 Bacteria 2085
344 Ga0501080_0188468 3300049742 Bacteria 1896
345 Ga0501045_0106112 3300049824 Bacteria 2082
346 nmdc:mga05p37_19363_c1 3300050507 Bacteria 8233
347 nmdc:mga05p37_273670_c1 3300050507 Bacteria 2017
348 nmdc:mga05p37_39819_c1 3300050507 Bacteria 5771
349 nmdc:mga05p37_497525_c1 3300050507 Bacteria 1400
350 nmdc:mga09592_192002_c1 3300050508 Unclassified 1768
351 nmdc:mga09592_305886_c1 3300050508 Bacteria 1378
352 nmdc:mga09592_831211_c1 3300050508 Bacteria 780
353 nmdc:mga0qj67_397108_c1 3300050509 Unclassified 1113
354 nmdc:mga06r32_19414_c1 3300050510 Bacteria 6238
355 nmdc:mga06r32_286459_c1 3300050510 Bacteria 1634
356 nmdc:mga06r32_293849_c1 3300050510 Unclassified 1611
357 nmdc:mga06r32_508667_c1 3300050510 Bacteria 1181
358 nmdc:mga08y16_1027676_c1 3300050511 Unclassified 803
359 nmdc:mga08y16_14803_c1 3300050511 Bacteria 8202
360 nmdc:mga08y16_793311_c1 3300050511 Bacteria 940
361 nmdc:mga0n895_124495_c1 3300050512 Bacteria 2601
362 nmdc:mga0n895_355661_c1 3300050512 Unclassified 1483
363 nmdc:mga0n895_782569_c1 3300050512 Bacteria 945
364 nmdc:mga08x19_285281_c1 3300050514 Bacteria 1145
365 nmdc:mga08x19_3743_c1 3300050514 Bacteria 9058
366 Ga0495601_0326481 3300053077 Unclassified 999
367 Ga0495612_0027932 3300053078 Bacteria 2270
368 Ga0495595_0024413 3300053084 Bacteria 2671
369 Ga0495619_0042839 3300053085 Bacteria 2966
370 Ga0495619_0051880 3300053085 Bacteria 2711
371 Ga0495619_0200611 3300053085 Bacteria 1381
372 Ga0530510_0014899 3300061734 Bacteria 5491
373 Ga0075429_100040217
374 CNXas_1000194
375 JGI24746J21847_1010083
376 Ga0065704_10238596
377 Ga0065712_10020526
378 Ga0065712_10084699
379 Ga0065715_10096735
380 Ga0065715_10150349
381 Ga0065715_10385152
382 Ga0065715_10464146
383 Ga0065707_10023480
384 Ga0065707_10083432
385 Ga0070676_10018276
386 Ga0070676_10196577
387 Ga0070683_100002707
388 Ga0070683_100389389
389 Ga0070670_100076872
390 Ga0070670_100092662
391 Ga0070670_100548946
392 Ga0070670_100753495
393 Ga0068869_100448927
394 Ga0070666_10001435
395 Ga0070680_100040449
396 Ga0070680_100290652
397 Ga0070660_100085718
398 Ga0070689_100089054
399 Ga0070689_100115144
400 Ga0070687_100002501
401 Ga0070668_100020875
402 Ga0070669_100004571
403 Ga0070669_100121989
404 Ga0070669_100606288
405 Ga0070675_100001318
406 Ga0070675_100358374
407 Ga0070675_100388756
408 Ga0070674_100068065
409 Ga0070674_100108480
410 Ga0070673_100428042
411 Ga0070673_100849285
412 Ga0070688_100094037
413 Ga0070688_100207382
414 Ga0070688_100223261
415 Ga0070667_100052716
416 Ga0070667_100070087
417 Ga0070667_100086944
418 Ga0070714_100303254
419 Ga0070714_100329397
420 Ga0070713_100063815
421 Ga0070713_100296920
422 Ga0070711_100148297
423 Ga0070711_100192898
424 Ga0070700_100568119
425 Ga0070678_100038748
426 Ga0070662_100003687
427 Ga0070681_10001308
428 Ga0070681_10610369
429 Ga0068867_100049451
430 Ga0070707_100037387
431 Ga0070698_100239420
432 Ga0070699_100000005
433 Ga0070699_100000036
434 Ga0070699_100056578
435 Ga0070699_100172316
436 Ga0070699_100235246
437 Ga0070684_100478107
438 Ga0070697_100530138
439 Ga0070672_100215386
440 Ga0070695_100256678
441 Ga0070696_100101539
442 Ga0070704_100031942
443 Ga0070664_100655346
444 Ga0068856_100101177
445 Ga0068859_100028951
446 Ga0068859_100131742
447 Ga0068859_100360425
448 Ga0068864_100844947
449 Ga0068861_100105163
450 Ga0068861_100228453
451 Ga0068861_100566158
452 Ga0068863_100945679
453 Ga0068860_100076902
454 Ga0068860_100190989
455 Ga0068862_100005497
456 Ga0068862_100011204
457 Ga0068862_100014975
458 Ga0068862_100401305
459 Ga0081455_10032907
460 Ga0081539_10000544
461 Ga0081539_10006479
462 Ga0070717_10336309
463 Ga0070716_100031834
464 Ga0097621_100229597
465 Ga0097621_100540158
466 Ga0068871_100502322
467 Ga0068871_101223425
468 Ga0075428_100521515
469 Ga0075431_100015067
470 Ga0075431_100047736
471 Ga0075431_100638941
472 Ga0075434_100235357
473 Ga0075434_100367946
474 Ga0075434_101126180
475 Ga0075429_100210247
476 Ga0075429_100240539
477 Ga0068865_100098086
478 Ga0097620_100028952
479 Ga0097620_100131739
480 Ga0097620_100360452
481 Ga0099795_10026348
482 Ga0105240_11070369
483 Ga0111539_10235686
484 Ga0111539_10759493
485 Ga0111539_11030811
486 Ga0111539_11190566
487 Ga0111539_11420015
488 Ga0105245_10141974
489 Ga0105245_10215449
490 Ga0105245_11071859
491 Ga0105247_10288822
492 Ga0114129_10020497
493 Ga0114129_10050068
494 Ga0114129_10210025
495 Ga0114129_10438550
496 Ga0114129_11014526
497 Ga0105243_10720831
498 Ga0105242_10013660
499 Ga0105242_11122067
500 Ga0105248_10089823
501 Ga0105248_11009951
502 Ga0105237_10295674
503 Ga0105238_10387876
504 Ga0105249_10001454
505 Ga0105249_10010608
506 Ga0105249_10161415
507 Ga0105249_10169332
508 Ga0105239_10020114
509 Ga0105246_10033512
510 Ga0157371_10450007
511 Ga0157369_10590222
512 Ga0157374_10113810
513 Ga0157374_10137254
514 Ga0157378_10002681
515 Ga0157378_10013776
516 Ga0157378_10364086
517 Ga0163162_10025240
518 Ga0157372_10253596
519 Ga0157375_10005483
520 Ga0157375_10170556
521 Ga0157375_10421748
522 Ga0157375_10423433
523 Ga0163163_10013173
524 Ga0163163_10625484
525 Ga0157380_10454575
526 Ga0182008_10442649
527 Ga0157379_10139636
528 Ga0157379_11069654
529 Ga0157376_10044117
530 Ga0157376_10342612
531 Ga0182005_1076897
532 Ga0163161_10322264
533 Ga0209233_1011629
534 Ga0207673_1011642
535 Ga0207697_10000305
536 Ga0207682_10012559
537 Ga0207688_10364461
538 Ga0207680_10012327
539 Ga0207645_10010498
540 Ga0207645_10461409
541 Ga0207643_10018185
542 Ga0207643_10032270
543 Ga0207643_10295568
544 Ga0207707_10002589
545 Ga0207707_10006362
546 Ga0207695_10691747
547 Ga0207660_10026049
548 Ga0207660_10230576
549 Ga0207662_10006117
550 Ga0207657_10046484
551 Ga0207652_10016072
552 Ga0207646_10021710
553 Ga0207646_10067931
554 Ga0207681_10002664
555 Ga0207681_10323177
556 Ga0207659_10012019
557 Ga0207687_10165207
558 Ga0207687_10390827
559 Ga0207700_10045773
560 Ga0207700_10567588
561 Ga0207706_10000989
562 Ga0207709_10429300
563 Ga0207670_10120171
564 Ga0207704_10028979
565 Ga0207704_10097886
566 Ga0207704_10384609
567 Ga0207665_10113394
568 Ga0207691_10049446
569 Ga0207711_10141466
570 Ga0207689_10031736
571 Ga0207679_10586273
572 Ga0207679_10753279
573 Ga0207667_10295587
574 Ga0207667_10825298
575 Ga0207651_11032599
576 Ga0207712_10002241
577 Ga0207712_10038368
578 Ga0207712_10049814
579 Ga0207712_10095621
580 Ga0207712_10138125
581 Ga0207668_10002954
582 Ga0207668_10354513
583 Ga0207658_10015716
584 Ga0207658_10168940
585 Ga0207658_10580895
586 Ga0207677_10123727
587 Ga0207677_10151188
588 Ga0207641_10090796
589 Ga0207641_10254724
590 Ga0207641_10332570
591 Ga0207675_100114036
592 Ga0207675_100276003
593 Ga0207675_100316638
594 Ga0209995_1033434
595 Ga0209971_1017619
596 Ga0268265_10001321
597 Ga0268265_10020643
598 Ga0268265_10125834
599 Ga0268265_10159173
600 Ga0268265_10230507
601 Ga0268264_10014861
602 Ga0268264_10039218
603 Ga0265319_1017283
604 Ga0265318_10009406
605 Ga0265336_10005776
606 Ga0265330_10063328
607 Ga0265320_10004014
608 Ga0307509_10000044
609 Ga0307410_10030358
610 Ga0307407_10134260
611 Ga0307416_100749609
612 Ga0307414_10639308
613 Ga0373929_0031242
614 Ga0373934_0006925
615 Ga0373945_0070354
616 Ga0373953_0033520
617 Ga0373954_0043061
618 Ga0373954_0289380
619 Ga0373924_0456533
620 Ga0373931_0041917
621 Ga0373935_0001703
622 Ga0373933_0051093
623 Ga0373933_0064112
624 Ga0373947_0000021
625 Ga0373937_0020413
626 Ga0373937_0065874
627 Ga0373925_0000404
628 Ga0395901_0704841
629 Ga0395901_0912412
630 Ga0451797_1220613
631 Ga0439435_0035002
632 Ga0439435_0062353
633 Ga0451577_0153292
634 Ga0453683_0015506
635 Ga0453683_0350579
636 Ga0466957_0505755
637 Ga0451576_0018307
638 Ga0451576_0072048
639 Ga0466967_0047089
640 Ga0495592_0097748
641 Ga0495603_0008641
642 Ga0495629_0043107
643 Ga0495651_0024303
644 Ga0495653_0012365
645 Ga0495653_0413141
646 Ga0495653_0575117
647 Ga0495580_0002768
648 Ga0495582_0000297
649 Ga0495582_0008015
650 Ga0495639_0000027
651 Ga0495662_0225989
652 Ga0495608_0055366
653 Ga0495608_0210140
654 Ga0495618_0023325
655 Ga0495628_0037755
656 Ga0495630_0212015
657 Ga0495630_0218560
658 Ga0495652_0021309
659 Ga0495652_0315741
660 Ga0495665_0000010
661 Ga0495586_0472596
662 Ga0495587_0005374
663 Ga0495587_0289443
664 Ga0495645_0020527
665 Ga0495633_0228288
666 Ga0495635_0067044
667 Ga0495635_0116209
668 Ga0495659_0100418
669 Ga0495588_0000379
670 Ga0495599_0009813
671 Ga0495623_0044234
672 Ga0495658_0000072
673 Ga0495613_0031155
674 Ga0495613_0607621
675 Ga0495670_0196072
676 Ga0495600_0153061
677 Ga0495600_0292421
678 Ga0495600_0491731
679 Ga0495581_0000086
680 Ga0495581_0024400
681 Ga0495581_0285540
682 Ga0495604_0017293
683 Ga0495676_0242300
684 Ga0495676_0728512
685 Ga0495675_0027791
686 Ga0495675_0121066
687 Ga0495684_0018138
688 Ga0495684_0026957
689 Ga0495684_0484587
690 Ga0495593_0000651
691 Ga0495602_0048313
692 Ga0495602_0644543
693 Ga0495614_0000022
694 Ga0496100_0229729
695 Ga0496100_0644439
696 Ga0496101_0472114
697 Ga0496102_0151270
698 Ga0496102_0265630
699 Ga0496104_0072731
700 Ga0496105_0131309
701 Ga0496105_0297966
702 Ga0496105_0690419
703 Ga0496107_0281531
704 Ga0496108_0617848
705 Ga0496109_0000027
706 Ga0496109_0760245
707 Ga0496112_0194447
708 Ga0496112_0346825
709 Ga0496112_1139542
710 Ga0496115_0217371
711 Ga0496115_0387113
712 Ga0496115_0398541
713 Ga0501039_0413754
714 Ga0501067_0239556
715 Ga0501247_001963
716 Ga0501080_0188468
717 Ga0501045_0106112
718 nmdc:mga05p37_19363_c1
719 nmdc:mga05p37_273670_c1
720 nmdc:mga05p37_39819_c1
721 nmdc:mga05p37_497525_c1
722 nmdc:mga09592_192002_c1
723 nmdc:mga09592_305886_c1
724 nmdc:mga09592_831211_c1
725 nmdc:mga0qj67_397108_c1
726 nmdc:mga06r32_19414_c1
727 nmdc:mga06r32_286459_c1
728 nmdc:mga06r32_293849_c1
729 nmdc:mga06r32_508667_c1
730 nmdc:mga08y16_1027676_c1
731 nmdc:mga08y16_14803_c1
732 nmdc:mga08y16_793311_c1
733 nmdc:mga0n895_124495_c1
734 nmdc:mga0n895_355661_c1
735 nmdc:mga0n895_782569_c1
736 nmdc:mga08x19_285281_c1
737 nmdc:mga08x19_3743_c1
738 Ga0495601_0326481
739 Ga0495612_0027932
740 Ga0495595_0024413
741 Ga0495619_0042839
742 Ga0495619_0051880
743 Ga0495619_0200611
744 Ga0530510_0014899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

97

202

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kp2-assembly1.cif.gz_A quadruple mutant plasmodium falciparum dihydrofolate reductase complexed with b10042 0.7012 45 135
1j3i-assembly1.cif.gz_B wild-type plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with wr99210, nadph, and dump 0.6929 45 135
1j3k-assembly1.cif.gz_B quadruple mutant (n51i+c59r+s108n+i164l) plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with wr99210, nadph, and dump 0.689 45 135
7f3z-assembly1.cif.gz_A double mutant plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts-k1, c59r+s108n) complexed with trimethoprim (top), nadph and dump 0.6838 44 135
3qgt-assembly1.cif.gz_A crystal structure of wild-type pfdhfr-ts complexed with nadph, dump and pyrimethamine 0.683 44 135
ID Description Score Start End Superfamily
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.6396 2 141 3.40.430.10
af_Q06417_60_286_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6147 42 114 3.40.50.720
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.6001 2 141 3.40.430.10
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.5934 28 154 3.40.430.10
4dpdA01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.5904 45 142 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A2V5YD78-F1-model_v4 Deaminase 0.7908 1 115
AF-A0A2V9P211-F1-model_v4 Deaminase 0.7726 1 132 GO:0008703
GO:0009231
AF-A0A1I6ZGK6-F1-model_v4 Uncharacterized conserved protein 0.7565 31 141 GO:0008703
GO:0009231
AF-A0A6G6WH84-F1-model_v4 Dihydrofolate reductase family protein 0.7464 34 135 GO:0008703
GO:0009231
AF-H8IKP3-F1-model_v4 Deaminase-reductase domain protein 0.7276 38 140 GO:0008703
GO:0009231

Map